BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate
reductase subunit alpha [Candidatus Liberibacter asiaticus str. psy62]
         (954 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254282207|ref|ZP_04957175.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [gamma proteobacterium NOR51-B]
 gi|219678410|gb|EED34759.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [gamma proteobacterium NOR51-B]
          Length = 961

 Score = 1027 bits (2654), Expect = 0.0,   Method: Composition-based stats.
 Identities = 560/956 (58%), Positives = 711/956 (74%), Gaps = 10/956 (1%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P++        + P  +         ++VIKRNG V +F+ SK+S AI KAF+AVEG  A
Sbjct: 12  PTRSNPIPTT-SNPGASPLAATAPGQLRVIKRNGTVVAFEDSKVSVAITKAFLAVEGGTA 70

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S R+ + +  LTEQ V    +   S   +HIEDIQDQVE +LM++G HKI R+YV+YR
Sbjct: 71  AASSRIHETVAKLTEQVVATFKRRMPSGGTIHIEDIQDQVELALMRAGEHKIARDYVIYR 130

Query: 123 EERSDVRAAQSHSKSD-APIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIV 181
           E R+  RAA++    +    A ++ ++  DG+    + +R+  IV EAC GL DVS   +
Sbjct: 131 EARAQERAAKAALSPESQQAAERINVVQADGSRSPLDIERVRTIVAEACEGLADVSEAAI 190

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           + E  +N+YDG++  ++ TAL+ ++RTLIE+EPNY+   AR LL+ LR E L +     +
Sbjct: 191 IDEALRNLYDGVAAEEVSTALVITARTLIEQEPNYSYAAARLLLDNLRAEGL-SFMGVAE 249

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
            AT  +M   YP     +I+ G++  LL   + DFDL  L + L  ERD  F YLGLQ L
Sbjct: 250 LATQQDMTIHYPAALKAFIKRGIELELLAPDLQDFDLEELGSALLPERDLQFSYLGLQTL 309

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYF+H + +R E+PQ FFMRVAMGLA +E  K  RA+EFY LLSSF +M STPTLFN+
Sbjct: 310 YDRYFIHSDNTRFELPQIFFMRVAMGLAAREEAKNARAIEFYRLLSSFDYMSSTPTLFNA 369

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT  PQLSSC+LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LGA+I GTNGKS
Sbjct: 370 GTLRPQLSSCYLTTVPDDLFGIYGAIQDNAMLSKFAGGLGNDWTPVRALGAYIKGTNGKS 429

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QG++PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT
Sbjct: 430 QGIVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNT 489

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFMKRV  +  WTLFSP++V DLHDLYGK FE  Y+ YE  A  GE+K+ + + 
Sbjct: 490 ANWIPDLFMKRVFDDGDWTLFSPNDVPDLHDLYGKAFEERYQQYEAMAASGELKLHKTLK 549

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A +LWRKML M+FETGHPW+TFKDPCN+RSPQQH GVVHSSNLCTEITLN+S++E AVCN
Sbjct: 550 AQSLWRKMLGMIFETGHPWMTFKDPCNLRSPQQHCGVVHSSNLCTEITLNTSADEIAVCN 609

Query: 602 LGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLM 661
           LGS+NL  H  N   + DKL STIRTA+R+LDNVIDIN +++ +A++SN  HR IG+G+M
Sbjct: 610 LGSVNLPQHIENGVLNLDKLRSTIRTAIRMLDNVIDINYYSVPQAEQSNFRHRPIGMGVM 669

Query: 662 GFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVF 721
           GFQ AL+ L + Y S +AV  AD+SME IS++AI AS ELA+ERG+YSS++GSLW QG+F
Sbjct: 670 GFQDALYKLDVAYGSDQAVSFADQSMEAISYYAIEASSELAEERGSYSSYEGSLWSQGIF 729

Query: 722 PIDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
           P DS+ LL + R    + +NR   + W  LK +V   GMRNSN MAIAPTATIANI GVS
Sbjct: 730 PHDSLDLLIQHRGEDYIQVNRDQSMDWAPLKAKVAANGMRNSNVMAIAPTATIANITGVS 789

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
           QSI+P+YQNLYVKSN+SG+FTVVN +LV +LK R LWD+ M++DLKY+DGS+  I+RIPD
Sbjct: 790 QSIEPTYQNLYVKSNLSGEFTVVNPYLVKDLKARGLWDKVMVNDLKYYDGSVQAIDRIPD 849

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
           DLK  +ATAFE++P WL++SASRRQKWIDQAQSLNLY++  SGKKLD  YR AW  GLKT
Sbjct: 850 DLKAKYATAFEVEPRWLVDSASRRQKWIDQAQSLNLYINNASGKKLDVTYRMAWFNGLKT 909

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           TYYLRS +AT  EKST++   GKLNAV     +++     +P +C+  D +CE CQ
Sbjct: 910 TYYLRSLAATGTEKSTVE--SGKLNAVSSG--SATPQPAPVPQACSLDDPDCEACQ 961


>gi|300022336|ref|YP_003754947.1| ribonucleoside-diphosphate reductase, subunit alpha [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299524157|gb|ADJ22626.1| ribonucleoside-diphosphate reductase, alpha subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 956

 Score = 1026 bits (2652), Expect = 0.0,   Method: Composition-based stats.
 Identities = 595/944 (63%), Positives = 721/944 (76%), Gaps = 6/944 (0%)

Query: 15  FPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKN 74
             S   P        QVI+RNG VT FD SKIS A+ KAF+AVEG  A+ S RV + +  
Sbjct: 15  SSSTGIPKATVDPVFQVIRRNGSVTPFDASKISVALTKAFLAVEGGRAAASRRVHETVDG 74

Query: 75  LTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSH 134
           LT Q V  L +        HIE+IQDQVE +LM+  HHK+ R YVLYREER   RAA   
Sbjct: 75  LTSQIVVALTRRGVQERTFHIEEIQDQVELALMRGEHHKVARAYVLYREERKRERAA--E 132

Query: 135 SKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLS 194
           + +  P  P + +   DG+L   ++ RL  ++EE+C+GL DVS++ +LSET +N+YDG++
Sbjct: 133 TAAPIPTMPSISVKSKDGSLAPLDAARLRKLIEESCAGLADVSAEAILSETQRNLYDGIT 192

Query: 195 ESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPE 254
             +L  A + ++RTLIE EPNY  VTAR L++KLRRE L+ V  +  +A   EM   YPE
Sbjct: 193 RDELADAPVLAARTLIETEPNYTFVTARLLMDKLRREALSFVAGRTDEARQSEMGERYPE 252

Query: 255 YFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRI 314
           YF  +I +G+ A LL   +  FDL  L   LK ERD  F+YLGLQ LYDRYFL  +G R 
Sbjct: 253 YFRAFIAKGIVADLLDPELARFDLDRLGGALKPERDGIFQYLGLQTLYDRYFLQTHGIRF 312

Query: 315 EMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLT 374
           E+PQAFFMRVAMGLAL+E ++E +A+EFY+L+S+F FMCSTPTLFN+GT  PQLSSCFLT
Sbjct: 313 ELPQAFFMRVAMGLALREIDREAKAIEFYDLISTFDFMCSTPTLFNAGTPRPQLSSCFLT 372

Query: 375 TVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDT 434
           TVPDDL GIF ++++NA+LAKYSGGLGNDWT VRGLGAHI GTNG+SQGV+PFLKVANDT
Sbjct: 373 TVPDDLDGIFKSIKDNALLAKYSGGLGNDWTRVRGLGAHIKGTNGESQGVVPFLKVANDT 432

Query: 435 AVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVT 494
           A+AVNQGGKRKGAVCAYLETWHID+EEFLDLRKN GDDRRRTHDMNTA+WIPDLFM+RV 
Sbjct: 433 AIAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNAGDDRRRTHDMNTAHWIPDLFMQRVA 492

Query: 495 QNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLF 554
           ++  WTLFSPDE  DLHDLYG  F   YE YE +A+R E+KV R++ AV LWR+MLTMLF
Sbjct: 493 EDGQWTLFSPDETPDLHDLYGTAFAERYEAYEEKAERMEMKVARRVRAVDLWRRMLTMLF 552

Query: 555 ETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN 614
           ETGHPWITFKDPCN+RSPQQH G+VHSSNLC EITLN+S++E AVCNLGSINL+AH  N+
Sbjct: 553 ETGHPWITFKDPCNLRSPQQHCGIVHSSNLCAEITLNTSNDEVAVCNLGSINLVAHVTND 612

Query: 615 QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPY 674
             D+DKL  T++TA+R+LDNVIDIN +TI +A++SN  HR +G+GLMGFQ AL  L I Y
Sbjct: 613 GVDFDKLERTVKTAMRMLDNVIDINFYTIPEARRSNLRHRPVGMGLMGFQDALQALRINY 672

Query: 675 ASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD 734
            S EAV  AD SME ISFHAISASV+LA ERG Y SF GSLW QG+ PIDSI LL   R 
Sbjct: 673 GSEEAVAFADTSMEAISFHAISASVDLAAERGRYPSFDGSLWSQGILPIDSIELLKSARG 732

Query: 735 -ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS 793
            +L ++ +S L WD L+ RV+T GMRNSN MAIAPTATI+NICGV+QSI+P+++NLYVKS
Sbjct: 733 TDLRLDTSSTLDWDGLRDRVRTTGMRNSNTMAIAPTATISNICGVAQSIEPAFRNLYVKS 792

Query: 794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDP 853
           NMSGDFTVVN FLV +LK R LWDE MISDLKY DGS+G I+RIP+DLK ++ATAFEID 
Sbjct: 793 NMSGDFTVVNPFLVRDLKARGLWDEVMISDLKYFDGSLGAIDRIPEDLKALYATAFEIDA 852

Query: 854 MWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK 913
            WL+++A+RRQKWIDQ QSLNLY+  P+G+KLD +YR AW  GLKTTYYLRS+SAT VEK
Sbjct: 853 HWLVDAAARRQKWIDQGQSLNLYIAAPNGRKLDALYRLAWERGLKTTYYLRSQSATHVEK 912

Query: 914 STLKGVDGKLNAVPVTDPNSSTHSLGI---PSSCTSDTECEVCQ 954
           STLKG DGKLNAV  +  +S+  ++      +    D  CE CQ
Sbjct: 913 STLKGTDGKLNAVSSSVHHSAPENIEAMAGKACLIDDPTCEACQ 956


>gi|254239526|ref|ZP_04932848.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa 2192]
 gi|126192904|gb|EAZ56967.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa 2192]
          Length = 963

 Score = 1022 bits (2641), Expect = 0.0,   Method: Composition-based stats.
 Identities = 558/960 (58%), Positives = 703/960 (73%), Gaps = 17/960 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +       D+   LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QASAPQAADSSQDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D ++ LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YRE 
Sbjct: 68  SSRIHDTVRRLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYREA 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  R     +   A   P ++I   DG+L   +  RL  I+ EAC GL +V   ++  E
Sbjct: 128 RAAERKNAGAASDVAQPHPSIRITRADGSLSPLDMGRLNTIISEACEGLAEVDGALIERE 187

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++E D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L       + AT
Sbjct: 188 TLKNLYDGVAEKDVNTALVMTARTLVEREPNYSYVTARLLMDTLRAEALG-FLGVAESAT 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    YIE+G +  L+   + +FDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 247 HHEMAELYAKALPAYIEKGAEFELVDAKLKEFDLEKLGKAIDHERDQQFTYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLA++E ++E R +EFYNLLSSF +M STPTLFN+GT 
Sbjct: 307 YFIHKDGIRFELPQIFFMRVAMGLAIEEKDREARTIEFYNLLSSFDYMSSTPTLFNAGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+GA+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 367 RPQLSSCYLTTVPDDLSGIYGAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV  +  WTLFSP +V DLHDLYGK FE  YE YE  A  G++K+ + + A  
Sbjct: 487 IPDLFMKRVFDDGSWTLFSPSDVPDLHDLYGKAFEERYEYYEALASYGKLKLHKVVQAKD 546

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS
Sbjct: 547 LWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGS 606

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
           INL+ H  + + D  KL  T++TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ
Sbjct: 607 INLVNHIVDGKLDTAKLEKTVKTAVRMLDNVIDINYYSVPQAQNSNFKHRPVGLGIMGFQ 666

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            AL+L HIPY S  A+  AD+SME IS++AI AS +LA ERGAY +F+GSLW QG+ PID
Sbjct: 667 DALYLQHIPYGSDAAIAFADQSMEAISYYAIQASCDLADERGAYQTFQGSLWSQGILPID 726

Query: 725 SIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSI 782
           S   L E R    + ++ +  L W  L++RV+  G+RNSN MAIAPTATIANI GVSQSI
Sbjct: 727 SEKKLIEERGAKYIEVDLSETLDWAPLRERVQK-GIRNSNIMAIAPTATIANITGVSQSI 785

Query: 783 DPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLK 842
           +P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  M++DLKY+DGS+  IERIP DLK
Sbjct: 786 EPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDPVMVNDLKYYDGSVQQIERIPQDLK 845

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYY 902
            ++ATAFE++  W++E+ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYY
Sbjct: 846 DLYATAFEVETRWIVEAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWFRGLKTTYY 905

Query: 903 LRSRSATSVEKSTLKGVDGKLNAVPV-------TDPNSSTHSLGIPSSCTSD-TECEVCQ 954
           LR+ +ATS EKST+    GKLNAV           P +      +P +C+ D  +CE CQ
Sbjct: 906 LRALAATSTEKSTIN--TGKLNAVSAGGNDGLQATPAAEPKPAPVPQACSIDNPDCEACQ 963


>gi|75677069|ref|YP_319490.1| ribonucleotide-diphosphate reductase subunit alpha [Nitrobacter
           winogradskyi Nb-255]
 gi|74421939|gb|ABA06138.1| ribonucleotide reductase large subunit [Nitrobacter winogradskyi
           Nb-255]
          Length = 969

 Score = 1021 bits (2640), Expect = 0.0,   Method: Composition-based stats.
 Identities = 605/969 (62%), Positives = 741/969 (76%), Gaps = 15/969 (1%)

Query: 1   MHPSKDVNKGDEDAFPSL--AYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVE 58
           M  + +         PSL  A   P      QVI+RNG V+ FD +KI+ A+ KAF+AVE
Sbjct: 1   MSAATETVPAARIVRPSLSAAATAPSSEPACQVIRRNGSVSPFDSAKIAVALTKAFLAVE 60

Query: 59  GKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREY 118
           G  A+ S RV DI+  LT+Q V  L + + +    HIEDIQDQVE +LM+S HHK+ R Y
Sbjct: 61  GNSAAASRRVHDIVTGLTDQIVASLTRRSDAGRTFHIEDIQDQVELALMRSEHHKVARAY 120

Query: 119 VLYREERSDVRAAQSHSKSDAPIAPK----LKIMMDDGTLISFNSKRLEMIVEEACSGLQ 174
           VLYREER+  RA    SKS    A      L++   DG+LI+ ++ RL  +VEEAC+GL 
Sbjct: 121 VLYREERARERAKAQESKSKKGGAAAAKAALRMKSADGSLIALDTPRLTAVVEEACAGLG 180

Query: 175 DVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLT 234
           DVS+  +L+ET++N+YDG+S  +L  A I ++RTL+E +P+YAKV+AR LL+K+RRE L+
Sbjct: 181 DVSASAILTETHRNLYDGISVDELAQAPILAARTLVETDPDYAKVSARLLLDKMRREALS 240

Query: 235 TVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFE 294
            V  + ++AT  EM   Y +YF  Y+  G+   LL   +  FDL  LA  LK ERD  F+
Sbjct: 241 FVAGRLEQATQAEMAERYADYFLSYVRAGIDHELLDPEIGRFDLDRLAAALKPERDLRFD 300

Query: 295 YLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCS 354
           YLGLQ LYDRYFLH+   R E+PQAFFMRVA GLAL+E ++E++A+ FY+LLSSF FM S
Sbjct: 301 YLGLQTLYDRYFLHVRSVRFELPQAFFMRVACGLALREIDREEKAIAFYDLLSSFDFMAS 360

Query: 355 TPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHI 414
           TPTLFN+GT  PQLSSCFLTTV DDL GIF A+++NA+L+KY+GGLGNDWT VRGLGAHI
Sbjct: 361 TPTLFNAGTLRPQLSSCFLTTVADDLDGIFKAIKDNALLSKYAGGLGNDWTRVRGLGAHI 420

Query: 415 HGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRR 474
            GTNG+SQGV+PFLKVANDTA+AVNQGGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRR
Sbjct: 421 KGTNGESQGVVPFLKVANDTAIAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRR 480

Query: 475 RTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEI 534
           RTHDMNTANW+PDLFM+RV ++  WTLFSPDE  DLHDL GK F   Y  YE +A RGE+
Sbjct: 481 RTHDMNTANWVPDLFMQRVEEDGMWTLFSPDETPDLHDLTGKAFAGRYAYYEEKAARGEL 540

Query: 535 KVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSS 594
           +V +++ AV LWR+MLTMLFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S+
Sbjct: 541 RVTKQVRAVDLWRRMLTMLFETGHPWITFKDPCNLRSPQQHCGVVHSSNLCTEITLNTSN 600

Query: 595 EETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
            E AVCNLGS+NL+ H  + + D++ LA T+R A+R+LDNV+D+N +TI +A+ SN  HR
Sbjct: 601 TEVAVCNLGSVNLVNHIKDGKLDHEHLARTVRIAMRMLDNVLDVNFYTIPEARTSNLRHR 660

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ AL++L +PYAS EAV  ADESME I++HAIS SVELA ERG Y S++GS
Sbjct: 661 PVGLGIMGFQDALNILRLPYASDEAVSFADESMEAIAYHAISGSVELAAERGRYPSYQGS 720

Query: 715 LWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LW +GV P+DS+ L+ E R  E+ ++R+SRL WD L++RV TIGMRNSNCMAIAPTATI+
Sbjct: 721 LWSKGVLPLDSLELVDEARGAEVDIDRSSRLDWDSLRQRVMTIGMRNSNCMAIAPTATIS 780

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NICGVSQSI+P+YQNLYVKSNMSGDFTVVN+ LV +LK R LWDE MISDLKY DGS+G 
Sbjct: 781 NICGVSQSIEPAYQNLYVKSNMSGDFTVVNAHLVRDLKARGLWDEVMISDLKYFDGSVGE 840

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+R+PDDLK ++ATAFEID  WLI++A+RRQKWIDQAQSLNLY+  PSGKKLD +YR AW
Sbjct: 841 IDRVPDDLKALYATAFEIDSAWLIDAAARRQKWIDQAQSLNLYIANPSGKKLDALYRHAW 900

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSS--------THSLGIPSSCT 945
             GLKTTYYLRSRSAT VEKSTLKG DGKLNAV  +   +         + S G  S   
Sbjct: 901 KRGLKTTYYLRSRSATHVEKSTLKGTDGKLNAVAASVSVAPLNGHAAVASASEGWKSCRV 960

Query: 946 SDTECEVCQ 954
            D  CE CQ
Sbjct: 961 DDPTCEACQ 969


>gi|254483512|ref|ZP_05096739.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [marine gamma proteobacterium HTCC2148]
 gi|214036233|gb|EEB76913.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [marine gamma proteobacterium HTCC2148]
          Length = 958

 Score = 1021 bits (2639), Expect = 0.0,   Method: Composition-based stats.
 Identities = 554/953 (58%), Positives = 699/953 (73%), Gaps = 11/953 (1%)

Query: 6   DVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRS 65
             +  D +  P+           ++VIKRNG V  F+ SKIS AI KAF+AVEG  A+ S
Sbjct: 13  GTSPVDRETAPAAGGIAATAPGQLRVIKRNGTVVPFEESKISVAITKAFLAVEGGTAAAS 72

Query: 66  IRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREER 125
            R+ + +  LT+Q      +   S   +HIED+QDQVE SLM++G HKI R+YV+YREE+
Sbjct: 73  SRIHETVAKLTDQVAATFQRRMPSGGTIHIEDVQDQVELSLMRAGEHKIARDYVIYREEQ 132

Query: 126 SDVRAAQSHSKSD-APIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           S  RAA++    +    A  + ++  DG+ ++ +  RL  +V EAC  L+DV    +L E
Sbjct: 133 SRKRAAKASLSQETQDAANGINVIQPDGSRVALDLDRLHTVVSEACFELEDVVESAILDE 192

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
             KN+YDG++  +L T+L+ ++RT+IE++PNY+ V AR L + LR E L +       AT
Sbjct: 193 ALKNLYDGVTAEELATSLVITARTMIEQDPNYSYVAARLLCDNLRAEAL-SFLGVATNAT 251

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
             +M  LY +    YI  G++  LL  ++  +DL  L   L  ERD  F YLGLQ LYDR
Sbjct: 252 QADMGQLYAKALPAYIARGIELELLSPNLAGYDLQRLGEALLPERDLQFTYLGLQTLYDR 311

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H + +R E+PQ FFMRVAMGLA +E  +  RA+EFY LLSSF +M STPTLFN+GT 
Sbjct: 312 YFIHSDETRFELPQVFFMRVAMGLAAEEANRNDRAIEFYELLSSFDYMSSTPTLFNAGTL 371

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LGA+I GTNGKSQG+
Sbjct: 372 RPQLSSCYLTTVPDDLHGIYGAIQDNAMLSKFAGGLGNDWTPVRALGAYIKGTNGKSQGI 431

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+DVEEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 432 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDVEEFVELRKNTGDDRRRTHDMNTANW 491

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV     WTLFSP +V DLHDLYG  FE  Y +YE  A  GEIK+F+ + A  
Sbjct: 492 IPDLFMKRVFNGEDWTLFSPSDVPDLHDLYGVAFEQRYAHYEAMAAAGEIKLFKTVKAEN 551

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS
Sbjct: 552 LWRKMLGMLFETGHPWMTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGS 611

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
           +NL  H   N  + +KL +T+RTAVR+LDNVIDIN +++ +AK SN  HR +GLGLMGFQ
Sbjct: 612 VNLPQHIDENGLNLEKLRNTVRTAVRMLDNVIDINYYSVPQAKNSNLMHRPVGLGLMGFQ 671

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            AL+  H+ Y S +AV  AD SME IS++AI AS ELA ERGAYSS++GSLW QGVFPID
Sbjct: 672 DALYKQHLAYGSEQAVSFADHSMEAISYYAIEASSELAAERGAYSSYEGSLWSQGVFPID 731

Query: 725 SIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSI 782
           S+  L + R    + +++T  + W  L+ +V+  GMRNSN MAIAPTATIANI GVSQSI
Sbjct: 732 SLQRLIDERGADYIQVDQTESMDWQALRSQVQQNGMRNSNVMAIAPTATIANITGVSQSI 791

Query: 783 DPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLK 842
           +P+YQNLYVKSN+SG+FTVVN +LV +LK+R LWD  M++DLKY+DGS+  I+RIP D+K
Sbjct: 792 EPTYQNLYVKSNLSGEFTVVNPYLVRDLKERGLWDGVMVNDLKYYDGSVQAIDRIPADIK 851

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYY 902
            I++TAFE++P WL+++ASRRQKWIDQAQSLNLY++  +GKKLD  YR AW  GLKTTYY
Sbjct: 852 GIYSTAFEVEPRWLVDAASRRQKWIDQAQSLNLYINNANGKKLDITYRMAWYSGLKTTYY 911

Query: 903 LRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           LRS +AT  EKST+    G LNAV     N +     +P +C+  D +CE CQ
Sbjct: 912 LRSLAATGTEKSTID--TGTLNAVS----NEAAGPAPVPQACSLDDPDCEACQ 958


>gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040179|gb|ACT56975.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 954

 Score = 1018 bits (2631), Expect = 0.0,   Method: Composition-based stats.
 Identities = 954/954 (100%), Positives = 954/954 (100%)

Query: 1   MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK 60
           MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK
Sbjct: 1   MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK 60

Query: 61  GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL 120
           GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL
Sbjct: 61  GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL 120

Query: 121 YREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI 180
           YREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI
Sbjct: 121 YREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI 180

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP
Sbjct: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI
Sbjct: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN
Sbjct: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK
Sbjct: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN
Sbjct: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI
Sbjct: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
           SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC
Sbjct: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL
Sbjct: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV
Sbjct: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720

Query: 721 FPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           FPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ
Sbjct: 721 FPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD
Sbjct: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT
Sbjct: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ
Sbjct: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954


>gi|92119122|ref|YP_578851.1| ribonucleotide-diphosphate reductase subunit alpha [Nitrobacter
           hamburgensis X14]
 gi|91802016|gb|ABE64391.1| Ribonucleoside-diphosphate reductase [Nitrobacter hamburgensis X14]
          Length = 966

 Score = 1017 bits (2630), Expect = 0.0,   Method: Composition-based stats.
 Identities = 589/967 (60%), Positives = 739/967 (76%), Gaps = 14/967 (1%)

Query: 1   MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK 60
           M  + +  + +  + P+ A   P      QVI+RNG V+ FD SKI+ A+ KAF+AVEG 
Sbjct: 1   MSLATEAARAERPSLPAAAA-MPSSEPAYQVIRRNGSVSPFDSSKIAVALTKAFLAVEGN 59

Query: 61  GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL 120
            A+ S RV DI+  LT+Q V  L + + +    HIEDIQDQ E +LM+S HHK+ R YVL
Sbjct: 60  SAAASRRVHDIVTELTDQIVASLTRRSDAGRTFHIEDIQDQAELALMRSAHHKVARAYVL 119

Query: 121 YREERSDVRAAQSHSKSDAPIA----PKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV 176
           YREER+  RA    S +    A    P L++   DG++   +++RL  +VEEAC+GL+ V
Sbjct: 120 YREERARERAKAQESNAKKSNAAAATPALRMKSVDGSMAPLDTRRLAAVVEEACAGLEGV 179

Query: 177 SSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTV 236
           S++ +L+ET++N+YDG+S  +L  A I ++RTL+E +P+YAK +AR LL+KLRRE L+ +
Sbjct: 180 SAEAILTETHRNLYDGISADELALAPILAARTLVETDPDYAKASARLLLDKLRREALSLI 239

Query: 237 YKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYL 296
             +P++AT  EM   Y EYF  Y++ G++  LL   +  FDL  LA  LK ERD  F+YL
Sbjct: 240 AGRPEQATQAEMTGRYAEYFLGYVQTGIENELLDPEIGRFDLDRLAAALKPERDLQFDYL 299

Query: 297 GLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTP 356
           G Q LYDRYFLH+ G+R E+PQAFFMRVA GLAL+E ++E +A+ FYNLLSSF FM STP
Sbjct: 300 GFQTLYDRYFLHVRGTRFELPQAFFMRVACGLALREIDREDKAIAFYNLLSSFDFMASTP 359

Query: 357 TLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHG 416
           TLFN+GT+  QLSSCFLTTV DDL GIF A+++NA+L+KY+GGLGNDWT VRGLGAHI G
Sbjct: 360 TLFNAGTQRAQLSSCFLTTVADDLDGIFKAIKDNALLSKYAGGLGNDWTRVRGLGAHIKG 419

Query: 417 TNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRT 476
           TNG+SQGV+PFLKVANDTA+AVNQGGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRRRT
Sbjct: 420 TNGESQGVVPFLKVANDTAIAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRRRT 479

Query: 477 HDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKV 536
           HDMNTANW+PDLFM+RV ++  WTLFSP+E  DLHDL GK F   Y +YE +A RGE++V
Sbjct: 480 HDMNTANWVPDLFMQRVEEDGVWTLFSPNETPDLHDLTGKAFAERYAHYEGKAARGEMRV 539

Query: 537 FRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEE 596
            +++ AV LWR+MLTMLFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S+ E
Sbjct: 540 TKQVRAVDLWRRMLTMLFETGHPWITFKDPCNLRSPQQHCGVVHSSNLCTEITLNTSNTE 599

Query: 597 TAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAI 656
            AVCNLGS+NL+ H  + + D+  LA T++TA+R+LDNV+++N +TI +A+ SN  HR +
Sbjct: 600 VAVCNLGSVNLVNHLHDGKLDHAHLARTVKTAMRMLDNVLNVNFYTIPEARTSNLRHRPV 659

Query: 657 GLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLW 716
           GLGLMGFQ AL++L +PYA  EAV  ADESME IS+ AIS SV+LA ERG Y S++GSLW
Sbjct: 660 GLGLMGFQDALNILRLPYACDEAVSFADESMEAISYWAISGSVDLAAERGRYPSYQGSLW 719

Query: 717 DQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANI 775
            +G+ P+DS+ L+ E R   + ++R+SRL W+ L++RV T+GMRNSNCMAIAPTATI+NI
Sbjct: 720 SKGILPLDSLALVDEARGAPIDLDRSSRLDWEALRQRVMTVGMRNSNCMAIAPTATISNI 779

Query: 776 CGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIE 835
           CGVSQSI+P+YQNLYVKSNMSGDFTVVN+ LV +LK R LWDE MISDLKY DG +  I+
Sbjct: 780 CGVSQSIEPAYQNLYVKSNMSGDFTVVNAHLVRDLKARGLWDEVMISDLKYFDGGLSRID 839

Query: 836 RIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLM 895
           R+PDDLK ++ATAFEID  WLI++A+RRQKWIDQAQSLNLY+ +PSGKKLD +YR AW  
Sbjct: 840 RVPDDLKALYATAFEIDSAWLIDAAARRQKWIDQAQSLNLYIADPSGKKLDALYRHAWKR 899

Query: 896 GLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSS--------THSLGIPSSCTSD 947
           GLKTTYYLRSRSAT VEKSTLK  DGKLNAV  +   +           S G  +    D
Sbjct: 900 GLKTTYYLRSRSATHVEKSTLKVTDGKLNAVSASVSTAPLNGHAASVAESDGWKACRIDD 959

Query: 948 TECEVCQ 954
             CE CQ
Sbjct: 960 PTCEACQ 966


>gi|85714831|ref|ZP_01045817.1| ribonucleotide-diphosphate reductase alpha subunit [Nitrobacter sp.
           Nb-311A]
 gi|85698317|gb|EAQ36188.1| ribonucleotide-diphosphate reductase alpha subunit [Nitrobacter sp.
           Nb-311A]
          Length = 956

 Score = 1017 bits (2629), Expect = 0.0,   Method: Composition-based stats.
 Identities = 594/951 (62%), Positives = 732/951 (76%), Gaps = 13/951 (1%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           S A   P      QVI+RNG V+ FD +KI+ A+ KAF+AVEG  A+ S RV DI+  LT
Sbjct: 6   SAAAAMPPSEPAYQVIRRNGSVSPFDSAKIAVALTKAFLAVEGNSAAASRRVHDIVAELT 65

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA----Q 132
            Q V  L + + +    HIEDIQDQVE +LM+S HHK+ R YVLYREER+  RA     +
Sbjct: 66  GQIVASLTRRSDAGRTFHIEDIQDQVELALMRSEHHKVARAYVLYREERARERAKSQESK 125

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           +   +       L++   DG+LI+ ++KRL  +V EAC+GL DVS+  +L+ET++N+YDG
Sbjct: 126 AKKGNTTAAKTVLRMKSADGSLIALDTKRLATVVVEACAGLGDVSASAILAETHRNLYDG 185

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           +S  +L  A I ++RTL+E +P+YAK +AR LL+KLRRE L+ V  + ++AT  EM   Y
Sbjct: 186 ISVDELALAPILAARTLVETDPDYAKASARLLLDKLRREALSFVSGRSEQATQAEMAERY 245

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +YF  Y+  G+   LL   +  FDL  LA  LK ERD  F+YLGLQ LYDRYFLH+ G 
Sbjct: 246 ADYFRAYVRTGIDNELLDLEIGRFDLDRLAAALKPERDLRFDYLGLQTLYDRYFLHVRGV 305

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQAFFMRVA GLAL+E ++E++A+ FY+LLSSF FM STPTLFN+GT  PQLSSCF
Sbjct: 306 RFELPQAFFMRVACGLALREIDREEKAIAFYDLLSSFDFMASTPTLFNAGTLRPQLSSCF 365

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTV DDL GIF A+++NA+L+KY+GGLGNDWT VRGLGAHI GTNG+SQGV+PFLKVAN
Sbjct: 366 LTTVADDLDGIFKAIKDNALLSKYAGGLGNDWTRVRGLGAHIKGTNGESQGVVPFLKVAN 425

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTA+AVNQGGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRRRTHDMNTANW+PDLFM+R
Sbjct: 426 DTAIAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLFMRR 485

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V ++  WTLFSPDE  DLHDL GK F   Y  YE +A RGE++V +++ AV LWR+MLTM
Sbjct: 486 VEEDGMWTLFSPDETPDLHDLTGKAFTERYACYEEKAARGELRVTKQVRAVDLWRRMLTM 545

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S+ E AVCNLGS+NL++H  
Sbjct: 546 LFETGHPWITFKDPCNLRSPQQHCGVVHSSNLCTEITLNTSNTEVAVCNLGSVNLVSHIK 605

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           + + D++ LA T+R A+R+LDNV+D+N +TI +A+ SN  HR +GLG+MGFQ AL++L +
Sbjct: 606 DGKLDHEHLARTVRIAMRMLDNVLDVNFYTIPEARTSNLRHRPVGLGVMGFQDALNILRL 665

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PYAS  AV  ADESME I+++AIS SVELA ERG Y S++GSLW +G+ P+DS+ L+ E 
Sbjct: 666 PYASNGAVSFADESMEAIAYYAISGSVELAAERGRYPSYQGSLWSKGILPLDSLTLVDEA 725

Query: 733 RD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYV 791
           R   + ++R+SRL WD L++ V TIGMRNSNCMAIAPTATI+NICGVSQSI+P+YQNLYV
Sbjct: 726 RGAAVDIDRSSRLDWDSLRESVMTIGMRNSNCMAIAPTATISNICGVSQSIEPAYQNLYV 785

Query: 792 KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEI 851
           KSNMSGDFTVVN+ LV +LK R LWDE MISDLKY DGS+G I+R+PDDLK ++ATAFEI
Sbjct: 786 KSNMSGDFTVVNAHLVRDLKARGLWDEVMISDLKYFDGSVGQIDRVPDDLKALYATAFEI 845

Query: 852 DPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSV 911
           D  WLI++A+RRQKWIDQAQSLNLY+  PSGKKLD +YR AW  GLKTTYYLRSRSAT V
Sbjct: 846 DSSWLIDAAARRQKWIDQAQSLNLYIANPSGKKLDALYRHAWKRGLKTTYYLRSRSATHV 905

Query: 912 EKSTLKGVDGKLNAVPV--------TDPNSSTHSLGIPSSCTSDTECEVCQ 954
           EKSTLKG DGKLNAV              +++ S G  S    D  CE CQ
Sbjct: 906 EKSTLKGTDGKLNAVAASVSAAPLNGHATAASASEGWKSCRIEDPTCEACQ 956


>gi|325272775|ref|ZP_08139119.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas sp.
           TJI-51]
 gi|324102082|gb|EGB99584.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas sp.
           TJI-51]
          Length = 959

 Score = 1017 bits (2629), Expect = 0.0,   Method: Composition-based stats.
 Identities = 558/956 (58%), Positives = 705/956 (73%), Gaps = 13/956 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +       D+   LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QAKVPQAADSQQDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++
Sbjct: 68  SSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQ 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  RA +++S +     P ++I + DG+L   +  RL  I+ EAC GL +V   ++  E
Sbjct: 128 RAKERATRANSDAVVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGDLIQRE 187

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +    + AT
Sbjct: 188 TLKNLYDGVAIKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFLN-VAESAT 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    Y+E+GV+  LL  ++  +DL  L   + +ERD  F YLGLQ LYDR
Sbjct: 247 HHEMADLYAKALPAYVEKGVEFELLDPALKGYDLERLGKAIDHERDQQFTYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 307 YFIHKDGVRFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 367 RPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ I A  
Sbjct: 487 IPDLFMKRVFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTIQAKD 546

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS
Sbjct: 547 LWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGS 606

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
           INL  H  + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ
Sbjct: 607 INLPNHINDGKLDTAKLQRTVNTAVRMLDNVIDINYYSVPQARNSNFKHRPVGLGIMGFQ 666

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            AL+L HIPY S  AVE AD+SME +S+ AI AS +LA ERGAY +F+GSLW +G+ P+D
Sbjct: 667 DALYLQHIPYGSDAAVEFADKSMEAVSYFAIQASCDLADERGAYETFQGSLWSKGILPLD 726

Query: 725 SIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSI 782
           S  +L E R    + +N    L W  +++RVK  G+RNSN MAIAPTATIANI GVSQSI
Sbjct: 727 SQQILIEARGQKYIDVNLEESLDWAPVRERVKK-GIRNSNIMAIAPTATIANITGVSQSI 785

Query: 783 DPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLK 842
           +P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +LK
Sbjct: 786 EPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELK 845

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYY 902
            ++ATAFE++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYY
Sbjct: 846 DLYATAFEVETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYY 905

Query: 903 LRSRSATSVEKSTLKGVDGKLNAVPVT---DPNSSTHSLGIPSSC-TSDTECEVCQ 954
           LR+ +ATS EKST+    GKLNAV       P  +     +P +C   + +CE CQ
Sbjct: 906 LRALAATSTEKSTIN--TGKLNAVSSGGDSAPVQAAGPAPVPKACAIDEPDCEACQ 959


>gi|313497536|gb|ADR58902.1| NrdA [Pseudomonas putida BIRD-1]
          Length = 959

 Score = 1015 bits (2624), Expect = 0.0,   Method: Composition-based stats.
 Identities = 557/956 (58%), Positives = 707/956 (73%), Gaps = 13/956 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +       D+ P LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QAQVPQAADSNPDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++
Sbjct: 68  SSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQ 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  RA ++++ +     P ++I + DG+L   +  RL  I+ EAC GL +V   ++  E
Sbjct: 128 RAKERATRANTDAVVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGDLIQRE 187

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +      AT
Sbjct: 188 TLKNLYDGVAIKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFLN-VADSAT 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    Y+ +G++  LL+ ++ DFDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 247 HHEMADLYAKALPAYVAKGIEFELLNPALADFDLEKLGKAINHERDQQFTYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 307 YFIHKDGVRFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 367 RPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ + A  
Sbjct: 487 IPDLFMKRVFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTVQAKD 546

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS
Sbjct: 547 LWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGS 606

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
           INL  H  + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ
Sbjct: 607 INLPNHIVDGKLDTTKLQRTVNTAVRMLDNVIDINYYSVPQARNSNFKHRPVGLGIMGFQ 666

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            AL+L HIPY S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+D
Sbjct: 667 DALYLQHIPYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLD 726

Query: 725 SIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSI 782
           S  +L E R    + +N    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI
Sbjct: 727 SQQILIEARGQKYIDVNLEETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSI 785

Query: 783 DPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLK 842
           +P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK
Sbjct: 786 EPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELK 845

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYY 902
            ++ATAFE++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYY
Sbjct: 846 DLYATAFEVETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYY 905

Query: 903 LRSRSATSVEKSTLKGVDGKLNAVPVT---DPNSSTHSLGIPSSC-TSDTECEVCQ 954
           LR+ +ATS EKST+    GKLNAV       P  +     +P +C   + +CE CQ
Sbjct: 906 LRALAATSTEKSTIN--TGKLNAVSSGGDSAPVQAAGPAPVPKACAIDEPDCEACQ 959


>gi|167035229|ref|YP_001670460.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           putida GB-1]
 gi|166861717|gb|ABZ00125.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           putida GB-1]
          Length = 959

 Score = 1015 bits (2624), Expect = 0.0,   Method: Composition-based stats.
 Identities = 554/956 (57%), Positives = 704/956 (73%), Gaps = 13/956 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +       D+   LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QAKVPQAADSNQDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++
Sbjct: 68  SSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQ 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  RA ++++ +     P ++I + DG+L   +  RL  I+ EAC GL +V   ++  E
Sbjct: 128 RAKERATRANTDAVVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGDLIQRE 187

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +      AT
Sbjct: 188 TLKNLYDGVAIKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFLN-VADSAT 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    Y+ +G++  LL+ ++ DFDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 247 HHEMADLYAKALPAYVAKGIEFELLNPALADFDLEKLGKAINHERDQQFTYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 307 YFIHKDGVRFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 367 RPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ I A  
Sbjct: 487 IPDLFMKRVFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTIQAKD 546

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS
Sbjct: 547 LWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGS 606

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
           INL  H  + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ
Sbjct: 607 INLPNHIVDGKLDTAKLQRTVNTAVRMLDNVIDINYYSVPQARNSNLKHRPVGLGIMGFQ 666

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            AL+L HI Y S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+D
Sbjct: 667 DALYLQHIAYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLD 726

Query: 725 SIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSI 782
           S  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI
Sbjct: 727 SQQILIEARGQKYIDVDLNETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSI 785

Query: 783 DPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLK 842
           +P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +LK
Sbjct: 786 EPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELK 845

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYY 902
            ++ATAFE++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYY
Sbjct: 846 DLYATAFEVETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYY 905

Query: 903 LRSRSATSVEKSTLKGVDGKLNAVPVT---DPNSSTHSLGIPSSC-TSDTECEVCQ 954
           LR+ +ATS EKST+    GKLNAV       P  +     +P +C   + +CE CQ
Sbjct: 906 LRALAATSTEKSTIN--TGKLNAVSSGGDSAPVQAAGPAPVPKACAIDEPDCEACQ 959


>gi|148546453|ref|YP_001266555.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           putida F1]
 gi|148510511|gb|ABQ77371.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           putida F1]
          Length = 959

 Score = 1012 bits (2615), Expect = 0.0,   Method: Composition-based stats.
 Identities = 557/956 (58%), Positives = 706/956 (73%), Gaps = 13/956 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +       D+   LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QAQVPQAADSNQDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++
Sbjct: 68  SSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQ 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  RA ++++ +     P ++I + DG+L   +  RL  I+ EAC GL +V   ++  E
Sbjct: 128 RAKERATRANTDAVVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGDLIQRE 187

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +      AT
Sbjct: 188 TLKNLYDGVAIKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFLN-VADSAT 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    Y+ +G++  LL+ ++ DFDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 247 HHEMADLYAKALPAYVAKGIEFELLNPALADFDLEKLGKAINHERDQQFTYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 307 YFIHKDGVRFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 367 RPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ I A  
Sbjct: 487 IPDLFMKRVFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTIQAKD 546

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS
Sbjct: 547 LWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGS 606

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
           INL  H  + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ
Sbjct: 607 INLPNHIVDGKLDTAKLQRTVNTAVRMLDNVIDINYYSVPQARNSNFKHRPVGLGIMGFQ 666

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            AL+L HIPY S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+D
Sbjct: 667 DALYLQHIPYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLD 726

Query: 725 SIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSI 782
           S  +L E R    + +N    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI
Sbjct: 727 SQQILIEARGQKYIDVNLEETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSI 785

Query: 783 DPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLK 842
           +P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK
Sbjct: 786 EPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELK 845

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYY 902
            ++ATAFE++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYY
Sbjct: 846 DLYATAFEVETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYY 905

Query: 903 LRSRSATSVEKSTLKGVDGKLNAVPVT---DPNSSTHSLGIPSSC-TSDTECEVCQ 954
           LR+ +ATS EKST+    GKLNAV       P  +     +P +C   + +CE CQ
Sbjct: 906 LRALAATSTEKSTIN--TGKLNAVSSGGDSAPVQAAGPAPVPKACAIDEPDCEACQ 959


>gi|15596353|ref|NP_249847.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           aeruginosa PAO1]
 gi|107100606|ref|ZP_01364524.1| hypothetical protein PaerPA_01001631 [Pseudomonas aeruginosa PACS2]
 gi|116049088|ref|YP_792110.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|218892880|ref|YP_002441749.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           aeruginosa LESB58]
 gi|254234290|ref|ZP_04927613.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa
           C3719]
 gi|296390474|ref|ZP_06879949.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           aeruginosa PAb1]
 gi|313106127|ref|ZP_07792382.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa
           39016]
 gi|9947078|gb|AAG04545.1|AE004545_8 NrdA, catalytic component of class Ia ribonucleotide reductase
           [Pseudomonas aeruginosa PAO1]
 gi|115584309|gb|ABJ10324.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166221|gb|EAZ51732.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa
           C3719]
 gi|218773108|emb|CAW28920.1| NrdA, catalytic component of class Ia ribonucleotide reductase
           [Pseudomonas aeruginosa LESB58]
 gi|310878884|gb|EFQ37478.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa
           39016]
          Length = 963

 Score = 1012 bits (2615), Expect = 0.0,   Method: Composition-based stats.
 Identities = 558/960 (58%), Positives = 704/960 (73%), Gaps = 17/960 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +       D+   LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QASAPQAADSSQDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D ++ LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YRE 
Sbjct: 68  SSRIHDTVRRLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYREA 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  R     +   A   P ++I   DG+L   +  RL  I+ EAC GL +V   ++  E
Sbjct: 128 RAAERKNAGAASDVAQPHPSIRITRADGSLSPLDMGRLNTIISEACEGLAEVDGALIERE 187

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++E D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L       + AT
Sbjct: 188 TLKNLYDGVAEKDVNTALVMTARTLVEREPNYSYVTARLLMDTLRAEALG-FLGVAESAT 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    YIE+G +  L+   + +FDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 247 HHEMAELYAKALPAYIEKGAEFELVDAKLKEFDLEKLGKAIDHERDQQFTYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLA++E ++E RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 307 YFIHKDGIRFELPQIFFMRVAMGLAIEEKDREARAIEFYNLLSSFDYMSSTPTLFNAGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+GA+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 367 RPQLSSCYLTTVPDDLSGIYGAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV  +  WTLFSP +V DLHDLYGK FE  YE YE  A  G++K+ + + A  
Sbjct: 487 IPDLFMKRVFDDGSWTLFSPSDVPDLHDLYGKAFEERYEYYEALASYGKLKLHKVVQAKD 546

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS
Sbjct: 547 LWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGS 606

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
           INL+ H  + + D  KL  T++TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ
Sbjct: 607 INLVNHIVDGKLDTAKLEKTVKTAVRMLDNVIDINYYSVPQAQNSNFKHRPVGLGIMGFQ 666

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            AL+L HIPY S  A+  AD+SME IS++AI AS +LA ERGAY +F+GSLW QG+ PID
Sbjct: 667 DALYLQHIPYGSDAAIAFADQSMEAISYYAIQASCDLADERGAYQTFQGSLWSQGILPID 726

Query: 725 SIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSI 782
           S   L E R    + ++ +  L W  L++RV+  G+RNSN MAIAPTATIANI GVSQSI
Sbjct: 727 SEKKLIEERGAKYIEVDLSETLDWAPLRERVQK-GIRNSNIMAIAPTATIANITGVSQSI 785

Query: 783 DPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLK 842
           +P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  M++DLKY+DGS+  IERIP DLK
Sbjct: 786 EPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDPVMVNDLKYYDGSVQQIERIPQDLK 845

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYY 902
            ++ATAFE++  W++E+ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYY
Sbjct: 846 DLYATAFEVETRWIVEAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWFRGLKTTYY 905

Query: 903 LRSRSATSVEKSTLKGVDGKLNAVPVTDPN-------SSTHSLGIPSSCTSD-TECEVCQ 954
           LR+ +ATS EKST+    GKLNAV     +       +      +P +C+ D  +CE CQ
Sbjct: 906 LRALAATSTEKSTIN--TGKLNAVSAGGNDGLQAAPAAEPKPAPVPQACSIDNPDCEACQ 963


>gi|104780528|ref|YP_607026.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           entomophila L48]
 gi|95109515|emb|CAK14216.1| ribonucleoside diphosphate reductase, alpha subunit [Pseudomonas
           entomophila L48]
          Length = 958

 Score = 1011 bits (2614), Expect = 0.0,   Method: Composition-based stats.
 Identities = 554/948 (58%), Positives = 705/948 (74%), Gaps = 13/948 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           ++   L    P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 18  ESNQDLTATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 74

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++R+  RA +
Sbjct: 75  ARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQRAKERATR 134

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           +++ +     P ++I + DG+L   +  RL  I+ EAC GL +V  +++  ET KN+YDG
Sbjct: 135 ANTDAVVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGELIQRETLKNLYDG 194

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           ++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY
Sbjct: 195 VALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFLN-VADSATHHEMADLY 253

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +    Y+E+GV+  LL  ++  +DL  +   + +ERD  F YLGLQ LYDRYF+H +G 
Sbjct: 254 AKALPAYVEKGVEFELLDPALKGYDLERMGKAINHERDQQFTYLGLQTLYDRYFIHKDGV 313

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+
Sbjct: 314 RFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCY 373

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV N
Sbjct: 374 LTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVN 433

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 434 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKR 493

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ I A  LWRKML+M
Sbjct: 494 VFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTIQAKDLWRKMLSM 553

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  
Sbjct: 554 LFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIV 613

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HI
Sbjct: 614 DGKLDTAKLQRTVNTAVRMLDNVIDINYYSVPQARNSNFKHRPVGLGIMGFQDALYLQHI 673

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PY S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E 
Sbjct: 674 PYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEA 733

Query: 733 RD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
           R    + ++ T  L W  +++RVK  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLY
Sbjct: 734 RGQKYIDVDLTESLDWAPVRERVKK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLY 792

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +LK ++ATAFE
Sbjct: 793 VKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELKDLYATAFE 852

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS
Sbjct: 853 VETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATS 912

Query: 911 VEKSTLKGVDGKLNAVPVT---DPNSSTHSLGIPSSC-TSDTECEVCQ 954
            EKST+    GKLNAV       P  +     +P +C   + +CE CQ
Sbjct: 913 TEKSTIN--TGKLNAVSSGGDSAPVQAAGPAPVPKACAIDEPDCEACQ 958


>gi|254516738|ref|ZP_05128797.1| putative ribonucleoside-diphosphate reductase alpha subunit [gamma
           proteobacterium NOR5-3]
 gi|219675161|gb|EED31528.1| putative ribonucleoside-diphosphate reductase alpha subunit [gamma
           proteobacterium NOR5-3]
          Length = 967

 Score = 1011 bits (2614), Expect = 0.0,   Method: Composition-based stats.
 Identities = 562/957 (58%), Positives = 707/957 (73%), Gaps = 13/957 (1%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
           + + +V  G   +   ++   P +   ++VIKRNG V  F+ SKIS AI KAF+AVEG  
Sbjct: 20  NTAANVASGVSASKAEVSATAPGQ---LRVIKRNGTVVPFEASKISVAITKAFLAVEGGT 76

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
           A+ S R+ + +  LTE       +   S   +HIED+QDQVE SLM++G HKI R+YV+Y
Sbjct: 77  AAASSRIHETVAKLTEMVTATFKRRMPSGGTIHIEDVQDQVELSLMRAGEHKIARDYVIY 136

Query: 122 REERSDVRAAQSH-SKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI 180
           RE+++  RAA+   S      A ++ ++  DG+    + +RL +IV EAC+GL+DVS   
Sbjct: 137 REQQAVKRAARQSLSAETQQAADRINVVQLDGSKAPLDLERLHIIVSEACAGLEDVSESR 196

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +L E  +N+YDG+S  +L T+L+ ++RTLIE+EPNY   +AR L + LR E L T     
Sbjct: 197 ILDEALRNLYDGVSMQELSTSLVITARTLIEQEPNYTYASARLLCDNLRTEAL-TFLGVA 255

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           + AT  +M   YP+    YI+ GV+  LL  ++ D+DL  L   +  ERD  F YLGLQ 
Sbjct: 256 ESATQGDMDRYYPQALSAYIKRGVELELLDPTLADYDLEQLGAAILPERDLQFTYLGLQT 315

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYF+H +  RIE+PQ FFMRVAMGLA++E  +E RA+EFY LLSSF +M STPTLFN
Sbjct: 316 LYDRYFIHSDEVRIELPQIFFMRVAMGLAVEEEHREARAIEFYRLLSSFDYMSSTPTLFN 375

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           +GT  PQLSSC+LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LG++I GTNGK
Sbjct: 376 AGTLRPQLSSCYLTTVPDDLHGIYGAIQDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGK 435

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVC+YLETWH+D+EEF++LRKNTGDDRRRTHDMN
Sbjct: 436 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCSYLETWHMDIEEFVELRKNTGDDRRRTHDMN 495

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRV  +  WTLFSP++V DLHDLYGK FE  Y  YE  A  GEIK  + +
Sbjct: 496 TANWIPDLFMKRVFDDGDWTLFSPNDVPDLHDLYGKAFEERYNTYEAMAANGEIKNHKTV 555

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKML MLFETGHPW+TFKDPCN+RSPQQH GVVHSSNLCTEITLN+S++E AVC
Sbjct: 556 KAQNLWRKMLGMLFETGHPWMTFKDPCNLRSPQQHAGVVHSSNLCTEITLNTSADEIAVC 615

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGSINL  H   N  + +KL  T+RTAVR+LDNVIDIN ++++ A+ SN  HR +GLGL
Sbjct: 616 NLGSINLPQHIDENGLNLEKLEQTVRTAVRMLDNVIDINYYSVDTARNSNFRHRPVGLGL 675

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ AL+  HI Y S  AVE AD SME IS++AI AS  LA ERGAYSS++GSLW QG+
Sbjct: 676 MGFQDALYKQHIAYGSDAAVEFADRSMEAISYYAIDASSSLAAERGAYSSYEGSLWSQGI 735

Query: 721 FPIDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
            PIDS+  L + R    + ++ T+ L W+ L+  VK  GMRNSN MAIAPTATIANI GV
Sbjct: 736 LPIDSLSKLVDERGSDYIKVDSTTTLDWESLRTSVKARGMRNSNVMAIAPTATIANITGV 795

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           SQSI+P+YQNLYVKSN+SG+FTVVN +LVN+LK R LWD  M++DLKY+DGS+ +IERIP
Sbjct: 796 SQSIEPTYQNLYVKSNLSGEFTVVNPYLVNDLKARGLWDSVMVNDLKYYDGSVQSIERIP 855

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            DL+ I++ AFE++P W++E ASRRQKWIDQAQSLNLY++  SGKKLD  YR AW  GLK
Sbjct: 856 ADLRAIYSNAFEVEPKWIVECASRRQKWIDQAQSLNLYINNASGKKLDITYRMAWYSGLK 915

Query: 899 TTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           TTYYLRS +AT  EKST+    G+LNAV  +   +      +P +C+  D +CE CQ
Sbjct: 916 TTYYLRSLAATGTEKSTI--ATGQLNAVSSS---AEPQPAPVPQACSLDDPDCEACQ 967


>gi|26987914|ref|NP_743339.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           putida KT2440]
 gi|24982623|gb|AAN66803.1|AE016309_5 ribonucleoside reductase, alpha subunit [Pseudomonas putida KT2440]
          Length = 959

 Score = 1011 bits (2614), Expect = 0.0,   Method: Composition-based stats.
 Identities = 556/956 (58%), Positives = 706/956 (73%), Gaps = 13/956 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +       D+   LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QAQVPQAADSNQDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++
Sbjct: 68  SSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQ 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  RA ++++ +     P ++I + DG+L   +  RL  I+ EAC GL +V   ++  E
Sbjct: 128 RAKERATRANTDAVVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGDLIQRE 187

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +      AT
Sbjct: 188 TLKNLYDGVAIKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFLN-VADSAT 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    Y+ +G++  LL+ ++ DFDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 247 HHEMADLYAKALPAYVAKGIEFELLNPALADFDLEKLGKAINHERDQQFTYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 307 YFIHKDGVRFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 367 RPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ + A  
Sbjct: 487 IPDLFMKRVFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTVQAKD 546

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS
Sbjct: 547 LWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGS 606

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
           INL  H  + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ
Sbjct: 607 INLPNHIVDGKLDTTKLQRTVNTAVRMLDNVIDINYYSVPQARNSNFKHRPVGLGIMGFQ 666

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            AL+L HIPY S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+D
Sbjct: 667 DALYLQHIPYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLD 726

Query: 725 SIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSI 782
           S  +L E R    + +N    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI
Sbjct: 727 SQQILIEARGQKYIDVNLEETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSI 785

Query: 783 DPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLK 842
           +P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK
Sbjct: 786 EPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELK 845

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYY 902
            ++ATAFE++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYY
Sbjct: 846 DLYATAFEVETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYY 905

Query: 903 LRSRSATSVEKSTLKGVDGKLNAVPVT---DPNSSTHSLGIPSSC-TSDTECEVCQ 954
           LR+ +ATS EKST+    GKLNAV       P  +     +P +C   + +CE CQ
Sbjct: 906 LRALAATSTEKSTIN--TGKLNAVSSGGDSAPVQAAGPAPVPKACAIDEPDCEACQ 959


>gi|152988045|ref|YP_001349578.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           aeruginosa PA7]
 gi|150963203|gb|ABR85228.1| ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide
           reductase) [Pseudomonas aeruginosa PA7]
          Length = 963

 Score = 1011 bits (2613), Expect = 0.0,   Method: Composition-based stats.
 Identities = 558/960 (58%), Positives = 704/960 (73%), Gaps = 17/960 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +       D+   LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QANAPQAADSSQDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D ++ LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YRE 
Sbjct: 68  SSRIHDTVRRLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYREA 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  R     +   A   P ++I   DG+L   +  RL  I+ EAC GL +V   ++  E
Sbjct: 128 RAAERKNAGATSDVAQPHPSIRITRADGSLSPLDMGRLNTIISEACEGLAEVDGALIERE 187

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++E D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L       + AT
Sbjct: 188 TLKNLYDGVAEKDVNTALVMTARTLVEREPNYSYVTARLLMDTLRAEALG-FLGVAESAT 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    YIE+G +  L+   + +FDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 247 HHEMAELYAKALPAYIEKGAEFELVDAKLKEFDLEKLGKAIDHERDQQFTYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLA++E ++E RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 307 YFIHKDGIRFELPQIFFMRVAMGLAIEEKDREARAIEFYNLLSSFDYMSSTPTLFNAGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+GA+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 367 RPQLSSCYLTTVPDDLSGIYGAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV  +  WTLFSP +V DLHDLYGK FE  YE YE  A  G++K+ + + A  
Sbjct: 487 IPDLFMKRVFDDGSWTLFSPSDVPDLHDLYGKAFEERYEYYEALASYGKLKLHKVVQAKD 546

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS
Sbjct: 547 LWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGS 606

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
           INL+ H  + + D  KL  T++TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ
Sbjct: 607 INLVNHIVDGKLDTAKLEKTVKTAVRMLDNVIDINYYSVPQAQNSNFKHRPVGLGIMGFQ 666

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            AL+L HIPY S  A+  AD+SME IS++AI AS +LA ERGAY +F+GSLW QG+ PID
Sbjct: 667 DALYLQHIPYGSDAAIAFADQSMEAISYYAIQASCDLADERGAYQTFQGSLWSQGILPID 726

Query: 725 SIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSI 782
           S   L E R    + ++ +  L W  L++RV+  G+RNSN MAIAPTATIANI GVSQSI
Sbjct: 727 SEKKLIEERGAKYIEVDLSETLDWAPLRERVQK-GIRNSNIMAIAPTATIANITGVSQSI 785

Query: 783 DPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLK 842
           +P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  M++DLKY+DGS+  IERIP DLK
Sbjct: 786 EPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDPVMVNDLKYYDGSVQQIERIPQDLK 845

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYY 902
            ++ATAFE++  W++E+ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYY
Sbjct: 846 DLYATAFEVETRWIVEAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWFRGLKTTYY 905

Query: 903 LRSRSATSVEKSTLKGVDGKLNAVPVTDPN-------SSTHSLGIPSSCTSD-TECEVCQ 954
           LR+ +ATS EKST+    GKLNAV     +       +      +P +C+ D  +CE CQ
Sbjct: 906 LRALAATSTEKSTIN--TGKLNAVSAGGNDGLQAAPAAEPKPAPVPQACSIDNPDCEACQ 963


>gi|53804298|ref|YP_114078.1| ribonucleotide-diphosphate reductase subunit alpha [Methylococcus
           capsulatus str. Bath]
 gi|53758059|gb|AAU92350.1| ribonucleoside-diphosphate reductase, alpha subunit [Methylococcus
           capsulatus str. Bath]
          Length = 969

 Score = 1009 bits (2608), Expect = 0.0,   Method: Composition-based stats.
 Identities = 567/968 (58%), Positives = 707/968 (73%), Gaps = 28/968 (2%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P    +       P            V+VI+RNG VT FD +KIS AI KAF+AVEG  A
Sbjct: 14  PLDATSAELRSLSPGE----------VRVIRRNGKVTGFDAAKISVAITKAFLAVEGGNA 63

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S R+ + ++ LT+  V  LL+       +HIEDIQDQVE +LM++GH K+ R YVLYR
Sbjct: 64  AASRRIHESVEELTDLVVRALLRRLPGGGTIHIEDIQDQVELALMRAGHQKVARAYVLYR 123

Query: 123 EERSDVRAAQS-HSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIV 181
           EER+ +RA +    K+       +++ ++DGT    ++ RL  +VEEAC GL DV    +
Sbjct: 124 EERARLRAEKQNEGKAQGGAEDVVQVTLEDGTRKPLDTARLRHVVEEACRGLSDVEPAWI 183

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           + ET +N++DG+ E ++   L+ ++RT IE+E NY+ V AR LL+ LRRE L+ +     
Sbjct: 184 IEETRRNLFDGVPEKEVAPTLVMTARTRIEQESNYSYVAARLLLDALRREALSFLGHGAV 243

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
            AT  EM   Y EYF  Y++ GV+  LL   +  FDL  L   LK ERD  F YLGLQ L
Sbjct: 244 SATQDEMSERYGEYFKDYVKRGVELELLSPELARFDLQRLGEALKPERDLQFNYLGLQTL 303

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYF+H    R E+PQAFFMRVAMGLA++E ++E+RA+EFY+LLSSF FM STPTLFN+
Sbjct: 304 YDRYFIHSGDIRFELPQAFFMRVAMGLAIQEVDREERAIEFYDLLSSFDFMSSTPTLFNA 363

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT  PQLSSC+LTTVPDDL GI+ A+++NA+L+K++GGLGNDWT VRG+GAHI GTNGKS
Sbjct: 364 GTLRPQLSSCYLTTVPDDLDGIYSAIKDNALLSKFAGGLGNDWTRVRGMGAHIKGTNGKS 423

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKVANDTAVAVNQGGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRRRTHDMNT
Sbjct: 424 QGVVPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRRRTHDMNT 483

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANW+PDLFMKRV +   WTLFSP++  DLHDL G+ FE  Y+ YE +ADRGEIK+++++ 
Sbjct: 484 ANWVPDLFMKRVAEEREWTLFSPNDTPDLHDLTGQSFERRYQEYEAKADRGEIKLYKRLP 543

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           AV LWRKML+MLFETGHPW+ FKDPCN+R   QH GVVHSSNLCTEITL+++  E AVCN
Sbjct: 544 AVQLWRKMLSMLFETGHPWLAFKDPCNLRYTNQHAGVVHSSNLCTEITLHTNDNEIAVCN 603

Query: 602 LGSINLLAHFANNQF-DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           LGS+NL AH   +   D +KL  TI T +R+LDNVIDIN +++ +A++SN  HR +GLG+
Sbjct: 604 LGSVNLAAHITPDGALDTEKLQRTIATGMRMLDNVIDINYYSVPQARRSNLRHRPVGLGI 663

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ AL+ L +PYAS EAV  AD SME +S++AI AS +LA ERG YSSF GSLW +G+
Sbjct: 664 MGFQDALYKLRLPYASQEAVAFADLSMEAVSYYAIQASCDLAAERGRYSSFDGSLWSRGI 723

Query: 721 FPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
            PIDSI LL E R   L M+R+  L W+ L++RV+T+GMRNSN MAIAPTATI+NICGVS
Sbjct: 724 LPIDSIALLEEGRGGYLQMDRSQTLDWNALRERVRTVGMRNSNTMAIAPTATISNICGVS 783

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
           QSI+P+YQNL+VKSN+SG+FTVVN +LV +LK   LWD  MI+DLKY+DGS+  IERIP+
Sbjct: 784 QSIEPTYQNLFVKSNLSGEFTVVNPYLVRDLKTLGLWDAVMINDLKYYDGSVQKIERIPE 843

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
            LK+++ATAFEID  WLIE+ SRRQKW+DQAQSLNLYL EPSGKKLD +Y+ AW+ GLKT
Sbjct: 844 TLKQLYATAFEIDARWLIEAGSRRQKWLDQAQSLNLYLAEPSGKKLDTLYKLAWVRGLKT 903

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPN-------------SSTHSLGIPSSCTS 946
           TYYLRS  AT VEKST    DGKLNAV     +             + T      +    
Sbjct: 904 TYYLRSLGATHVEKST--AFDGKLNAVKTDPIDDAIPGLRPLETVYADTRPAEPKACLID 961

Query: 947 DTECEVCQ 954
           D  CE CQ
Sbjct: 962 DPTCEACQ 969


>gi|170720378|ref|YP_001748066.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           putida W619]
 gi|169758381|gb|ACA71697.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           putida W619]
          Length = 959

 Score = 1009 bits (2608), Expect = 0.0,   Method: Composition-based stats.
 Identities = 555/956 (58%), Positives = 704/956 (73%), Gaps = 13/956 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           + +     D+   LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QALAPQAADSNQDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++
Sbjct: 68  SSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQ 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  RA ++++ +     P ++I + DG+L   +  RL  I+ EAC GL +V   ++  E
Sbjct: 128 RAKERATRANTDAAVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGDLIQRE 187

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +      AT
Sbjct: 188 TLKNLYDGVAIKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFLN-VADSAT 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    YI +GV+  LL+ ++ DFDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 247 HHEMADLYAKALPAYIAKGVEFELLNPALADFDLEKLGKAINHERDQQFTYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 307 YFIHKDGVRFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 367 RPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ I A  
Sbjct: 487 IPDLFMKRVFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTIQAKD 546

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS
Sbjct: 547 LWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGS 606

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
           INL  H  + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ
Sbjct: 607 INLPNHIVDGKLDTAKLQRTVNTAVRMLDNVIDINYYSVPQARNSNFKHRPVGLGIMGFQ 666

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            AL+L HIPY S  AVE AD+SME +S+ AI AS +LA ERGAY +F+GSLW +G+ P+D
Sbjct: 667 DALYLQHIPYGSDAAVEFADKSMEAVSYFAIQASCDLADERGAYETFQGSLWSKGILPLD 726

Query: 725 SIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSI 782
           S  +L E R    + +N    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI
Sbjct: 727 SQQILIEARGQKYIDVNLEETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSI 785

Query: 783 DPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLK 842
           +P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +LK
Sbjct: 786 EPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELK 845

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYY 902
            ++ATAFE++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYY
Sbjct: 846 DLYATAFEVETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYY 905

Query: 903 LRSRSATSVEKSTLKGVDGKLNAVPVTDPN----SSTHSLGIPSSCTSDTECEVCQ 954
           LR+ +ATS EKST+    GKLNAV     +    ++  +    +    + +CE CQ
Sbjct: 906 LRALAATSTEKSTIN--TGKLNAVSSGGDSAPAQAAGPAPVPKACAIDEPDCEACQ 959


>gi|110635037|ref|YP_675245.1| ribonucleotide-diphosphate reductase subunit alpha [Mesorhizobium
           sp. BNC1]
 gi|110286021|gb|ABG64080.1| ribonucleoside-diphosphate reductase, alpha subunit [Chelativorans
           sp. BNC1]
          Length = 954

 Score = 1008 bits (2607), Expect = 0.0,   Method: Composition-based stats.
 Identities = 603/954 (63%), Positives = 736/954 (77%), Gaps = 5/954 (0%)

Query: 4   SKDVNKGDEDAFPSLAYPFP---EKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK 60
           +      +  A   +  P P   E     +VI+RNG VT FDPSKI+ A+ KAF+AVEG 
Sbjct: 3   ATATQLSNGSAAGPVFTPAPVEREAESAYRVIRRNGSVTPFDPSKIAIALTKAFLAVEGS 62

Query: 61  GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL 120
            A+ S RV +++++LTEQ V  L + N++    HIE+IQDQVE +LM+ GHHK+ R YVL
Sbjct: 63  VAAGSRRVHEVVEDLTEQVVGALTRRNEAGRTFHIEEIQDQVELALMRDGHHKVARAYVL 122

Query: 121 YREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI 180
           Y       R   +   ++    P L++M++DG+    +  RL  +VEEAC GL+ VS++ 
Sbjct: 123 Y--REERARERAATKTAENAAQPILQVMLEDGSKTPLDIARLTAVVEEACQGLEAVSAEA 180

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +LSE  +N+YDG++  +L  A I ++RTL+E EPNY++V+AR LL+KLRRE LT V  +P
Sbjct: 181 ILSEAQRNLYDGITLDELSLAPILAARTLVETEPNYSQVSARLLLDKLRREALTFVEGRP 240

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
            +AT  EM   YP YF  +I  G++A ++   +  FDL  L   LK ERD  F+YLG Q 
Sbjct: 241 TQATQAEMVERYPAYFEGFIAAGIQAEMIDPELGRFDLKRLGAALKPERDLRFQYLGFQT 300

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLH +G R E+PQAFFMRVAMGLAL+E ++E RA+EFY+L+S+F FMCSTPTLFN
Sbjct: 301 LYDRYFLHEDGVRYELPQAFFMRVAMGLALREIDREARAIEFYDLISTFDFMCSTPTLFN 360

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           +GT  PQLSSCFLTTV DDL GIF A+++NA+LAKYSGGLGNDWTPVRGLGA I GTNGK
Sbjct: 361 AGTLRPQLSSCFLTTVSDDLDGIFKAVKDNALLAKYSGGLGNDWTPVRGLGARIKGTNGK 420

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQG++PFLKVANDTA+AVNQGGKRKGAVCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMN
Sbjct: 421 SQGIVPFLKVANDTAIAVNQGGKRKGAVCAYLETWHVDIEEFLDLRKNTGDDRRRTHDMN 480

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANW+PDLFM+RV  +  WTLFSPDE  DLHDLYG  F+ AYE YE +A RGEI+VFR++
Sbjct: 481 TANWVPDLFMERVEADGEWTLFSPDETPDLHDLYGPAFKAAYEEYEARAARGEIRVFRQV 540

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            AV LWR+MLTMLFETGHPWITFKDPCN+RSPQ+H GVVHSSNLCTEITLN+S +E AVC
Sbjct: 541 RAVDLWRRMLTMLFETGHPWITFKDPCNLRSPQRHAGVVHSSNLCTEITLNTSKDEVAVC 600

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGSINL AH +    D +KLA T+ TA+R+LDNVIDIN +TI +A++SN  HR +GLGL
Sbjct: 601 NLGSINLAAHVSEKGLDMEKLARTVATAMRMLDNVIDINFYTIPEARRSNLRHRPVGLGL 660

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ AL  L +PYAS  AVE AD SME I++HAISASVELA+ERGAY+SF+GSLW +GV
Sbjct: 661 MGFQDALQTLRLPYASEGAVEFADRSMEAIAYHAISASVELAKERGAYASFEGSLWSKGV 720

Query: 721 FPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
            PIDS+  +AE R    M+R + L W+ L+ RV   GMRNSN MAIAPTATI+NICGVSQ
Sbjct: 721 LPIDSLSFVAESRGVDGMDRGTTLDWESLRARVVEHGMRNSNTMAIAPTATISNICGVSQ 780

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNL+VKSNMSGDFTVVN+ LV++LK R LWDE M+SDLKY+DG +G I+R+PDD
Sbjct: 781 SIEPAYQNLFVKSNMSGDFTVVNAALVHDLKARGLWDEVMVSDLKYYDGLLGQIDRVPDD 840

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK ++ATAFEIDP WLIE+ASRRQKWIDQAQSLNLY+  PSGKKLD +YR AW  GLKTT
Sbjct: 841 LKALYATAFEIDPAWLIEAASRRQKWIDQAQSLNLYIANPSGKKLDELYRLAWRKGLKTT 900

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           YYLRSRSAT VEKSTLK  DGKLNAV V    ++    G+ +    D +CE CQ
Sbjct: 901 YYLRSRSATHVEKSTLKRADGKLNAVAVMPQPAAFELEGVKACAIDDPDCEACQ 954


>gi|330811234|ref|YP_004355696.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379342|gb|AEA70692.1| Ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 963

 Score = 1006 bits (2601), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/960 (57%), Positives = 703/960 (73%), Gaps = 17/960 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +       D+ P L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QGTAPLAADSNPDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ 
Sbjct: 68  SSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDS 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  RA +S + +     P ++I   DG+L   +  RL  IV EAC GL++V   ++  E
Sbjct: 128 RAKERATRSPADAPVQAHPSIRIARADGSLAPLDMGRLNTIVTEACEGLEEVDGDLIQRE 187

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L +  +  + AT
Sbjct: 188 TLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGL-SFLEVAESAT 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    Y+ +G++  LL+  + +FDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 247 HHEMVDLYAKALPAYVAKGIEFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLA++E ++E RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 307 YFIHKDGVRFELPQIFFMRVAMGLAIEEKQREDRAIEFYNLLSSFDYMASTPTLFNAGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+GA+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 367 RPQLSSCYLTTVPDDLSGIYGAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IK+F+ + A  
Sbjct: 487 IPDLFMKRVFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKLFKVVQAKD 546

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS
Sbjct: 547 LWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGS 606

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
           INL  H  + + D  KL  T+ TAVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ
Sbjct: 607 INLPNHIVDGKLDTAKLQRTVNTAVRMLDNVIDINYYSVPQAKNSNFKHRPVGLGIMGFQ 666

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            AL+L HIPY S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW QG+ P+D
Sbjct: 667 DALYLQHIPYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSQGILPLD 726

Query: 725 SIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSI 782
           S  +L   R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI
Sbjct: 727 SQQILIAQRGQKYIDVDLNESLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSI 785

Query: 783 DPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLK 842
           +P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +LK
Sbjct: 786 EPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELK 845

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYY 902
           +++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYY
Sbjct: 846 ELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYY 905

Query: 903 LRSRSATSVEKSTLKGVDGKLNAVPVTDP--------NSSTHSLGIPSSCTSDTECEVCQ 954
           LR+ +ATS EKST+    GKLNAV               +  +    +    + +CE CQ
Sbjct: 906 LRALAATSTEKSTIN--TGKLNAVSSGGNHGDDSVLAAPAGPAPVPKACAIDEPDCEACQ 963


>gi|209885873|ref|YP_002289729.1| ribonucleoside-diphosphate reductase alpha subunit [Oligotropha
           carboxidovorans OM5]
 gi|209874069|gb|ACI93865.1| ribonucleoside-diphosphate reductase alpha subunit [Oligotropha
           carboxidovorans OM5]
          Length = 969

 Score = 1005 bits (2599), Expect = 0.0,   Method: Composition-based stats.
 Identities = 608/953 (63%), Positives = 737/953 (77%), Gaps = 13/953 (1%)

Query: 14  AFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIK 73
             P    P P +   +Q+I+RNG V+ FDPSKIS A+ KAF+AVEG  A+ S RV +I++
Sbjct: 18  LSPESLAPSP-REPAMQIIRRNGTVSRFDPSKISIAMTKAFLAVEGHTAAASRRVHEIVE 76

Query: 74  NLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS 133
            LT++ VT L +        HIED+QDQVE +LM+S HHK+ R YVLYREER+  RAA  
Sbjct: 77  GLTQEVVTNLTRRLGEGRTFHIEDVQDQVELALMRSEHHKVARAYVLYREERARERAAGK 136

Query: 134 HSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGL 193
            +++     P L++ + +GT    + KRLE+I+ EA  GL  V    VL+E  +N+YDG+
Sbjct: 137 SAEAAVSNEPALQMTLANGTRAPLDIKRLELIIREAGEGLDGVDPAPVLAEARRNLYDGI 196

Query: 194 SESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYP 253
           S+ +L  A I ++RTL+E EPNYA V+AR LL+KLR EVLT +YK P  A+  +M   Y 
Sbjct: 197 SQDELALAPIMAARTLVEHEPNYAYVSARLLLDKLRSEVLTYLYKTPTSASQADMATRYA 256

Query: 254 EYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSR 313
           EYF  Y++ G++A LL   +  FDL  LA+ LK ERD  F++LGLQ LYDRYFLH+ GSR
Sbjct: 257 EYFPVYVKAGIEAELLDPELGRFDLDRLASALKPERDLQFQFLGLQTLYDRYFLHVGGSR 316

Query: 314 IEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFL 373
           +E+PQAFFMRVAMGLA++E ++E RA+EFYNLLSSF FM STPTLFNSGT  PQLSSCFL
Sbjct: 317 LELPQAFFMRVAMGLAVREIDREARAIEFYNLLSSFDFMASTPTLFNSGTLRPQLSSCFL 376

Query: 374 TTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAND 433
           TTV DDL GIF A+++NA+LAKYSGGLGNDWT VRGLGAHI GTNG+SQGV+PFLKVAND
Sbjct: 377 TTVADDLDGIFKAVKDNALLAKYSGGLGNDWTNVRGLGAHIKGTNGESQGVVPFLKVAND 436

Query: 434 TAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV 493
           TA+AVNQGGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRRRTHDMNTANW+PDLFM+RV
Sbjct: 437 TAIAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLFMQRV 496

Query: 494 TQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTML 553
            ++  WTLFSPDE  DLHDLYG  F+ AYE YE +A RGEI VF+++ A  LWR+MLTML
Sbjct: 497 EEDGTWTLFSPDETPDLHDLYGPAFKAAYEGYEAKAARGEIHVFKEMRATDLWRRMLTML 556

Query: 554 FETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFAN 613
           FETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGSINLL H   
Sbjct: 557 FETGHPWITFKDACNLRSPQQHAGVVHSSNLCTEITLNTSADEVAVCNLGSINLLNHTTR 616

Query: 614 NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIP 673
              ++DKL  TI TAVR+LDNVIDIN +TI +A++SN  HR +GLGLMGFQ ALH+  IP
Sbjct: 617 EGLNHDKLKRTIATAVRMLDNVIDINFYTIPEARRSNLKHRPVGLGLMGFQDALHIQRIP 676

Query: 674 YASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR 733
             S  AV  ADESME IS+HAISASV+LA ERG Y SF+GSLW QG+ PIDS+ +LA+ R
Sbjct: 677 ITSDAAVAFADESMEIISYHAISASVDLAGERGRYPSFEGSLWSQGMLPIDSVSILAKAR 736

Query: 734 DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS 793
           +   ++ ++ L W  L++RVKT GMRNSN MAIAPTATI+NICGV+QSI+P+YQNLYVKS
Sbjct: 737 NGAPLDTSATLDWSGLRERVKTDGMRNSNVMAIAPTATISNICGVTQSIEPAYQNLYVKS 796

Query: 794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDP 853
           NMSGDFTVVN FLV +LK R LWDE M+SDLKY DGS+G I+R+PDDLK ++AT FEID 
Sbjct: 797 NMSGDFTVVNEFLVRDLKSRGLWDEVMVSDLKYFDGSVGQIDRVPDDLKALYATVFEIDT 856

Query: 854 MWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK 913
            WLI++A+RRQKWIDQAQSLNLY+  PSGKKLD +YR AW +GLKTTYYLRSRSAT VEK
Sbjct: 857 SWLIQAAARRQKWIDQAQSLNLYIANPSGKKLDQLYRLAWQLGLKTTYYLRSRSATHVEK 916

Query: 914 STLKGVDGKLNAVPVTDPNS------------STHSLGIPSSCTSDTECEVCQ 954
           STLKG DGKLNAV  + P++            +    G+ +    + +CE CQ
Sbjct: 917 STLKGTDGKLNAVSASIPSAQQHAPIVVPNDTAPDLTGVKACSIDNPDCEACQ 969


>gi|146308171|ref|YP_001188636.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           mendocina ymp]
 gi|145576372|gb|ABP85904.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           mendocina ymp]
          Length = 968

 Score = 1004 bits (2596), Expect = 0.0,   Method: Composition-based stats.
 Identities = 556/966 (57%), Positives = 709/966 (73%), Gaps = 24/966 (2%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           + V     D+   LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QAVAPQGADSSQDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YRE 
Sbjct: 68  SSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYREA 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           +++ R A + S+   P  P ++I   DG+L   +  RL+ I+ EAC GL +V   ++  E
Sbjct: 128 QANKRKASAGSEIAQP-HPSIRITAADGSLQPLDMGRLQTIIREACEGLAEVDGALIERE 186

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++E D+ TAL+ ++RTL+E+EPNY+ VTAR L++ +R E L T     Q AT
Sbjct: 187 TLKNLYDGVAEKDVNTALVMTARTLVEREPNYSYVTARLLMDNIRAEAL-TFLGITQSAT 245

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    Y+++GV+  LL   + ++DL  L   L +ERD  F YLGLQ LYDR
Sbjct: 246 HHEMVDLYAKALPAYVDKGVEFELLDPKLKEYDLEKLGKALNHERDQQFTYLGLQTLYDR 305

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           YF+H +G R E+PQ FFMRVAMGLA++E   +E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 306 YFIHKDGIRFELPQVFFMRVAMGLAIEEPKNREDRAIEFYNLLSSFDYMASTPTLFNAGT 365

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 366 LRPQLSSCYLTTVPDDLSGIYSAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 425

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTAN
Sbjct: 426 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNTAN 485

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAV 543
           WIPDLFMKRV ++  WTLFSP EV DLHDL GK FE  YE YE   + G+IK+++ I A 
Sbjct: 486 WIPDLFMKRVFEDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALIEYGKIKLYKTIQAK 545

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLG 603
            LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLG
Sbjct: 546 DLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLG 605

Query: 604 SINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGF 663
           S+NL+ H  + + D +KL  T++TAVR+LDNVIDIN +++ +A+ SN  HR +GLGLMGF
Sbjct: 606 SVNLVNHIVDGKLDIEKLGRTVKTAVRMLDNVIDINYYSVPQARNSNLKHRPVGLGLMGF 665

Query: 664 QSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPI 723
           Q AL+L HI Y S  A+E AD SME IS++AI AS +LA+ERGAYS+F+GSLW +G+ P+
Sbjct: 666 QDALYLQHIAYGSDAAIEFADRSMEAISYYAIQASCDLAEERGAYSTFEGSLWSKGILPL 725

Query: 724 DSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
           DS  +L E R    + ++ +  L W  L++RVK  G+RNSN MAIAPTATI+NI GVSQS
Sbjct: 726 DSQQILIEARGQKYIDVDLSESLDWAPLRERVKK-GIRNSNIMAIAPTATISNIIGVSQS 784

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  M++DLKY+DGS+  IERIP DL
Sbjct: 785 IEPTYQNLYVKSNLSGEFTVINPYLVRDLKNRGLWDPVMVNDLKYYDGSVQQIERIPQDL 844

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           K ++ATAFE++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTY
Sbjct: 845 KDLYATAFEVETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTY 904

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVTDPN-------------SSTHSLGIPSSCTSDT 948
           YLR+ +ATS EKST+    GKLNAV                   +   +    +    + 
Sbjct: 905 YLRALAATSTEKSTIN--TGKLNAVSAGGDEGFSAKAQAPAQQAAPAPAPVPKACAIDEP 962

Query: 949 ECEVCQ 954
           +CE CQ
Sbjct: 963 DCEACQ 968


>gi|77460467|ref|YP_349974.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           fluorescens Pf0-1]
 gi|77384470|gb|ABA75983.1| ribonucleoside-diphosphate reductase alpha chain [Pseudomonas
           fluorescens Pf0-1]
          Length = 964

 Score = 1004 bits (2596), Expect = 0.0,   Method: Composition-based stats.
 Identities = 555/961 (57%), Positives = 700/961 (72%), Gaps = 18/961 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +       D+   LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QGTLPQAADSNSDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ 
Sbjct: 68  SSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDA 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           RS  RA ++ +++     P ++I   DG+L   +  RL  IV EAC GL +V   ++  E
Sbjct: 128 RSKERATRTTAEAPVQAHPSIRITRADGSLAPLDMGRLNTIVTEACEGLAEVDGDLIQRE 187

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++ +D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L       + AT
Sbjct: 188 TLKNLYDGVALNDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVAESAT 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    Y+ +G++  LL+  +  FDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 247 HHEMADLYAKALPAYVAKGIEFELLNPVLASFDLEKLGKAINHERDQQFTYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLA++E +KE RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 307 YFIHKDGVRFELPQIFFMRVAMGLAIEEKQKEDRAIEFYNLLSSFDYMASTPTLFNAGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 367 RPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISAV 543
           IPDLFMKRV  +  WTLFSP EV DLHDL GK FE  YE YE      G+IK+F+ I A 
Sbjct: 487 IPDLFMKRVFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYPGKIKLFKTIQAK 546

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLG 603
            LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLG
Sbjct: 547 DLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLG 606

Query: 604 SINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGF 663
           SINL  H  + + D  KL  TI  AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGF
Sbjct: 607 SINLPNHIVDGKLDTAKLKRTIDVAVRMLDNVIDINYYSVPQAKNSNFRHRPVGLGIMGF 666

Query: 664 QSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPI 723
           Q AL+L HIPY S  AVE AD+SME +S++AI AS +LA ERG+Y +F+GSLW +GV P+
Sbjct: 667 QDALYLQHIPYGSDAAVEFADKSMEAVSYYAIQASCDLADERGSYETFQGSLWSKGVLPL 726

Query: 724 DSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
           DS  +L E R    + ++ T  L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQS
Sbjct: 727 DSQQILIEARGQKYIDVDLTESLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQS 785

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +L
Sbjct: 786 IEPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQEL 845

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           K+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTY
Sbjct: 846 KELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTY 905

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVTDP--------NSSTHSLGIPSSCTSDTECEVC 953
           YLR+ +ATS EKST+    GKLNAV               +  +    +    + +CE C
Sbjct: 906 YLRALAATSTEKSTIN--TGKLNAVSSGGNHGDDSVLAAPAGPAPVPKACAIDEPDCEAC 963

Query: 954 Q 954
           Q
Sbjct: 964 Q 964


>gi|119504229|ref|ZP_01626309.1| ribonucleotide-diphosphate reductase alpha subunit [marine gamma
           proteobacterium HTCC2080]
 gi|119459737|gb|EAW40832.1| ribonucleotide-diphosphate reductase alpha subunit [marine gamma
           proteobacterium HTCC2080]
          Length = 964

 Score = 1003 bits (2594), Expect = 0.0,   Method: Composition-based stats.
 Identities = 566/955 (59%), Positives = 716/955 (74%), Gaps = 10/955 (1%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           +  V      +   L    P +   ++VIKRNG VTSF+ SKIS AI KAF+AVEG  A+
Sbjct: 16  TAPVTGTGNTSSGRLQATAPGQ---LRVIKRNGTVTSFEDSKISVAITKAFLAVEGGTAA 72

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S R+ + +  LTEQ +T   +   S   +HIEDIQDQVE +LM++G HKI R+YV+YRE
Sbjct: 73  ASSRIHETVAKLTEQVITTFKRRMPSGGTIHIEDIQDQVELALMRAGEHKIARDYVIYRE 132

Query: 124 ERSDVRAAQSHSKSD-APIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVL 182
           ER+  RAA++    +    A  + ++M DG+    N +R+  IV EAC+ L DVS   ++
Sbjct: 133 ERARDRAAKAALSPESQAAASGINVVMPDGSREPLNIERVRTIVSEACADLVDVSESAII 192

Query: 183 SETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQK 242
            E  +N+YDG++  ++ T+L+ ++RT+IE++PNY+ V AR LL+ LR E L  +    + 
Sbjct: 193 DEALRNLYDGVTADEVSTSLVITARTMIEQDPNYSYVAARLLLDNLRAESLNYL-GVAKS 251

Query: 243 ATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILY 302
           AT  +M  LY E    +I +GV   LL   +++FD+  L   L  ERD  F YLGLQ LY
Sbjct: 252 ATQSDMAQLYSEALSAFIHQGVTLELLSPELLEFDIAALGQALLPERDLQFSYLGLQTLY 311

Query: 303 DRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSG 362
           DRYF+H +  RIE+PQ FFMRVAMGL+++E +   RA+EFY LLSSF +M STPTLFNSG
Sbjct: 312 DRYFIHADEVRIELPQVFFMRVAMGLSIREDDPNTRAIEFYQLLSSFDYMSSTPTLFNSG 371

Query: 363 TRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQ 422
           T   QLSSC+LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LG++I GTNGKSQ
Sbjct: 372 TLRSQLSSCYLTTVPDDLFGIYGAIQDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQ 431

Query: 423 GVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTA 482
           G++PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTA
Sbjct: 432 GIVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTA 491

Query: 483 NWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISA 542
           NWIPDLFMKRV ++  WTLFSP++V DLHDLYG+ FE  Y  YE  A  GEI+V + + A
Sbjct: 492 NWIPDLFMKRVFEDGDWTLFSPNDVPDLHDLYGRAFEDRYAQYEAMAASGEIRVHKTLKA 551

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
            A+WRKML M+FETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S++E AVCNL
Sbjct: 552 QAVWRKMLGMIFETGHPWVTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTSADEIAVCNL 611

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GS+NL  H  + + +  KL +T+RTA+R+LDNVIDIN +++ +A++SN  HR IGLG+MG
Sbjct: 612 GSVNLPQHIEDGKLNLKKLRATVRTAIRMLDNVIDINYYSVPQAEQSNMRHRPIGLGIMG 671

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+ + + YAS  AV  AD+SME +S+ AI AS ELA ERGAYSS++GSLW QGVFP
Sbjct: 672 FQDALYKIDVSYASKGAVSFADQSMEAVSYFAIEASSELAAERGAYSSYEGSLWSQGVFP 731

Query: 723 IDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           +DS+ +L E R    + +NR     W ELK RV   GMRNSNCMAIAPTATIANI GVSQ
Sbjct: 732 LDSLDILVEQRGANYIEVNRDMTFDWPELKGRVAKHGMRNSNCMAIAPTATIANITGVSQ 791

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNLYVKSN+SG+FTVVN +LV +LK RDLWD+ M++DLKY DGS+ +I+RIPDD
Sbjct: 792 SIEPTYQNLYVKSNLSGEFTVVNPYLVRDLKARDLWDKVMVNDLKYFDGSVQSIDRIPDD 851

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK  ++TAFEI+P WL++SASRRQKWIDQAQSLNLY++  SGKKLD  YR AW  GLKTT
Sbjct: 852 LKAKYSTAFEIEPRWLVDSASRRQKWIDQAQSLNLYINNASGKKLDVTYRMAWYSGLKTT 911

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           YYLRS +AT  EKST++   GKLNAV      S+     +P +C+  D +CE CQ
Sbjct: 912 YYLRSLAATGTEKSTVE--SGKLNAVASGAAESTPQPAPVPQACSLDDPDCEACQ 964


>gi|220935778|ref|YP_002514677.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219997088|gb|ACL73690.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 971

 Score = 1003 bits (2593), Expect = 0.0,   Method: Composition-based stats.
 Identities = 583/956 (60%), Positives = 722/956 (75%), Gaps = 8/956 (0%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           + +V+   +     LA   P +     VI+RNG VT+FD SKI  AI KAF+AVEG  A+
Sbjct: 19  APEVSPESQVTAAELAATAPGQH---HVIRRNGKVTAFDASKIKVAITKAFLAVEGGNAA 75

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSAL-IVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
            S R+ DI+  L EQ    L +    +   VHIEDIQDQVE +LM+ GHHKI R YVLYR
Sbjct: 76  ASRRIHDIVAELAEQVCENLFRRAGGSAVTVHIEDIQDQVELALMRGGHHKIARAYVLYR 135

Query: 123 EERSDVRAAQSHSKSDAPIAP--KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI 180
           E+++  RAA++ ++  A  A    + +   DGT    ++ RL  +VEEAC+GL+ V  ++
Sbjct: 136 EQQAQKRAAEAATRKPARQAEAAVIHVTRPDGTRAPLDTARLVKVVEEACAGLEAVDGQL 195

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +L+E  +N++DG++E D+ TAL+ S+R LIEKEPNY++VTAR L++ LRRE L+ +   P
Sbjct: 196 ILNEAQRNLFDGVAEKDVGTALVMSARVLIEKEPNYSQVTARLLMDTLRREALSFIAGLP 255

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           Q AT  EM   YPEYF  Y++   +  LL   +  +DL  L   LK ERD  F YLGLQ 
Sbjct: 256 QAATQAEMTQRYPEYFKAYVKRAAELELLDSELTRYDLDRLGAALKPERDLQFTYLGLQT 315

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYF+H  G R E+PQAFFMRVAMGLA+ E ++E RA+EFYNLLSSF FM STPTLFN
Sbjct: 316 LYDRYFIHSGGVRFELPQAFFMRVAMGLAIHEIDREGRAIEFYNLLSSFDFMSSTPTLFN 375

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGT  PQLSSC+LTTVPDDL GIFGA+++NA+L+K++GGLGNDWT VRG+GAHI GTNGK
Sbjct: 376 SGTLRPQLSSCYLTTVPDDLDGIFGAIKDNALLSKFAGGLGNDWTRVRGMGAHIKGTNGK 435

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKVANDTAVAVNQGGKRKGAVCAYLETWH+DVEEF++LRKNTGDDRRRTHDMN
Sbjct: 436 SQGVVPFLKVANDTAVAVNQGGKRKGAVCAYLETWHVDVEEFIELRKNTGDDRRRTHDMN 495

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           +ANWIPDLFMKRV +   WTLFSP+E  DLHDL G+ FE  Y  YE +A RGEIKVF+K+
Sbjct: 496 SANWIPDLFMKRVAEEGEWTLFSPNETPDLHDLVGEAFEQRYAEYEAKAARGEIKVFKKL 555

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            AV LWRKML MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S +E AVC
Sbjct: 556 KAVDLWRKMLAMLFETGHPWMTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTSDDEIAVC 615

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGS+NL AH   N  + +KL  T+ TA+R+LDNVID N +++ +A++SN  HR +GLG+
Sbjct: 616 NLGSVNLAAHVDENGLNLEKLERTVSTAMRMLDNVIDYNYYSVPQARRSNLRHRPVGLGI 675

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ AL+   IPYAS +AVE AD SME +S++AI AS +LA+ERG Y SF GSLW QGV
Sbjct: 676 MGFQDALYQQRIPYASEDAVEFADRSMEAVSYYAIKASTDLAEERGRYQSFDGSLWSQGV 735

Query: 721 FPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
            PIDSI LLA+ R   L  + +    WD L+ RVKT+GMRNSN MAIAPTATI+NICGVS
Sbjct: 736 LPIDSIELLAKSRGQYLQQDTSMTFDWDSLRDRVKTVGMRNSNTMAIAPTATISNICGVS 795

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
           QSI+P+YQNL+VKSN+SG+FTV+N  LVN+LK R LWDE M++DLKY+DGS+  I+R+P 
Sbjct: 796 QSIEPTYQNLFVKSNLSGEFTVINPNLVNDLKARKLWDEVMVNDLKYYDGSVQPIDRVPA 855

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
           DLK+++ATAFE+D  WL+E+ASRRQKW+DQAQSLNLY+ EPSGKKLD +Y+ AW+ GLKT
Sbjct: 856 DLKQLYATAFELDARWLVEAASRRQKWLDQAQSLNLYMAEPSGKKLDNLYKLAWVRGLKT 915

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTS-DTECEVCQ 954
           TYYLRS  AT VEKST+           V   +++  +   P  C+  D ECE CQ
Sbjct: 916 TYYLRSMGATHVEKSTVADASRANKLNAVKGADAAAPATEAPKMCSILDPECEACQ 971


>gi|70731822|ref|YP_261564.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           fluorescens Pf-5]
 gi|68346121|gb|AAY93727.1| ribonucleoside-diphosphate reductase, alpha chain [Pseudomonas
           fluorescens Pf-5]
          Length = 963

 Score = 1003 bits (2593), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/961 (57%), Positives = 701/961 (72%), Gaps = 17/961 (1%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           S+       D+   L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+
Sbjct: 10  SQANAPQAADSTQDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAA 66

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+
Sbjct: 67  ASSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRD 126

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLS 183
            R+  RA +S S+      P ++I   DG+    +  RL  IV EAC GL++V   ++  
Sbjct: 127 SRAKERATRSTSEEPVQAHPSIRITRTDGSFAPLDMGRLNTIVSEACEGLEEVDGDLIQR 186

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
           ET KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L    +  + A
Sbjct: 187 ETLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLEVAESA 245

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           THHEM  LY +    Y+ +G++  LL+  + +FDL  L   + +ERD  F YLGLQ LYD
Sbjct: 246 THHEMAELYAKALPAYVAKGIEFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYD 305

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H +G R E+PQ FFMRVAMGLA++E ++E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 306 RYFIHKDGVRFELPQIFFMRVAMGLAIEEKQREDRAIEFYNLLSSFDYMASTPTLFNAGT 365

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+GA+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 366 LRPQLSSCYLTTVPDDLSGIYGAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 425

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 426 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTAN 485

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAV 543
           WIPDLFMKRV  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IK+F+ + A 
Sbjct: 486 WIPDLFMKRVFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKLFKTVQAK 545

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLG 603
            LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLG
Sbjct: 546 DLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLG 605

Query: 604 SINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGF 663
           SINL  H  + + D  KL  T+ TAVR+LDNVIDIN +++ +AK SN  HR +GLG+MGF
Sbjct: 606 SINLPNHIVDGKLDTAKLQRTVNTAVRMLDNVIDINYYSVPQAKNSNFKHRPVGLGIMGF 665

Query: 664 QSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPI 723
           Q AL+L HI Y S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+
Sbjct: 666 QDALYLQHIAYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPL 725

Query: 724 DSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
           DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQS
Sbjct: 726 DSQQILIEARGQKYIDVDLNESLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQS 784

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +L
Sbjct: 785 IEPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQEL 844

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           K+++ATAFE++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTY
Sbjct: 845 KELYATAFEVETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTY 904

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVTDP--------NSSTHSLGIPSSCTSDTECEVC 953
           YLR+ +ATS EKST+    GKLNAV               +  +    +    + +CE C
Sbjct: 905 YLRALAATSTEKSTIN--TGKLNAVSSGGNHGDDSVLAAPAGPAPVPKACAIDEPDCEAC 962

Query: 954 Q 954
           Q
Sbjct: 963 Q 963


>gi|192291020|ref|YP_001991625.1| ribonucleotide-diphosphate reductase subunit alpha
           [Rhodopseudomonas palustris TIE-1]
 gi|192284769|gb|ACF01150.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Rhodopseudomonas palustris TIE-1]
          Length = 974

 Score = 1002 bits (2591), Expect = 0.0,   Method: Composition-based stats.
 Identities = 590/958 (61%), Positives = 720/958 (75%), Gaps = 17/958 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
               +            QVI+R+G V+ FD SKI+ A+ KAF+AVEG  A+ S RV D +
Sbjct: 18  PLASADVVAGAAHETSYQVIRRSGEVSPFDASKIAVALTKAFLAVEGSNAAASRRVHDTV 77

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LT+Q V  L +        HIEDIQDQ E +LM+S HHK+ R YV+YREER+  RA +
Sbjct: 78  AELTDQIVANLTRRVGPGRTFHIEDIQDQAELALMRSEHHKVARAYVIYREERTRERA-K 136

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           + +    P+AP L+    DGTL   + +RL  I+ EAC+GL  VS   VL+ET +N+YDG
Sbjct: 137 AAAAQVKPVAPALRTKSADGTLHLIDMQRLAAIIAEACAGLDGVSVDAVLAETQRNLYDG 196

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           +S+ +L  A I ++R  +E EP+YAKV+AR LL+KLRRE L+ V  +P +AT  +M   Y
Sbjct: 197 ISDDELALAPILAARIFVETEPDYAKVSARLLLDKLRREALSFVEGRPHQATQAQMAERY 256

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +YF  Y++ G+   L+   +  FD+  LA  +K ERD  F+YLGLQ LYDRYFLH++G+
Sbjct: 257 ADYFSAYVKAGIAHELIDPEIGRFDVSKLAAAIKPERDLQFDYLGLQTLYDRYFLHVHGT 316

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQAFFMRVA G+AL+E ++E +A+EFY+LLSSF FM STPTLFN+GT  PQLSSCF
Sbjct: 317 RFELPQAFFMRVACGIALREVDREAKAIEFYDLLSSFDFMASTPTLFNAGTLRPQLSSCF 376

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GIF ++++NA+L+KY+GGLGNDWT VRGLGAHI GTNG+SQG++PFLKVAN
Sbjct: 377 LTTVPDDLDGIFKSIKDNALLSKYAGGLGNDWTHVRGLGAHIKGTNGESQGIVPFLKVAN 436

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTA+AVNQGGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRRRTHDMNTANW+PDLFM+R
Sbjct: 437 DTAIAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLFMQR 496

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V QN  WTLFSPDE  DLHDL G+ F   Y  YE +A RGE++V ++I AV LWR+MLTM
Sbjct: 497 VEQNGPWTLFSPDETPDLHDLTGRAFAERYAFYEARAARGELRVTKQIRAVDLWRRMLTM 556

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S  E AVCNLGS+NL+ H  
Sbjct: 557 LFETGHPWITFKDPCNLRSPQQHCGVVHSSNLCTEITLNTSEREVAVCNLGSVNLVNHVV 616

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           + + D  +L  T+ TA+R+LDNVID+N +TI +A+ SN  HR +GLGLMGFQ AL++L +
Sbjct: 617 DGRLDCARLERTVTTAMRMLDNVIDVNFYTIPEARASNLRHRPVGLGLMGFQDALNILRL 676

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PYAS EAV  ADESME I++ +ISASV+LA ERG Y+S+ GSLW QG+ P+DSI LL E 
Sbjct: 677 PYASDEAVAFADESMEAIAYWSISASVDLAAERGRYASYDGSLWSQGILPLDSIDLLDEA 736

Query: 733 RD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYV 791
           R   + ++R SRL W+ L+KRV   GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYV
Sbjct: 737 RGAAIEVDRGSRLDWEALRKRVTATGMRNSNVMAIAPTATISNICGVSQSIEPAYQNLYV 796

Query: 792 KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEI 851
           KSNMSGDFTVVN+ LV +LK R LWDE MISDLKY DGS+G I+R+PDDLK ++ATAFEI
Sbjct: 797 KSNMSGDFTVVNTHLVRDLKGRGLWDEVMISDLKYFDGSLGQIDRVPDDLKALYATAFEI 856

Query: 852 DPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSV 911
           D  WLIE+A+RRQKWIDQAQSLNLYL  PSGK LD +YR AW  GLKTTYYLRSRSAT V
Sbjct: 857 DATWLIEAAARRQKWIDQAQSLNLYLANPSGKTLDALYRLAWRRGLKTTYYLRSRSATHV 916

Query: 912 EKSTLKGVDGKLNAVPV--------------TDPNSSTHSLGIPSSC-TSDTECEVCQ 954
           EKSTL+G DGKLNAV                   N    + G   +C   D  CE CQ
Sbjct: 917 EKSTLRGTDGKLNAVSAIILPTASAEPSRSNGAGNGHAATEGWGKACAIDDPGCEACQ 974


>gi|289208616|ref|YP_003460682.1| ribonucleoside-diphosphate reductase, subunit alpha
           [Thioalkalivibrio sp. K90mix]
 gi|288944247|gb|ADC71946.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Thioalkalivibrio sp. K90mix]
          Length = 964

 Score = 1002 bits (2591), Expect = 0.0,   Method: Composition-based stats.
 Identities = 567/964 (58%), Positives = 716/964 (74%), Gaps = 10/964 (1%)

Query: 1   MHPSKDVNKGDEDAF-PSLAYPFPEKIK----GVQVIKRNGGVTSFDPSKISRAIMKAFM 55
           M+      +  E    P  A P  E +       QVI+RNG VT FD SKI  A+ KAF+
Sbjct: 1   MYSDTQTAEAQEGIQYPPQAEPSAEVLATSPGQHQVIRRNGKVTGFDASKIEVAVTKAFL 60

Query: 56  AVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSAL-IVHIEDIQDQVECSLMQSGHHKI 114
           AVEG  A+ S R+ ++ K +  Q V  L +   +    VHIEDIQDQVE +LM+ GHHK+
Sbjct: 61  AVEGGNAAASRRIHEVSKEVAGQVVDSLFRRAGTQGMTVHIEDIQDQVELALMRGGHHKV 120

Query: 115 TREYVLYREERSDVRAAQ--SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSG 172
            R YV+YRE+++  RAA+    S  +   A  L +   DGT    +  RL+ +V EAC G
Sbjct: 121 ARAYVIYREQQAQKRAAEAAEQSPEEQEAAAALNVTRADGTQAPLDEARLQAVVAEACDG 180

Query: 173 LQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREV 232
           ++ V  + +L+E  +N++DG++E D+ TAL+ ++R +IEKEPNY++VTAR L++ LRRE 
Sbjct: 181 IEHVDGEKILTEARRNLFDGVAEKDVATALVMAARVMIEKEPNYSEVTARLLMDALRREA 240

Query: 233 LTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFA 292
           L+ V+ +P++AT  ++   Y EYF  YI       L+   +  +DL  L   +K ERD  
Sbjct: 241 LSFVHGRPEEATQAQLAERYAEYFGAYIRRAADLELVDSELTRYDLDKLGAAIKPERDLQ 300

Query: 293 FEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFM 352
           F YLGLQ LYDRYF+H +G+R E+PQAFFMRVAMGLA+ E ++E RA+EFYNLLSSF FM
Sbjct: 301 FTYLGLQTLYDRYFIHSDGTRFELPQAFFMRVAMGLAINEIDREARAIEFYNLLSSFDFM 360

Query: 353 CSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGA 412
            STPTLFNSGT  PQLSSC+LT+VPDDL GI+ A+++NA+L+K++GGLGNDWT VRG+GA
Sbjct: 361 SSTPTLFNSGTLRPQLSSCYLTSVPDDLDGIYSAIRDNALLSKFAGGLGNDWTRVRGMGA 420

Query: 413 HIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDD 472
           HI GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEF++LRKNTGDD
Sbjct: 421 HIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFIELRKNTGDD 480

Query: 473 RRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRG 532
           RRRTHDMN+ANWIPDLFMKRV ++  WTLFSP+E  DLHDL G +FE  Y  YE +A RG
Sbjct: 481 RRRTHDMNSANWIPDLFMKRVAEDGDWTLFSPNETPDLHDLVGTDFEKRYCEYEEKAARG 540

Query: 533 EIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNS 592
           E++V + + AV LWRKML MLFETGHPW+TFKDPCN+RSPQQH GVVHSSNLCTEITLN+
Sbjct: 541 ELRVHKTMKAVDLWRKMLGMLFETGHPWMTFKDPCNLRSPQQHTGVVHSSNLCTEITLNT 600

Query: 593 SSEETAVCNLGSINLLAH-FANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNH 651
           S +E AVCNLGSINL AH     + D DKL  T+ TA+R+LDNVID N +++ +A++SN 
Sbjct: 601 SDDEIAVCNLGSINLAAHINEAGELDQDKLEQTVNTAMRMLDNVIDYNYYSVPQARRSNL 660

Query: 652 THRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSF 711
            HR +GLG+MGFQ AL+ L +PYAS  AVE AD SME +S++AI AS +LA+ERG Y SF
Sbjct: 661 RHRPVGLGIMGFQDALYKLRMPYASEAAVEFADTSMEAVSYYAIKASTDLAEERGRYESF 720

Query: 712 KGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTA 770
            GSLW QG+ PIDS+  LAE R   L M+ T RL WD+L+KRVK +GMRNSN MAIAPTA
Sbjct: 721 PGSLWSQGILPIDSVEKLAETRGDYLQMDTTQRLEWDKLRKRVKKVGMRNSNTMAIAPTA 780

Query: 771 TIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGS 830
           TI+NICGVSQSI+P+YQNL+VKSN+SG+FTV+N +LV +LK R+LWDE M++DLKY+DGS
Sbjct: 781 TISNICGVSQSIEPTYQNLFVKSNLSGEFTVINPYLVRDLKDRELWDEVMVNDLKYYDGS 840

Query: 831 IGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYR 890
           +  ++R+PDDLK ++ATAFE+D  WL+E+ASRRQKWIDQAQSLNLY+ EPSG KLD +Y+
Sbjct: 841 VQPLDRVPDDLKALYATAFELDTRWLVEAASRRQKWIDQAQSLNLYMAEPSGPKLDALYK 900

Query: 891 QAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTEC 950
            AW+ GLKTTYYLRS  AT VEKST+           V+    ++      +    D +C
Sbjct: 901 LAWVRGLKTTYYLRSMGATHVEKSTVADSSRANKLNAVSGGQQASEPEAPKACSILDPDC 960

Query: 951 EVCQ 954
           E CQ
Sbjct: 961 EACQ 964


>gi|312962585|ref|ZP_07777075.1| ribonucleoside-diphosphate reductase [Pseudomonas fluorescens WH6]
 gi|311283165|gb|EFQ61756.1| ribonucleoside-diphosphate reductase [Pseudomonas fluorescens WH6]
          Length = 963

 Score = 1002 bits (2589), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/960 (57%), Positives = 698/960 (72%), Gaps = 17/960 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +       D+   L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QGSVPQAADSNMDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ 
Sbjct: 68  SSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDS 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  RA  + +       P ++I + DG+    +  RL  I+ EAC GL++V   ++  E
Sbjct: 128 RAKERAVHAPAAEAVQAHPSIRITLADGSFAPLDLGRLNTIITEACEGLEEVDGDLIQRE 187

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++ +D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         AT
Sbjct: 188 TLKNLYDGVALTDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSAT 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    YI +G++  LL+  +  FDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 247 HHEMADLYAKALPAYIAKGIEFELLNPVLATFDLEKLGKAINHERDQQFTYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLA++E  KE RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 307 YFIHKDGIRFELPQVFFMRVAMGLAIEEKHKEDRAIEFYNLLSSFDYMSSTPTLFNAGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 367 RPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQA-DRGEIKVFRKISAV 543
           IPDLFMKRV  +  WTLFSP EV DLHDL GK FE  YE YE  A   G+IK+F+ I A 
Sbjct: 487 IPDLFMKRVFDDGQWTLFSPSEVPDLHDLTGKAFEERYEYYEALAQYPGKIKLFKTIQAK 546

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLG 603
            LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLG
Sbjct: 547 DLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLG 606

Query: 604 SINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGF 663
           SINL  H  N + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGF
Sbjct: 607 SINLPNHIVNGKLDTAKLERTVNTAVRMLDNVIDINYYSVPQAQNSNFKHRPVGLGIMGF 666

Query: 664 QSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPI 723
           Q AL+L HIPY S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+
Sbjct: 667 QDALYLQHIPYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPL 726

Query: 724 DSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
           DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQS
Sbjct: 727 DSQQILIEQRGQKYIDVDLNETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQS 785

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +L
Sbjct: 786 IEPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQEL 845

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           K+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTY
Sbjct: 846 KELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTY 905

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSST-------HSLGIPSSCTSDTECEVCQ 954
           YLR+ +ATS EKST+    GKLNAV   +    +        +    +    + +CE CQ
Sbjct: 906 YLRALAATSTEKSTIN--TGKLNAVSSGNHGDDSVLAAPAGPAPVPKACAIDEPDCEACQ 963


>gi|224825452|ref|ZP_03698557.1| ribonucleoside-diphosphate reductase, alpha subunit [Lutiella
           nitroferrum 2002]
 gi|224602373|gb|EEG08551.1| ribonucleoside-diphosphate reductase, alpha subunit [Lutiella
           nitroferrum 2002]
          Length = 949

 Score = 1002 bits (2589), Expect = 0.0,   Method: Composition-based stats.
 Identities = 555/953 (58%), Positives = 690/953 (72%), Gaps = 17/953 (1%)

Query: 9   KGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRV 68
           +G   A    A          + I+RNG V  F+P KIS A+ KAF+A+ G   + S  +
Sbjct: 7   EGQTAAELGRAAAPQADFSQYKTIRRNGAVVPFEPVKISIAMTKAFLAIMGHQGATSASI 66

Query: 69  QDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDV 128
           +D +  LTE  V+ L++       +HIEDIQDQVE SLM++G H + R YVLYREERS  
Sbjct: 67  RDKVAQLTEMVVSALMRRKPEGGAIHIEDIQDQVELSLMRAGEHDVARAYVLYREERSRE 126

Query: 129 RAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKN 188
           RAA+  + +       + ++  +G  +  +  +L   +E AC GL +     +L+ET KN
Sbjct: 127 RAARGEALTQI----TINVVRKNGAKLPLDIAKLRATIESACVGLAETDVDAILTETLKN 182

Query: 189 MYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEM 248
           +YDG+SE ++  + I ++R +IE++P Y  VTAR LL  +R E+L       +  +  EM
Sbjct: 183 IYDGVSEEEVNKSAILAARAMIEQDPAYDYVTARLLLNNIRLEILG------EAVSQEEM 236

Query: 249 QCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLH 308
              Y  YF + I++G+ A LL E + ++DL  L   L   RD  F YLGLQ LYDRYFLH
Sbjct: 237 GECYVSYFPQAIKKGIAAELLDERLGEYDLKKLGAALDASRDLQFGYLGLQTLYDRYFLH 296

Query: 309 INGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQL 368
           +NG+RIEMPQAF+MRVAMGLAL E E+E RA+EFYN+LSSF FM STPTLFNSGTR  QL
Sbjct: 297 VNGTRIEMPQAFYMRVAMGLALNEVEREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQL 356

Query: 369 SSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFL 428
           SSC+LTT+ DDL GI+  ++ENA+L+K++GGLGNDWTPVR +G+HI GTNGKSQGV+PFL
Sbjct: 357 SSCYLTTIADDLDGIYEGIKENALLSKFAGGLGNDWTPVRAMGSHIKGTNGKSQGVVPFL 416

Query: 429 KVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDL 488
           KV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDL
Sbjct: 417 KVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFVELRKNTGDDRRRTHDMNTANWIPDL 476

Query: 489 FMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRK 548
           FMKRV   A WTL SP E  DLHDL G  FE  Y+ YE  A RGEIKV ++I A++LWRK
Sbjct: 477 FMKRVMDGAEWTLLSPSECPDLHDLVGAAFEKRYQEYEAMAARGEIKVSKRIPALSLWRK 536

Query: 549 MLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLL 608
           MLTMLFETGHPWITFKDPCNIRSPQ H+GVVHSSNLCTEITLN++ +E AVCNLGS+NL 
Sbjct: 537 MLTMLFETGHPWITFKDPCNIRSPQGHMGVVHSSNLCTEITLNTNDDEIAVCNLGSVNLA 596

Query: 609 AHFANNQF-DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSAL 667
            H   +   D  KL  TIR A+R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ  L
Sbjct: 597 RHMQADGTLDGAKLQRTIRIAMRMLDNVIDINFYPVKKARNSNLKHRPVGMGIMGFQDCL 656

Query: 668 HLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIG 727
           H+  IPYAS EAVE ADESME +++HA  AS ELAQERG Y S+KGSLWD+GV P DSI 
Sbjct: 657 HMKRIPYASQEAVEFADESMELVAYHAYWASSELAQERGRYPSYKGSLWDRGVLPHDSIN 716

Query: 728 LLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSY 786
           LLA  R   L ++RT RL W++L++R+K  GMRNSNC+AIAPTATIANI GVS SI+P+Y
Sbjct: 717 LLAAERGGYLDVDRTERLDWNKLRERIKEHGMRNSNCLAIAPTATIANIIGVSASIEPTY 776

Query: 787 QNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHA 846
           QNL+VKSN+SG+FTV N  LV +LK+  LWDE M+SDLKY DGS+G I+RIP +LK I+A
Sbjct: 777 QNLFVKSNLSGEFTVTNEHLVRDLKKLGLWDEVMVSDLKYFDGSLGRIDRIPAELKAIYA 836

Query: 847 TAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSR 906
           TAFE+DP WL+++ASRRQKWIDQAQSLNLY+   SGKKLD +Y+ AW+ GLKTTYYLR+ 
Sbjct: 837 TAFEMDPKWLVDAASRRQKWIDQAQSLNLYMAGASGKKLDELYKYAWVRGLKTTYYLRTL 896

Query: 907 SATSVEKST-----LKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           +ATS EKST     L  V     AV       +T +         + +CE CQ
Sbjct: 897 AATSAEKSTGRGGELNAVSATTPAVSAAPEVDNTPATDAKFCSIDNPDCEACQ 949


>gi|90425008|ref|YP_533378.1| ribonucleotide-diphosphate reductase subunit alpha
           [Rhodopseudomonas palustris BisB18]
 gi|90107022|gb|ABD89059.1| Ribonucleoside-diphosphate reductase [Rhodopseudomonas palustris
           BisB18]
          Length = 960

 Score = 1000 bits (2586), Expect = 0.0,   Method: Composition-based stats.
 Identities = 593/947 (62%), Positives = 732/947 (77%), Gaps = 9/947 (0%)

Query: 16  PSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNL 75
           PS+         G ++I+RNG VT FDP+KI+ A+ KAF+AVEG  A+ S R+ D++  L
Sbjct: 15  PSVVEHVTAANPGYRLIRRNGTVTRFDPTKITLALTKAFLAVEGSSAASSRRIHDVVGGL 74

Query: 76  TEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS 135
           T+Q V+ L +         IED+QDQVE +LM+  +HK+ R YVLYRE+R+  R   + +
Sbjct: 75  TQQIVSSLTRRADLGHTFLIEDVQDQVELALMRGEYHKVARAYVLYREDRAKQRIESAQN 134

Query: 136 KSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSE 195
               P +P L++   DG ++  ++ RL  +VEEAC+GL DV +  VLSET +N+YDG+S 
Sbjct: 135 AQLEPASP-LRVTATDGIVVPLDAVRLAAVVEEACAGLDDVRASQVLSETRRNLYDGISL 193

Query: 196 SDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEY 255
            +L  A I ++RTLIE EPNYAKV+AR LL+KLRRE L+ V  +P++ATH EM   Y +Y
Sbjct: 194 DELALAPILAARTLIETEPNYAKVSARLLLDKLRREALSFVAGRPEQATHAEMAGRYGDY 253

Query: 256 FCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIE 315
           F  YI  G+ + LL   +  FDLV L+  LK ERD  F+YLGLQ LYDRYFLH++G+R E
Sbjct: 254 FKAYIATGIASELLDRELGRFDLVRLSAALKPERDLQFDYLGLQTLYDRYFLHVDGTRFE 313

Query: 316 MPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTT 375
           +PQAFFMRVA GLAL+E ++E +A+EFY LLSSF FM STPTLFN+GT  PQLSSCFLTT
Sbjct: 314 LPQAFFMRVACGLALREIDREDKAIEFYELLSSFDFMASTPTLFNAGTLRPQLSSCFLTT 373

Query: 376 VPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTA 435
           VPDDL GIF ++++NA+L+KY+GGLGNDWT VRGLGAHI GTNG+SQGV+PFLKVANDTA
Sbjct: 374 VPDDLDGIFKSIKDNALLSKYAGGLGNDWTRVRGLGAHIKGTNGESQGVVPFLKVANDTA 433

Query: 436 VAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ 495
           +AVNQGGKRKGAVCAYLETWHID+E+FLDLRKNTGDDRRRTHDMNTANW+PDLFM RV Q
Sbjct: 434 IAVNQGGKRKGAVCAYLETWHIDIEQFLDLRKNTGDDRRRTHDMNTANWVPDLFMTRVEQ 493

Query: 496 NAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFE 555
           + GWTLFSPDE  DLHDL G+ F   YE YE +A+RGE++VF+++ A  LWRKMLTMLFE
Sbjct: 494 DGGWTLFSPDETPDLHDLTGQAFVERYEQYEAKAERGEMRVFKRLRAADLWRKMLTMLFE 553

Query: 556 TGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ 615
           TGHPWITFKDPCN+RSPQ H GVVHSSNLCTEITLN+S+ E AVCNLGSINL+ H  N  
Sbjct: 554 TGHPWITFKDPCNLRSPQSHAGVVHSSNLCTEITLNTSTTEVAVCNLGSINLVNHLVNGA 613

Query: 616 FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA 675
            D+ +LA ++ T +R+LDNV+D+N +TI +A+ SN  HR +GLG+MGFQ AL++L +PYA
Sbjct: 614 IDHARLARSVGTGMRMLDNVLDVNFYTIPEARSSNLKHRPVGLGIMGFQDALNILRLPYA 673

Query: 676 SPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD- 734
           S +AV  ADESME +S+ AISASV+LA ERG Y SF+GSLW +GV P+DSI  +   R  
Sbjct: 674 SEQAVAFADESMESVSYWAISASVDLAAERGRYPSFEGSLWSKGVLPLDSIARVDAARAL 733

Query: 735 ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
            + ++R+ RL WD L+ RVK +GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYVKSN
Sbjct: 734 PVEVDRSFRLDWDGLRARVKAVGMRNSNTMAIAPTATISNICGVSQSIEPAYQNLYVKSN 793

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           MSGDFTVVN++LVN+LK R LWDE M+SDLKY DGS+G I+R+PDDLK ++ATAFEID  
Sbjct: 794 MSGDFTVVNTYLVNDLKARGLWDEVMVSDLKYFDGSVGQIDRVPDDLKALYATAFEIDSA 853

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           WLIE+A+RRQKWIDQ+QSLNLYL  P+GKKLD +YR AW  GLKTTYYLRSRSAT VEKS
Sbjct: 854 WLIEAAARRQKWIDQSQSLNLYLANPNGKKLDALYRLAWRRGLKTTYYLRSRSATHVEKS 913

Query: 915 TLKGVDGKLNAVPVTDPNSST-------HSLGIPSSCTSDTECEVCQ 954
           TLKG DGKLNAV       +         ++   +    D  CEVCQ
Sbjct: 914 TLKGTDGKLNAVSAGLAMDTPRAVAVACGAVAGQACAIDDPTCEVCQ 960


>gi|261855610|ref|YP_003262893.1| ribonucleotide-diphosphate reductase subunit alpha
           [Halothiobacillus neapolitanus c2]
 gi|261836079|gb|ACX95846.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Halothiobacillus neapolitanus c2]
          Length = 957

 Score = 1000 bits (2586), Expect = 0.0,   Method: Composition-based stats.
 Identities = 556/952 (58%), Positives = 699/952 (73%), Gaps = 9/952 (0%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
                    A  S           ++VI+RNG VT+FD SKI  A+ KAF+AVEG GA+ 
Sbjct: 13  PTTAHSAPSAAHSTIDTAATTPGQLRVIRRNGKVTAFDDSKIKVAMTKAFLAVEGSGAAV 72

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S+RV D++  L++Q  + L +       VHIEDIQDQVE +LM+ GHHK+ R YVLYRE 
Sbjct: 73  SMRVHDLVNALSDQISSALKRRAPGGGTVHIEDIQDQVELALMREGHHKVARAYVLYREH 132

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           ++  RAA++  ++   I   L +   DGT    +  RL  ++ EACS L DV    VL E
Sbjct: 133 QAQKRAAEAPDQATPEI--VLNVTHADGTRSPLDHVRLNALIGEACSNLTDVDPNAVLQE 190

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T +N++DG+ E ++ TAL+ S+RTLIEK+PNY+ V AR LL+ +R E L    +     T
Sbjct: 191 TLRNLFDGVPEKEVNTALVMSARTLIEKDPNYSFVAARLLLDGIRSEALRFTKQPVTVCT 250

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
             E+  L+ +YF  YI  G++  LL  ++  +D+  L + +   RD  F YLGLQ LYDR
Sbjct: 251 QSELSGLFADYFQSYINTGIEHELLDPTLRQYDIKRLTDAIDTSRDLQFSYLGLQTLYDR 310

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YFLH  G R E+PQAFFMRVAMGLA+ E ++E  A+EFY LLSSF FM STPTLFNSGT 
Sbjct: 311 YFLHEGGVRFELPQAFFMRVAMGLAINEIDRETHAIEFYKLLSSFDFMSSTPTLFNSGTL 370

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GIF A+++NA+L+K++GGLGNDW+ VR L +HI GTNGKSQGV
Sbjct: 371 RPQLSSCYLTTVPDDLDGIFAAIKDNALLSKFAGGLGNDWSRVRALSSHIKGTNGKSQGV 430

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKVANDTAVAVNQGGKRKGAVCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANW
Sbjct: 431 VPFLKVANDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLDLRKNTGDDRRRTHDMNTANW 490

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           +PDLFMKRV +   WTLFSP +  DLHDL G  FE AY  YE + DRGE+K FR+I A  
Sbjct: 491 VPDLFMKRVMEEGEWTLFSPADCPDLHDLTGLAFEKAYTAYEARVDRGEMKNFRRIKATN 550

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML+MLFETGHPWITFKDPCN+R   QH GVVHSSNLCTEITL+++ +E AVCNLGS
Sbjct: 551 LWRKMLSMLFETGHPWITFKDPCNLRYTNQHAGVVHSSNLCTEITLHTNDQEIAVCNLGS 610

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
           +NL  H   N  D +KLA TI+TA+R+LDNVI+ N +++ +A+ SN  HR +GLG+MGFQ
Sbjct: 611 VNLAQHVTENGLDQEKLARTIKTAMRMLDNVIEYNYYSVPQARNSNLRHRPVGLGIMGFQ 670

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            ALH+  IPY+S +A+E AD SME +S++AISAS +LA ERG Y SF+GSLW +G+ PID
Sbjct: 671 DALHIQKIPYSSEQAIEFADRSMETVSYYAISASSDLAAERGRYQSFEGSLWSRGILPID 730

Query: 725 SIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSID 783
           SI LLAE R   L MNR + L W+ ++ ++K  GMRNSN MAIAPTATI+NICGV+QSI+
Sbjct: 731 SIDLLAEARGKYLVMNRDTTLDWEAVRAKIKVQGMRNSNTMAIAPTATISNICGVAQSIE 790

Query: 784 PSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKK 843
           P+++NL+VKSN+SG+FTV+N +LV +LK  DLWDE M++DLKY DGS+  I+RIPD LK 
Sbjct: 791 PTFENLFVKSNLSGEFTVINPYLVRDLKALDLWDEVMVNDLKYFDGSVQQIDRIPDSLKA 850

Query: 844 IHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYL 903
           ++ATAFE++P WLIE+ SRRQKWIDQAQSLNLYL +PSG KLD +Y+ AWL+GLKTTYYL
Sbjct: 851 LYATAFEVEPRWLIEAGSRRQKWIDQAQSLNLYLADPSGPKLDQMYKNAWLVGLKTTYYL 910

Query: 904 RSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSC-TSDTECEVCQ 954
           R+ S T VEK+T+  +DGKL  V          +  +P +C   D  CE CQ
Sbjct: 911 RASSKTRVEKTTMTKLDGKLRGVSAD-----PIAEALPKACAIDDPGCEACQ 957


>gi|88705572|ref|ZP_01103282.1| ribonucleoside-diphosphate reductase, alpha subunit [Congregibacter
           litoralis KT71]
 gi|88700085|gb|EAQ97194.1| ribonucleoside-diphosphate reductase, alpha subunit [Congregibacter
           litoralis KT71]
          Length = 969

 Score = 1000 bits (2584), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/945 (58%), Positives = 695/945 (73%), Gaps = 11/945 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
            +   ++   P +   ++VIKRNG V  F+ SKIS AI KAF+AVEG  A+ S R+ + +
Sbjct: 33  ASAAEVSATAPGQ---LRVIKRNGTVVPFEASKISVAITKAFLAVEGGTAAASSRIHETV 89

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LTE       +   S   +HIED+QDQVE SLM++G HKI R+YV+YRE+++  RAA+
Sbjct: 90  AKLTEMVTATFKRRMPSGGTIHIEDVQDQVELSLMRAGEHKIARDYVIYREQQASKRAAR 149

Query: 133 SH-SKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYD 191
              S      A ++ ++  DG+    + +RL +IV EAC+GL DVS   +L E  +N+YD
Sbjct: 150 QSLSAETQEAADRINVVQLDGSKAPLDLERLHIIVSEACAGLDDVSETRILDEALRNLYD 209

Query: 192 GLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCL 251
           G+S  +L T+L+ ++RTLIE+EPNY   +AR L + LR E L +       AT  +M  L
Sbjct: 210 GVSMQELSTSLVITARTLIEQEPNYTYASARLLCDNLRTEAL-SFLGVADSATQGDMDRL 268

Query: 252 YPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHING 311
           Y +    YI  GV+  LL  ++ ++DL  +   +  ERD  F YLGLQ LYDRYF+H + 
Sbjct: 269 YAKALPAYIARGVELELLDPTLAEYDLERMGKAILPERDLQFTYLGLQTLYDRYFIHSDE 328

Query: 312 SRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSC 371
            R E+PQ FFMRVAMGLA++ET++E RA+EFY LLSSF +M STPTLFN+GT  PQLSSC
Sbjct: 329 VRFELPQIFFMRVAMGLAVEETDREARAIEFYRLLSSFDYMSSTPTLFNAGTLRPQLSSC 388

Query: 372 FLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVA 431
           +LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV 
Sbjct: 389 YLTTVPDDLHGIYGAIQDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVV 448

Query: 432 NDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMK 491
           NDTAVAVNQGGKRKGAVC+YLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMK
Sbjct: 449 NDTAVAVNQGGKRKGAVCSYLETWHMDIEEFVELRKNTGDDRRRTHDMNTANWIPDLFMK 508

Query: 492 RVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLT 551
           RV  +  WTLFSP++V DLHDLYGK FE  Y  YE  A  GE+K  + + A  LWRKML 
Sbjct: 509 RVFDDGDWTLFSPNDVPDLHDLYGKAFEERYCAYEAMAATGELKYSKTVKAQNLWRKMLG 568

Query: 552 MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF 611
           MLFETGHPW+TFKDPCN+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGSINL  H 
Sbjct: 569 MLFETGHPWMTFKDPCNLRSPQQHAGVVHSSNLCTEITLNTSADEIAVCNLGSINLPQHV 628

Query: 612 ANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLH 671
             N  + +KLA T+RTAVR+LDNVIDIN ++++ A+ SN  HR +GLGLMGFQ AL+  H
Sbjct: 629 DENGLNLEKLAETVRTAVRMLDNVIDINYYSVDTARNSNFRHRPVGLGLMGFQDALYKQH 688

Query: 672 IPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAE 731
           I Y S +AV  AD SME IS++AI AS +LA+ERGAY S++GSLW QG+ PIDS+G L E
Sbjct: 689 IAYGSEDAVTFADRSMEAISYYAIDASSKLAEERGAYESYEGSLWSQGILPIDSLGKLVE 748

Query: 732 VRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNL 789
            R    + ++ +  + W  L++ VK  GMRNSN MAIAPTATIANI GVSQSI+P+YQNL
Sbjct: 749 ERGSDYIKVDDSMTMDWTSLREAVKARGMRNSNVMAIAPTATIANITGVSQSIEPTYQNL 808

Query: 790 YVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAF 849
           YVKSN+SG+FTVVN +LVN+LK R LWD  M++DLKY+DGS+  IERIP DL+ I++ AF
Sbjct: 809 YVKSNLSGEFTVVNPYLVNDLKVRGLWDSVMVNDLKYYDGSVQAIERIPADLRAIYSNAF 868

Query: 850 EIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSAT 909
           E++P W++E ASRRQKWIDQAQSLNLY++  SGKKLD  YR AW  GLKTTYYLRS +AT
Sbjct: 869 EVEPRWIVECASRRQKWIDQAQSLNLYINNASGKKLDITYRMAWYSGLKTTYYLRSLAAT 928

Query: 910 SVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             EKST+    G+LNAV      +             D +CE CQ
Sbjct: 929 GTEKSTID--TGQLNAVSSESAPAPAPVPMA--CSLDDPDCEACQ 969


>gi|330504345|ref|YP_004381214.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           mendocina NK-01]
 gi|328918631|gb|AEB59462.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           mendocina NK-01]
          Length = 968

 Score =  999 bits (2582), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/966 (57%), Positives = 707/966 (73%), Gaps = 24/966 (2%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           + V     ++   LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QAVTPQAAESSQDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YRE 
Sbjct: 68  SSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYREA 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           ++  R A + S+   P  P ++I    G +   +  RL+ I+ EAC GL +V   ++  E
Sbjct: 128 QASKRKASAGSEIAQP-HPSIRITNAAGEVQPLDMGRLQTIIREACEGLAEVDGSLIERE 186

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++E D+ TAL+ ++RTL+E+EPNY+ VTAR L++ +R E L+ +      AT
Sbjct: 187 TLKNLYDGVAEKDVNTALVMTARTLVEREPNYSYVTARLLMDNIRAEALSFLSIAAS-AT 245

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    Y+E+GV+  LL   +  FDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 246 HHEMADLYAKALPAYVEKGVEFELLDAKLKTFDLEKLGAAINHERDQQFTYLGLQTLYDR 305

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           YF+H +G R E+PQ FFMRVAMGLA++E   +E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 306 YFIHKDGIRFELPQVFFMRVAMGLAIEEPKNREDRAIEFYNLLSSFDYMASTPTLFNAGT 365

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+GA+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 366 LRPQLSSCYLTTVPDDLSGIYGAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 425

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTAN
Sbjct: 426 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNTAN 485

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAV 543
           WIPDLFMKRV ++  WTLFSP EV DLHDL GK FE  YE YE   + G+IK+++ I A 
Sbjct: 486 WIPDLFMKRVFEDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALIEYGKIKLYKTIQAK 545

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLG 603
            LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLG
Sbjct: 546 DLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLG 605

Query: 604 SINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGF 663
           S+NL+ H  + + D +KL  T++TAVR+LDNVIDIN +++++A+ SN  HR +GLGLMGF
Sbjct: 606 SVNLVNHIVDGKLDIEKLGRTVKTAVRMLDNVIDINYYSVDQARNSNLKHRPVGLGLMGF 665

Query: 664 QSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPI 723
           Q AL+L HI Y S  A+E AD+SME IS++AI AS +LA ERG+YS+F+GSLW +G+ P+
Sbjct: 666 QDALYLQHIAYGSDAAIEFADKSMEAISYYAIQASCDLADERGSYSTFEGSLWSKGILPL 725

Query: 724 DSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
           DS  LL E R    + ++ +  L W  +++RVK  G+RNSN MAIAPTATI+NI GVSQS
Sbjct: 726 DSQQLLIEARGQKYIDVDLSESLDWAPIRERVKK-GIRNSNIMAIAPTATISNIIGVSQS 784

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  M++DLKY+DGS+  IERIP DL
Sbjct: 785 IEPTYQNLYVKSNLSGEFTVINPYLVRDLKNRGLWDPVMVNDLKYYDGSVQQIERIPQDL 844

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           K ++ATAFE++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTY
Sbjct: 845 KDLYATAFEVETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTY 904

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVTDPN-------------SSTHSLGIPSSCTSDT 948
           YLR+ +ATS EKST+    GKLNAV                   +   +    +    + 
Sbjct: 905 YLRALAATSTEKSTIN--TGKLNAVSAGGDEGFSAKAQAPAQQAAPAPAPVPKACAIDEP 962

Query: 949 ECEVCQ 954
           +CE CQ
Sbjct: 963 DCEACQ 968


>gi|229592128|ref|YP_002874247.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           fluorescens SBW25]
 gi|229363994|emb|CAY51541.1| ribonucleoside-diphosphate reductase alpha chain [Pseudomonas
           fluorescens SBW25]
          Length = 964

 Score =  998 bits (2581), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/961 (57%), Positives = 700/961 (72%), Gaps = 18/961 (1%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +       D+   L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 11  QGSVPQAADSNLDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ 
Sbjct: 68  SSRIHDTVARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDS 127

Query: 125 RSDVRAAQSHSKSDA-PIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLS 183
           R+  RA ++ ++  A    P ++I + DGT    +  RL  I+ EAC GL++V   ++  
Sbjct: 128 RAKERAVRTPAEEAAVQAHPSIRITLADGTFAPLDLGRLNTIITEACEGLEEVDGDLIQR 187

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
           ET KN+YDG++ +D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         A
Sbjct: 188 ETLKNLYDGVALTDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSA 246

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           THHEM  LY +    YI +G++  LL+  +  FDL  L   + +ERD  F YLGLQ LYD
Sbjct: 247 THHEMADLYAKALPAYIAKGIEFELLNPILATFDLEKLGKAINHERDQQFTYLGLQTLYD 306

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H +G R E+PQ FFMRVAMGLA++E  KE RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 307 RYFIHKDGIRFELPQVFFMRVAMGLAIEEKHKEDRAIEFYNLLSSFDYMSSTPTLFNAGT 366

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 367 LRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 426

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 427 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTAN 486

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISA 542
           WIPDLFMKRV  +  WTLFSP EV DLHDL GK FE  YE YE      G+IK+F+ I A
Sbjct: 487 WIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFEERYEYYEALSQYPGKIKLFKTIQA 546

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNL
Sbjct: 547 KDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNL 606

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GSINL  H  N + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MG
Sbjct: 607 GSINLPNHIVNGKLDTAKLERTVNTAVRMLDNVIDINYYSVPQAQNSNFKHRPVGLGIMG 666

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+L HIPY S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW +G+ P
Sbjct: 667 FQDALYLQHIPYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILP 726

Query: 723 IDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           +DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQ
Sbjct: 727 LDSQQILIEQRGQKYIDVDLNESLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQ 785

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNLYVKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +
Sbjct: 786 SIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQE 845

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTT
Sbjct: 846 LKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTT 905

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSST-------HSLGIPSSCTSDTECEVC 953
           YYLR+ +ATS EKST+    GKLNAV   +    +        +    +    + +CE C
Sbjct: 906 YYLRALAATSTEKSTIN--TGKLNAVSSGNHGDDSVLAAPAGPAPVPKACAIDEPDCEAC 963

Query: 954 Q 954
           Q
Sbjct: 964 Q 964


>gi|192361574|ref|YP_001982049.1| ribonucleotide-diphosphate reductase subunit alpha [Cellvibrio
           japonicus Ueda107]
 gi|190687739|gb|ACE85417.1| ribonucleoside reductase, large chain [Cellvibrio japonicus
           Ueda107]
          Length = 978

 Score =  997 bits (2576), Expect = 0.0,   Method: Composition-based stats.
 Identities = 564/976 (57%), Positives = 718/976 (73%), Gaps = 31/976 (3%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           +   +  D      L+   P +   ++VIKRNG V  FD SKI+ A+ KAF+AVEG  A+
Sbjct: 9   TSTSSHADLSNNNGLSATAPGQ---LRVIKRNGTVVPFDASKIAIAMTKAFLAVEGGTAA 65

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S RV++ + NLT+Q      +   S   +HIE+IQDQVE  LM++G  K+ R+YVLYRE
Sbjct: 66  ASTRVRETVDNLTKQITATFKRRMPSGGTIHIEEIQDQVELILMRAGEQKVARDYVLYRE 125

Query: 124 ERSDVRAAQSHSK--SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIV 181
           E + +R AQ         P  P + +   DGT    +  R+  IV EAC+GL  V  K +
Sbjct: 126 EHARLRRAQKEVNKTEADPDYPAMSVTQADGTRAPLDIARMRTIVSEACAGLAGVEEKAI 185

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           L E  +N+YDG++E D+ T+L+ ++RTL+EKEPNY   TAR LL+KLR E L  +   P 
Sbjct: 186 LDEAMRNLYDGVAEKDVNTSLVITARTLVEKEPNYTYATARLLLDKLRAEALGFLGVAPS 245

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
            AT  +M+  Y      YI++GV+  L+   +++FDL  L   L  +RD  F YLGLQ L
Sbjct: 246 -ATQSDMELYYARALPVYIQKGVELELISPELLNFDLDKLGKALIADRDLQFTYLGLQTL 304

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYF+H + +RIE+PQ FFMRVAMGLAL+E ++E+RA+EFY LLSSF +M STPTLFNS
Sbjct: 305 YDRYFIHSDSTRIELPQIFFMRVAMGLALQEDKREERAIEFYRLLSSFDYMSSTPTLFNS 364

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT  PQLSSC+LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVRGLGA+I GTNGKS
Sbjct: 365 GTLRPQLSSCYLTTVPDDLHGIYGAIQDNAMLSKFAGGLGNDWTPVRGLGAYIKGTNGKS 424

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKVANDTAVAVNQGGKRKGAVCAYLETWH+DVEEFL+LRKNTGDDRRRTHDMNT
Sbjct: 425 QGVVPFLKVANDTAVAVNQGGKRKGAVCAYLETWHMDVEEFLELRKNTGDDRRRTHDMNT 484

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANW+PDLFMKRV ++  WTLFSP++V DLHDLYGK FE  YE+YE+ A +G++++F+ + 
Sbjct: 485 ANWVPDLFMKRVFEDQEWTLFSPNDVPDLHDLYGKAFEERYEHYEQLAAQGKVRLFKTVR 544

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSS-EETAVC 600
           A+ LWRKML MLFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+ + +E AVC
Sbjct: 545 ALDLWRKMLGMLFETGHPWITFKDPCNLRSPQQHAGVVHSSNLCTEITLNTKAGDEIAVC 604

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGS+NL  H  N + D  KL  T+ TA+R+LDNVIDIN + ++ +K+SN  HR IGLG+
Sbjct: 605 NLGSVNLAQHIVNGKLDLAKLEKTVSTAIRMLDNVIDINYYAVDTSKQSNLRHRPIGLGI 664

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ AL+   I Y+S  AV+ AD SME +S++AI AS +LAQERG YS+F+GSLW +GV
Sbjct: 665 MGFQDALYEQRIAYSSQAAVDFADTSMEAVSYYAIKASCQLAQERGKYSTFEGSLWSKGV 724

Query: 721 FPIDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
            PIDSI +LA+ R    + ++R+    WD L+  VKT GMRNSN MAIAPTATI+NI GV
Sbjct: 725 LPIDSIDILAQNRGENYIKVDRSKTFDWDSLRTEVKTKGMRNSNVMAIAPTATISNITGV 784

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           +QSI+P+YQNLYVKSN+SG+FTVVN +LV++LK R LWD  M++DLKY++GS+  I+RIP
Sbjct: 785 TQSIEPTYQNLYVKSNLSGEFTVVNPYLVHDLKDRGLWDSVMVNDLKYYEGSVQKIDRIP 844

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
           +D+K I+ATAFE++P W++ESASRRQKWIDQAQSLNLY+   +GKKLD  YR AW  GLK
Sbjct: 845 EDMKAIYATAFEVEPKWIVESASRRQKWIDQAQSLNLYIAGANGKKLDITYRMAWYSGLK 904

Query: 899 TTYYLRSRSATSVEKSTLKGVDGKLNAVPVT-------------------DPNSSTHSLG 939
           TTYYLR+ +AT+ EKST+    G LNAV  T                   +  S   +  
Sbjct: 905 TTYYLRALAATTTEKSTIN--TGALNAVSATGNSGLSAAPAAAKPVVADIEEASFAEAAP 962

Query: 940 IPSSCTSD-TECEVCQ 954
           +P +C+ D  +CE CQ
Sbjct: 963 VPKACSIDNPDCEACQ 978


>gi|146282011|ref|YP_001172164.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           stutzeri A1501]
 gi|145570216|gb|ABP79322.1| ribonucleoside reductase, large chain [Pseudomonas stutzeri A1501]
          Length = 961

 Score =  994 bits (2570), Expect = 0.0,   Method: Composition-based stats.
 Identities = 554/968 (57%), Positives = 704/968 (72%), Gaps = 21/968 (2%)

Query: 1   MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK 60
           M              P LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG 
Sbjct: 1   MQNQSTRENPLSADAPDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGG 57

Query: 61  GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL 120
            A+ S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+
Sbjct: 58  NAAASSRIHDTVARLTEQVTATFRRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVI 117

Query: 121 YREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI 180
           YRE ++  R + S S   A   P +++   DG+    +  RL+ I+ EAC GL +V   +
Sbjct: 118 YREAQAVKRKSASGSSDIAQPHPSIRVTRADGSQQPLDMGRLQTIITEACEGLAEVDGAL 177

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +  ET KN+YDG++E D+ TAL+ ++RTL+E+EPNY++VTAR L++ LR E L       
Sbjct: 178 IERETLKNLYDGVAEKDVNTALVMTARTLVEREPNYSQVTARLLMDTLRAEALG-FLGVA 236

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           + ATHHEM  LY +    YIE+GV+  LL   +  +DL  L   L +ERD  F YLGLQ 
Sbjct: 237 ESATHHEMADLYAKALPAYIEKGVEFELLDSKLKSYDLAKLGAALNHERDQQFTYLGLQT 296

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYF+H +  R E+PQ FFMRVAMGLA++E +KE RA+EFYNLLSSF +M STPTLFN
Sbjct: 297 LYDRYFIHKDNVRFELPQIFFMRVAMGLAIEEEQKEARAIEFYNLLSSFDYMASTPTLFN 356

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           +GT  PQLSSC+LTTVPDDL GI+ ++++NA+L+K++GGLGNDWTPVR LGA+I GTNGK
Sbjct: 357 AGTLRPQLSSCYLTTVPDDLGGIYDSIRDNALLSKFAGGLGNDWTPVRALGAYIKGTNGK 416

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 417 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMN 476

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRV  +  WTLFSP +V DLHDL G+ FE  YE YE     G+IK+F+ +
Sbjct: 477 TANWIPDLFMKRVFDDGPWTLFSPSDVPDLHDLTGRAFEERYEYYEELTKYGKIKLFKTL 536

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVC
Sbjct: 537 PAKDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVC 596

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGSINL+ H  + + D  KL  T+RTAVR+LDNVIDIN +++ +A+ +N  HR +GLG+
Sbjct: 597 NLGSINLVNHIVDGKLDAAKLERTVRTAVRMLDNVIDINYYSVPQAQNANFKHRPVGLGI 656

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ AL+L HI Y S  A++ AD+SME IS+ AI AS +LA ERGAYSSF+GSLW +G+
Sbjct: 657 MGFQDALYLQHIAYGSDAAIDFADKSMEAISYFAIQASCDLADERGAYSSFEGSLWSKGI 716

Query: 721 FPIDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
            P+DS  +L E R    + ++ +  L W  +++RVK  G+RNSN MAIAPTATI+NI GV
Sbjct: 717 LPLDSQQILIEARGQKYIDVDLSESLDWAPVRERVKK-GIRNSNIMAIAPTATISNIVGV 775

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           SQSI+P+YQNLYVKSN+SG+FTV+N +LV++LK R LWD  M++DLKY+DGS+  IERIP
Sbjct: 776 SQSIEPTYQNLYVKSNLSGEFTVINPYLVHDLKARGLWDPVMVNDLKYYDGSVQQIERIP 835

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            DLK ++ATAFE++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLK
Sbjct: 836 QDLKDLYATAFEVETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLK 895

Query: 899 TTYYLRSRSATSVEKSTLKGVDGKLNAVPVTD-----------PNSSTHSLGIPSSCTSD 947
           TTYYLR+ +ATS EKST+    GKLNAV                 +      +P +C+ D
Sbjct: 896 TTYYLRALAATSTEKSTIN--TGKLNAVSSGGSEAANSASAAPAAAEPKPAPVPLACSID 953

Query: 948 -TECEVCQ 954
             +CE CQ
Sbjct: 954 NPDCEACQ 961


>gi|327480259|gb|AEA83569.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           stutzeri DSM 4166]
          Length = 960

 Score =  994 bits (2570), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/967 (57%), Positives = 704/967 (72%), Gaps = 20/967 (2%)

Query: 1   MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK 60
           M              P LA   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG 
Sbjct: 1   MQNQSTRENPLSADAPDLAATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGG 57

Query: 61  GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL 120
            A+ S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+
Sbjct: 58  NAAASSRIHDTVARLTEQVTATFRRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVI 117

Query: 121 YREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI 180
           YRE ++  R + S S   A   P +++   DG+    +  RL+ I+ EAC GL +V   +
Sbjct: 118 YREAQAVKRKSASGSSDIAQPHPSIRVTRADGSQQPLDMGRLQTIITEACEGLAEVDGAL 177

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +  ET KN+YDG++E D+ TAL+ ++RTL+E+EPNY++VTAR L++ LR E L       
Sbjct: 178 IERETLKNLYDGVAEKDVNTALVMTARTLVEREPNYSQVTARLLMDTLRAEALG-FLGVA 236

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           + ATHHEM  LY +    YIE+GV+  LL   +  +DL  L   L +ERD  F YLGLQ 
Sbjct: 237 ESATHHEMADLYAKALPAYIEKGVEFELLDSKLKSYDLAKLGAALNHERDQQFTYLGLQT 296

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYF+H +  R E+PQ FFMRVAMGLA++E +KE RA+EFYNLLSSF +M STPTLFN
Sbjct: 297 LYDRYFIHKDNVRFELPQIFFMRVAMGLAIEEEQKEARAIEFYNLLSSFDYMASTPTLFN 356

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           +GT  PQLSSC+LTTVPDDL GI+ ++++NA+L+K++GGLGNDWTPVR LGA+I GTNGK
Sbjct: 357 AGTLRPQLSSCYLTTVPDDLGGIYDSIRDNALLSKFAGGLGNDWTPVRALGAYIKGTNGK 416

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 417 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMN 476

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRV  +  WTLFSP +V DLHDL G+ FE  YE YE     G+IK+F+ +
Sbjct: 477 TANWIPDLFMKRVFDDGPWTLFSPSDVPDLHDLTGRAFEERYEYYEELTKYGKIKLFKTL 536

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVC
Sbjct: 537 PAKDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVC 596

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGSINL+ H  + + D  KL  T+RTAVR+LDNVIDIN +++ +A+ +N  HR +GLG+
Sbjct: 597 NLGSINLVNHIKDGKLDAAKLERTVRTAVRMLDNVIDINYYSVPQAQNANFKHRPVGLGI 656

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ AL+L HI Y S  A++ AD+SME IS++AI AS +LA ERGAYSSF+GSLW +G+
Sbjct: 657 MGFQDALYLQHIAYGSDAAIDFADKSMEAISYYAIQASCDLADERGAYSSFEGSLWSKGI 716

Query: 721 FPIDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
            P+DS  +L E R    + ++ +  L W  +++RVK  G+RNSN MAIAPTATI+NI GV
Sbjct: 717 LPLDSQQILIEARGQKYIDVDLSESLDWAPIRERVKK-GIRNSNIMAIAPTATISNIVGV 775

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           SQSI+P+YQNLYVKSN+SG+FTV+N +LV++LK R LWD  M++DLKY+DGS+  IERIP
Sbjct: 776 SQSIEPTYQNLYVKSNLSGEFTVINPYLVHDLKARGLWDPVMVNDLKYYDGSVQQIERIP 835

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            DLK ++ATAFE++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLK
Sbjct: 836 QDLKDLYATAFEVETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLK 895

Query: 899 TTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIP-----------SSCTSD 947
           TTYYLR+ +ATS EKST+    GKLNAV      ++  +   P           +    +
Sbjct: 896 TTYYLRALAATSTEKSTIN--TGKLNAVSSGGSEAANSASAAPAAEPKPAPVPLACSIDN 953

Query: 948 TECEVCQ 954
            +CE CQ
Sbjct: 954 PDCEACQ 960


>gi|34497742|ref|NP_901957.1| ribonucleotide-diphosphate reductase subunit alpha [Chromobacterium
           violaceum ATCC 12472]
 gi|34103598|gb|AAQ59959.1| ribonucleoside-diphosphate reductase system [Chromobacterium
           violaceum ATCC 12472]
          Length = 972

 Score =  994 bits (2570), Expect = 0.0,   Method: Composition-based stats.
 Identities = 549/954 (57%), Positives = 692/954 (72%), Gaps = 20/954 (2%)

Query: 9   KGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRV 68
           +G   A    A          + I+RNG V  F+P KIS A+ KAF+AV G   + S  +
Sbjct: 31  EGQTAAELGRAAAPQADFSLYKTIRRNGAVVPFEPVKISIAMTKAFLAVMGNQGATSASI 90

Query: 69  QDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDV 128
           +D +  LTEQ V  L++       +HIEDIQDQVE SLM+ G H + R YVLYRE+RS  
Sbjct: 91  RDKVAQLTEQVVNALMRRKPEGGAIHIEDIQDQVELSLMRFGEHDVARAYVLYREQRSQE 150

Query: 129 RAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKN 188
           RAA+  + +      ++ ++  DG  +  +  RL   +E A   L  +    +L+ET KN
Sbjct: 151 RAARGEALTSV----QINVLRKDGRKLPLDVPRLRASIEAASKNLAGIDVDAILAETLKN 206

Query: 189 MYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEM 248
           +YDG+ E ++  + I ++R++IE++P Y  VTAR L+  +R E+L       +  +  EM
Sbjct: 207 IYDGVPEEEVGKSAILAARSMIEQDPAYDYVTARLLMGNIRLEILG------EAVSQDEM 260

Query: 249 QCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLH 308
              Y  YF  YI++G+ A LL E + ++DL  L   L  ERD  F YLGLQ LYDRYFLH
Sbjct: 261 GKQYAPYFADYIKKGIAAELLDEKLAEYDLKKLGAALDAERDLQFGYLGLQTLYDRYFLH 320

Query: 309 INGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQL 368
           ++G+RIEMPQAF+MRVAMGLAL E  +E RA+EFY +LSSF FM STPTLFNSGTR  QL
Sbjct: 321 VDGTRIEMPQAFYMRVAMGLALNEVNREDRAIEFYKVLSSFDFMSSTPTLFNSGTRRSQL 380

Query: 369 SSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFL 428
           SSC+LTT+ DDL GI+  ++ENA+L+K++GGLGNDWTPVR +G+HI GTNGKSQGV+PFL
Sbjct: 381 SSCYLTTIADDLDGIYEGIKENALLSKFAGGLGNDWTPVRAMGSHIKGTNGKSQGVVPFL 440

Query: 429 KVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDL 488
           KV NDTAVAVNQGGKRKGAVCAYLETWH D+EEFL+LRKNTGDDRRRTHDMNTANWIPDL
Sbjct: 441 KVVNDTAVAVNQGGKRKGAVCAYLETWHADIEEFLELRKNTGDDRRRTHDMNTANWIPDL 500

Query: 489 FMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRK 548
           FMKRV +   W+LFSP E  DLHDLYG+ FE AY  YE +  RGE+KV+++I A++LWRK
Sbjct: 501 FMKRVMEGGDWSLFSPSETPDLHDLYGQAFEKAYTAYEARGARGELKVYKRIPALSLWRK 560

Query: 549 MLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINL- 607
           MLTMLFETGHPW+TFKDPCNIRSPQQH+GVVHSSNLCTEITLN++ +E AVCNLGS+NL 
Sbjct: 561 MLTMLFETGHPWVTFKDPCNIRSPQQHMGVVHSSNLCTEITLNTNDDEIAVCNLGSVNLS 620

Query: 608 LAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSAL 667
                +   D DKL  TIRTA+R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ  L
Sbjct: 621 AHLKEDGSLDADKLQRTIRTALRMLDNVIDINFYPVKKARNSNLKHRPVGMGIMGFQDCL 680

Query: 668 HLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIG 727
           H+  +PY S  AVE ADESME +++ A  AS ELA+ERG Y S+ GSLWD+GV P DSI 
Sbjct: 681 HIKRVPYGSNAAVEFADESMEMVAYFAYLASTELAEERGRYPSYSGSLWDRGVLPHDSIN 740

Query: 728 LLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSY 786
           LLA  R   L ++RT R+ W++L++R+K  GMRNSNC+AIAPTATIANI GVS SI+P+Y
Sbjct: 741 LLAAERGGYLEVDRTERMDWNKLRERIKQHGMRNSNCLAIAPTATIANIIGVSASIEPTY 800

Query: 787 QNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHA 846
           QNL+VKSN+SG+FTV N +LV +LK   LWDE M++DLKY DGS+G I+R+P +LK I+A
Sbjct: 801 QNLFVKSNLSGEFTVTNEYLVRDLKAAGLWDEVMVADLKYFDGSLGQIDRVPAELKAIYA 860

Query: 847 TAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSR 906
           TAFE+DP WL+E+ASRRQKWIDQAQSLNLY+   SGKKLD +Y+ AWL GLKTTYYLR+ 
Sbjct: 861 TAFEVDPKWLVEAASRRQKWIDQAQSLNLYMAGASGKKLDELYKHAWLRGLKTTYYLRTL 920

Query: 907 SATSVEKSTLKGVDGKLNAVPVTDPNSS------THSLGIPSSCTSDTECEVCQ 954
           +ATS EKST +G  G+LNAV      +       T +         + +CE CQ
Sbjct: 921 AATSAEKSTGRG--GELNAVSSQAQTAPAAAVDNTPATDAKFCSIDNPDCESCQ 972


>gi|254428366|ref|ZP_05042073.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [Alcanivorax sp. DG881]
 gi|196194535|gb|EDX89494.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [Alcanivorax sp. DG881]
          Length = 962

 Score =  994 bits (2569), Expect = 0.0,   Method: Composition-based stats.
 Identities = 565/959 (58%), Positives = 715/959 (74%), Gaps = 18/959 (1%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P+ D N  D+    SLA   P +   ++VIKRNG V S+D  KI+ AI KAF+AVEG  A
Sbjct: 15  PASDSNDQDQ----SLASTAPGQ---LRVIKRNGKVVSYDDDKITVAISKAFLAVEGGTA 67

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S R+ + +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YVLYR
Sbjct: 68  AASSRIHETVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRNGEQKVARDYVLYR 127

Query: 123 EERSDVRAAQSHSKSDAPIAPK-LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIV 181
           E+++  RAA+  S   AP     + + M+DG+    +  RLE ++  ACSGL+DV++  +
Sbjct: 128 EQQASKRAAEHSSDLPAPTHQVDMSVTMEDGSKAPLDMARLEHLIRAACSGLEDVNADKI 187

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           ++ET KN+YDG+S  D+ T+++ ++RT+IE EPNY++VTAR L++K+R E L       +
Sbjct: 188 ITETVKNLYDGVSIHDVNTSMVITARTMIEVEPNYSQVTARLLMDKIRAEAL-QFLNVAE 246

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           +A+H EM  LY E    YI +G++  LL   + ++DL  L   L   RD  F YLGLQ L
Sbjct: 247 RASHDEMNALYGEALKAYIGKGIELELLSPQLAEYDLDKLGAALDGNRDLQFSYLGLQTL 306

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYF+H N +RIE+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+
Sbjct: 307 YDRYFIHHNDTRIELPQCFFMRVAMGLAVEEDNREARAIEFYNLLSSFDYMSSTPTLFNA 366

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT  PQLSSC+LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LGA+I GTNG+S
Sbjct: 367 GTLRPQLSSCYLTTVPDDLHGIYGAIQDNAMLSKFAGGLGNDWTPVRALGAYIKGTNGRS 426

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMN+
Sbjct: 427 QGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNS 486

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFMKRV     WTLFSP++  DLHDLYG+ FE AY  YE +   GE+K+F+++ 
Sbjct: 487 ANWIPDLFMKRVINEEDWTLFSPNDAPDLHDLYGEAFEKAYLEYEAKTRSGELKLFKRLP 546

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A+ LWRKML+MLFETGHPW TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ EE AVCN
Sbjct: 547 AINLWRKMLSMLFETGHPWFTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNQEEIAVCN 606

Query: 602 LGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLM 661
           LGS+NL  H   N  D +KL  TI TAVR+LDNVIDIN +++ +A++SN  HR +GLG+M
Sbjct: 607 LGSVNLAQHVDENGLDIEKLQGTINTAVRMLDNVIDINYYSVPQAERSNMKHRPVGLGIM 666

Query: 662 GFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVF 721
           GFQ AL+   I YAS +AV  AD SME +S++AI AS +LA+ERGAY +F GSLW QGV 
Sbjct: 667 GFQDALYKQGISYASSDAVTFADNSMEAVSYYAIQASAKLAEERGAYQTFDGSLWSQGVL 726

Query: 722 PIDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
           PIDSI +L   R      ++R+  L WD ++   K  GMRNSN MAIAPTATIANI GVS
Sbjct: 727 PIDSIEILVNQRGEDYCKVDRSQTLDWDSVRAMAKK-GMRNSNVMAIAPTATIANITGVS 785

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
           QSI+P+YQNLYVKSN+SG+FTVVN +LV+ LK+R LWD  M++DLKY+DGS   IERIP 
Sbjct: 786 QSIEPTYQNLYVKSNLSGEFTVVNPYLVSALKERGLWDNVMVNDLKYYDGSAQPIERIPA 845

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
           DLK+   TAFE++P WL+E+ASRRQKWIDQAQSLNLY+ E +GKKLD  Y+ AWL+GLKT
Sbjct: 846 DLKEQFRTAFEVEPRWLVEAASRRQKWIDQAQSLNLYIAEANGKKLDVTYKMAWLLGLKT 905

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTH---SLGIPSSCT-SDTECEVCQ 954
           TYYLR+  AT  EKST+   DGKLN V       +     +  +P +C+  D +CE CQ
Sbjct: 906 TYYLRAIGATQTEKSTIN--DGKLNRVSSKVEEPAAEFGQAADVPQACSLDDPDCEACQ 962


>gi|88812073|ref|ZP_01127325.1| ribonucleotide-diphosphate reductase alpha subunit [Nitrococcus
           mobilis Nb-231]
 gi|88790577|gb|EAR21692.1| ribonucleotide-diphosphate reductase alpha subunit [Nitrococcus
           mobilis Nb-231]
          Length = 955

 Score =  994 bits (2569), Expect = 0.0,   Method: Composition-based stats.
 Identities = 559/954 (58%), Positives = 710/954 (74%), Gaps = 14/954 (1%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEK-IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
           P   +      + P+ ++  PE   + + VI+R+G V+ FDP KI+ A+ KA++AVEG  
Sbjct: 14  PEVTMPAQSAVSLPAESFEHPESRARDLHVIRRDGQVSGFDPGKITVAMTKAYLAVEGAN 73

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
           AS S R+++ ++ L  Q V  L +   +   VHIEDIQDQVE +LM++G H++ R YVLY
Sbjct: 74  ASGSQRIRETVERLVGQVVEALTRRQPAGGRVHIEDIQDQVELALMRAGEHRVARAYVLY 133

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIV 181
           REER+  R  Q+     A  A +L++   DG  +  +  RL  IVEE+C  +  V  + +
Sbjct: 134 REERARARQDQAEPV--AAQAERLRVTRADGGQVPLDEARLRRIVEESCQRIAGVEPEAI 191

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           ++ET++N+YDG+ E++L TAL+  +RTLIE+EP Y+ V A  LL+ LRRE L+ +     
Sbjct: 192 VAETHRNLYDGIPEAELGTALVMCARTLIEREPGYSYVAAGLLLDTLRREALSFLGGVEA 251

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
            AT  EM   YP+YF  Y+  GV+  LL   +++FDL  LA  L+  RD  F YLGLQ L
Sbjct: 252 GATFEEMAKRYPDYFIAYVRRGVELELLDPRLLEFDLERLARVLEPARDRQFGYLGLQTL 311

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLH +G+  E+PQAFFMRVAMGLAL E ++E+RA EFY LL+SF FM STPTLFN+
Sbjct: 312 YDRYFLHYDGTHFELPQAFFMRVAMGLALNEIDREERAAEFYRLLASFDFMSSTPTLFNA 371

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GTR PQLSSC+L+T+PDDL GI+ A+++NA+L+K++GGLGNDWTPVR LGAHI GTNG+S
Sbjct: 372 GTRRPQLSSCYLSTIPDDLDGIYSAIRDNALLSKFAGGLGNDWTPVRALGAHIKGTNGRS 431

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKVANDTAVAVNQGG+R+GAVCAYLE WH+D+EEFL+LRKNTGD+RRRTHDMNT
Sbjct: 432 QGVVPFLKVANDTAVAVNQGGRRRGAVCAYLEIWHLDIEEFLELRKNTGDERRRTHDMNT 491

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANW+PDLFM+RV   A WTLFSPDE  DLHDLYG  FE  Y  YE QA+RGE++ ++++S
Sbjct: 492 ANWVPDLFMRRVIDEADWTLFSPDETPDLHDLYGAAFEAHYREYEAQAERGELRNYKRVS 551

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           AVALWR+ML+MLFETGHPWITFKD CN RSPQQH GVVHSSNLCTEITLN+S +E AVCN
Sbjct: 552 AVALWRRMLSMLFETGHPWITFKDACNARSPQQHTGVVHSSNLCTEITLNTSDDEIAVCN 611

Query: 602 LGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLM 661
           LGS+NL AH      D  +L  T+RTA+R+LDNVIDIN +++ +A+++N  HR +GLG+M
Sbjct: 612 LGSVNLAAHVGAEGIDAARLERTVRTAMRMLDNVIDINWYSVPQARRANMRHRPVGLGVM 671

Query: 662 GFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVF 721
           GFQ AL+ L +PYAS EAV+ AD SME IS++AI AS ELAQERGAY+SF GSLW +G+ 
Sbjct: 672 GFQDALYRLGLPYASREAVDFADRSMETISYYAIQASSELAQERGAYASFAGSLWSRGIL 731

Query: 722 PIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           PIDSI LLAE R   L M+ ++ L WD L++R++  GMRNSNC+AIAPTATIANI GVS 
Sbjct: 732 PIDSIRLLAEQRGEPLTMDTSTTLDWDALRERIRRTGMRNSNCLAIAPTATIANIVGVSP 791

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+Y+NLYVKSN+SG+FTVVN  LV  LK R LWD  +++DLKY DGS+  IER+P+ 
Sbjct: 792 SIEPTYRNLYVKSNLSGEFTVVNPHLVEALKARGLWDAVLVNDLKYFDGSVQAIERVPEP 851

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           +K ++ TAFEIDP WL+E+ASRRQKW+DQ+QSLNLY+ E SG KLD +YR AW  GLKTT
Sbjct: 852 IKALYTTAFEIDPNWLVEAASRRQKWLDQSQSLNLYMAEASGPKLDALYRNAWRRGLKTT 911

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           YYLRS  AT VEKST+   DG LN V       +            D ECE CQ
Sbjct: 912 YYLRSLGATHVEKSTV--ADGALNRVAAAPAAPACAV--------DDPECEACQ 955


>gi|254784924|ref|YP_003072352.1| ribonucleotide-diphosphate reductase subunit alpha [Teredinibacter
           turnerae T7901]
 gi|237686086|gb|ACR13350.1| ribonucleoside-diphosphate reductase alpha subunit, class I
           [Teredinibacter turnerae T7901]
          Length = 961

 Score =  993 bits (2568), Expect = 0.0,   Method: Composition-based stats.
 Identities = 563/958 (58%), Positives = 716/958 (74%), Gaps = 12/958 (1%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P+  V + +  +  S+A   P +   ++VIKRNG +  +   KI+ A+ KAF+AVEG  A
Sbjct: 10  PTSPVPQANPHSNSSIANAAPGQ---LRVIKRNGTLVPYTDDKIAVAMTKAFLAVEGGTA 66

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S R+ + + NLT+Q      +   S   +HIE+IQDQVE +LM++G HK+ R+YVLYR
Sbjct: 67  AASSRIHETVANLTQQISATFKRRMPSGGTIHIEEIQDQVELTLMRTGEHKVARDYVLYR 126

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVL 182
            ER+ +RA +          P++ ++  DG+L   +  RL  +V EAC+GL+DV  + +L
Sbjct: 127 AERAKLRAEKEKLSQANVDFPEINVLQPDGSLQPLDVMRLHTVVSEACAGLKDVDGEAIL 186

Query: 183 SETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQK 242
            E  +N+Y+G+S  DL T+L+ S+RTL+EKEPNY   TAR L++KLR E L        +
Sbjct: 187 KEAMRNLYEGVSAEDLNTSLVISARTLVEKEPNYTYATARLLMDKLRAEAL-AFLDVATQ 245

Query: 243 ATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILY 302
           AT  EM+  YP     YI  G++  LL  ++ DFDL  L   L  ERD  F YLGLQ LY
Sbjct: 246 ATSAEMEMFYPNALPAYISRGIELELLDPALADFDLQLLGAALIPERDQQFTYLGLQTLY 305

Query: 303 DRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSG 362
           DRYFLH +G+R E+PQ FFMRVAMGLA++E +K  RA+EFY LLSSF +M STPTLFN+G
Sbjct: 306 DRYFLHSDGTRFELPQIFFMRVAMGLAMREDDKNGRAIEFYRLLSSFDYMSSTPTLFNAG 365

Query: 363 TRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQ 422
           T  PQLSSC+LT+VPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LG++I GTNGKSQ
Sbjct: 366 TLRPQLSSCYLTSVPDDLHGIYGAIQDNAMLSKWAGGLGNDWTPVRALGSYIKGTNGKSQ 425

Query: 423 GVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTA 482
           GV+PFLKVANDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTA
Sbjct: 426 GVVPFLKVANDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTA 485

Query: 483 NWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISA 542
           NW+PDLFMKRV ++  WTLF+P  V DLHDL+G  FE  YE+YER+A  G IK F+K+ A
Sbjct: 486 NWVPDLFMKRVFEDKEWTLFTPSTVPDLHDLFGLAFEERYEHYEREAAAGNIKPFKKVRA 545

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA-VCN 601
           V LWRKML MLFETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+ + E   VCN
Sbjct: 546 VDLWRKMLGMLFETGHPWITFKDACNLRSPQQHAGVVHSSNLCTEITLNTKANEEIAVCN 605

Query: 602 LGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLM 661
           LGSINL  H  + + D +KL  ++ TAVR+LDNVIDIN ++++ A+ SN  HR +GLG+M
Sbjct: 606 LGSINLAQHVVDGKLDQEKLQRSVDTAVRMLDNVIDINYYSVDTARNSNLRHRPVGLGIM 665

Query: 662 GFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVF 721
           GFQ AL+ + IPY+S  AVE AD SME +S++AISAS  LA ERG+YS+F+GSLW QGV 
Sbjct: 666 GFQDALYKMRIPYSSAAAVEFADRSMEAVSYYAISASSALASERGSYSTFEGSLWSQGVL 725

Query: 722 PIDSIGLLAEVRDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
           PIDSI LLA+ R E  +  ++T+ L WD L+  VKT GMRNSN MAIAPTATIANI GVS
Sbjct: 726 PIDSIQLLAKNRGEQFIEQDQTTTLDWDTLRNTVKTQGMRNSNVMAIAPTATIANITGVS 785

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
           QSI+P+YQNLYVKSN+SG+FTVVN +LV++LK R LWD  M++DLKY++GS+  I+RIPD
Sbjct: 786 QSIEPTYQNLYVKSNLSGEFTVVNPYLVHDLKDRGLWDSVMVNDLKYYEGSVFKIDRIPD 845

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
           DLK ++ATAFE++P W++++ASRRQKWIDQAQSLNLY+   +GKKLD  YR AW  GLKT
Sbjct: 846 DLKLLYATAFEVEPRWIVDAASRRQKWIDQAQSLNLYISGANGKKLDITYRMAWYRGLKT 905

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNS--STHSLGIPSSCT-SDTECEVCQ 954
           TYYLR+ +AT+ EKST+    G LNAV    P +  S     +P +C+  D +CE CQ
Sbjct: 906 TYYLRALAATTTEKSTID--TGSLNAVSSGAPAANISAGPADVPKACSLDDPDCEACQ 961


>gi|90022103|ref|YP_527930.1| ribonucleotide-diphosphate reductase subunit alpha [Saccharophagus
           degradans 2-40]
 gi|89951703|gb|ABD81718.1| ribonucleoside-diphosphate reductase class Ia alpha subunit
           [Saccharophagus degradans 2-40]
          Length = 969

 Score =  993 bits (2568), Expect = 0.0,   Method: Composition-based stats.
 Identities = 556/965 (57%), Positives = 712/965 (73%), Gaps = 18/965 (1%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P       +  +  ++    P +   ++VIKRNG V  +   KIS A+ KAF+AVEG  
Sbjct: 11  KPQGSPIADNASSSSTINATAPGQ---LRVIKRNGTVVPYTDDKISVAMTKAFLAVEGGT 67

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
           A+ S R+ + ++ LT Q      +   S   +HIE+IQDQVE +LM++G HK+ R+YV+Y
Sbjct: 68  AAASRRIHETVEGLTAQISATFKRRMPSGGTIHIEEIQDQVELTLMRAGEHKVARDYVIY 127

Query: 122 REERSDVRA-AQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI 180
           R +R++ R  A +    +    P++ ++  +G     +  R++ +V EAC+GL+DV +  
Sbjct: 128 RAKRAEQRTPAVNVEDVNFSDFPEINVVDHNGDRHPLDIDRIKTVVAEACAGLKDVDADA 187

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +L E  +++YDG+S +DL TAL+ S+RTL+EKEPNY   T+R L++KLR E L +     
Sbjct: 188 ILKEAMRSLYDGVSLTDLNTALVISARTLVEKEPNYTYATSRLLMDKLRAEAL-SFLGIA 246

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           ++AT  EM+ LY +    YIE+G++  L+   +  +DL  L N L  ERD  F YLGLQ 
Sbjct: 247 EEATQAEMETLYAKTLPAYIEKGIELDLISPDLASYDLNMLGNALIAERDLQFTYLGLQT 306

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLH N  RIE+PQ FFMRVAMGLA  E  K +RAVEFY LLSSF +M STPTLFN
Sbjct: 307 LYDRYFLHSNDVRIELPQIFFMRVAMGLAANEENKNERAVEFYRLLSSFDYMSSTPTLFN 366

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           +GT  PQLSSC+LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVRGLGA+I GTNGK
Sbjct: 367 AGTLRPQLSSCYLTTVPDDLHGIYGAMQDNAMLSKWAGGLGNDWTPVRGLGAYIKGTNGK 426

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKVANDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 427 SQGVVPFLKVANDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMN 486

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANW+PDLFMKRV +   WTLFSP++V DLHDL+G+ FE  YE YERQA  G+I+V +K+
Sbjct: 487 TANWVPDLFMKRVFEEKEWTLFSPNDVPDLHDLFGRAFEDRYEEYERQAAAGKIRVHKKV 546

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA-V 599
            A+ LWRKML MLFETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+ + E   V
Sbjct: 547 RALDLWRKMLGMLFETGHPWITFKDACNLRSPQQHAGVVHSSNLCTEITLNTKANEEIAV 606

Query: 600 CNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLG 659
           CNLGSINL  H  + + D +KLA T++TAVR+LDNVIDIN + +E A+ SN  HR +GLG
Sbjct: 607 CNLGSINLAQHIVDGKLDEEKLAQTVKTAVRMLDNVIDINYYAVESARTSNMRHRPVGLG 666

Query: 660 LMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQG 719
           LMGFQ AL+ ++I Y+S +AV  AD SME IS+HAI AS ELA+ERG+YS+F GSLW +G
Sbjct: 667 LMGFQDALYKMNISYSSDDAVTFADRSMEAISYHAIKASSELAKERGSYSTFDGSLWSKG 726

Query: 720 VFPIDSIGLLAEVRDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICG 777
           + P+DS+ LL E R E  + ++++S   WD L++ VKT GMRNSN MAIAPTATIANI G
Sbjct: 727 ILPLDSLDLLIENRGEKFIKVDKSSTHDWDTLRETVKTQGMRNSNVMAIAPTATIANITG 786

Query: 778 VSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERI 837
           VSQSI+P+YQNLYVKSN+SG+FTVVN +LV++LK+R LWD  M++DLKY++GS+  I+RI
Sbjct: 787 VSQSIEPTYQNLYVKSNLSGEFTVVNPYLVHDLKERGLWDSVMVNDLKYYEGSLQKIDRI 846

Query: 838 PDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGL 897
           P+DLK +++TAFE++P W++E+ASRRQKWIDQAQSLNLY+   +GKKLD  YR AW  GL
Sbjct: 847 PEDLKALYSTAFEVEPRWIVEAASRRQKWIDQAQSLNLYIAGANGKKLDITYRMAWYSGL 906

Query: 898 KTTYYLRSRSATSVEKSTLKGVDGKLNAV--------PVTDPNSSTHSLGIPSSCTSDTE 949
           KTTYYLR+ SAT+ EKST+    G LNAV                  +    +    D +
Sbjct: 907 KTTYYLRALSATTTEKSTV--TSGTLNAVSSGGGASQSAAAAAEPAPAAVPLACSLDDPD 964

Query: 950 CEVCQ 954
           CE CQ
Sbjct: 965 CEACQ 969


>gi|28868877|ref|NP_791496.1| ribonucleoside-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|28852116|gb|AAO55191.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|331016766|gb|EGH96822.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 970

 Score =  993 bits (2567), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/969 (57%), Positives = 695/969 (71%), Gaps = 26/969 (2%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           S         A   L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+
Sbjct: 10  SPTGAPQASQAQQDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAA 66

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+
Sbjct: 67  ASSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRD 126

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLS 183
            R+  RA ++         P ++I + DG+    +  RL  IV EAC GL +V + ++ +
Sbjct: 127 SRAKERAGRAPEDQVQ-AHPSIRITLADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQT 185

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
           ET KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         A
Sbjct: 186 ETLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSA 244

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           THHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F YLGLQ LYD
Sbjct: 245 THHEMADLYAKALPAYVATGIKFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYD 304

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 305 RYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGT 364

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 365 LRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 424

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 425 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTAN 484

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISA 542
           WIPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G++K+F+ I A
Sbjct: 485 WIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQA 544

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNL
Sbjct: 545 KDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNL 604

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GSINL  H  N + D DKL  TI  AVR+LDNVIDIN +++ +A+ SN  HR +GLG+MG
Sbjct: 605 GSINLPNHIVNGKLDTDKLKRTIDVAVRMLDNVIDINYYSVPQARNSNLRHRPVGLGIMG 664

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW QG+ P
Sbjct: 665 FQDALYLQHIPYGSDAAVQFADSSMEAVSYYAIQASCDLADERGAYETFQGSLWSQGILP 724

Query: 723 IDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           +DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQ
Sbjct: 725 LDSQQILIEQRGQKYIDVDLKESLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQ 783

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +
Sbjct: 784 SIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQE 843

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTT
Sbjct: 844 LKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTT 903

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCT 945
           YYLR+ +ATS EKST+    GKLNAV          ++  P                   
Sbjct: 904 YYLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAI 961

Query: 946 SDTECEVCQ 954
            + +CE CQ
Sbjct: 962 DEPDCEACQ 970


>gi|298487944|ref|ZP_07005983.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298157495|gb|EFH98576.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|330986741|gb|EGH84844.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. lachrymans str. M301315]
          Length = 970

 Score =  993 bits (2567), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/969 (56%), Positives = 694/969 (71%), Gaps = 26/969 (2%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           S             L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+
Sbjct: 10  SPTGAPQASQTPQDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAA 66

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+
Sbjct: 67  ASSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRD 126

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLS 183
            R+  RA ++         P ++I + DG+    +  RL  IV EAC GL +V + ++ +
Sbjct: 127 SRAKERAVRAPEDQVQ-AHPSIRITLADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQT 185

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
           ET KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         A
Sbjct: 186 ETLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSA 244

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           THHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F YLGLQ LYD
Sbjct: 245 THHEMADLYAKALPAYVATGIKFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYD 304

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 305 RYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGT 364

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 365 LRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 424

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 425 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTAN 484

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISA 542
           WIPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G+IK+F+ I A
Sbjct: 485 WIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQA 544

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNL
Sbjct: 545 KDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNL 604

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GSINL  H  N + D DKL  T+  AVR+LDNVIDIN +++ +AK SN  HR +GLG+MG
Sbjct: 605 GSINLPNHIVNGKLDTDKLKRTVDVAVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMG 664

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW +G+ P
Sbjct: 665 FQDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILP 724

Query: 723 IDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           +DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQ
Sbjct: 725 LDSQQILIEQRGEKYIDVDLKETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQ 783

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +
Sbjct: 784 SIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQE 843

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTT
Sbjct: 844 LKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTT 903

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCT 945
           YYLR+ +ATS EKST+    GKLNAV          ++  P                   
Sbjct: 904 YYLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAI 961

Query: 946 SDTECEVCQ 954
            + +CE CQ
Sbjct: 962 DEPDCEACQ 970


>gi|330949819|gb|EGH50079.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae Cit 7]
          Length = 970

 Score =  993 bits (2566), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/968 (56%), Positives = 694/968 (71%), Gaps = 23/968 (2%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           ++   G   A  +           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 8   ENSPTGAPQASQTQQDLSATAPGQLRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ 
Sbjct: 68  SSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDS 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  RA ++  +      P ++I   DG+    +  RL  IV EAC GL +V + ++ +E
Sbjct: 128 RAKERAVRAPEEQVQ-AHPSIRITRADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQTE 186

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         AT
Sbjct: 187 TLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSAT 245

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 246 HHEMADLYAKALPAYVATGIKFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDR 305

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 306 YFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTL 365

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 366 RPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 425

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 426 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANW 485

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISAV 543
           IPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G+IK+F+ I A 
Sbjct: 486 IPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQAK 545

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLG 603
            LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLG
Sbjct: 546 DLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLG 605

Query: 604 SINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGF 663
           SINL  H  N + D DKL  T+  AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGF
Sbjct: 606 SINLPNHIVNGKLDTDKLKRTVDVAVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGF 665

Query: 664 QSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPI 723
           Q AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+
Sbjct: 666 QDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPL 725

Query: 724 DSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
           DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQS
Sbjct: 726 DSQQILIEQRGEKYIDVDLKETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQS 784

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +L
Sbjct: 785 IEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQEL 844

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           K+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTY
Sbjct: 845 KELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTY 904

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCTS 946
           YLR+ +ATS EKST+    GKLNAV          ++  P                    
Sbjct: 905 YLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAID 962

Query: 947 DTECEVCQ 954
           + +CE CQ
Sbjct: 963 EPDCEACQ 970


>gi|221213240|ref|ZP_03586215.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans CGD1]
 gi|221166692|gb|EED99163.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans CGD1]
          Length = 995

 Score =  993 bits (2566), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/994 (55%), Positives = 691/994 (69%), Gaps = 56/994 (5%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G     P   +         +VI+RNG V +F+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLGGAEQGAPALAPQATF------ADYKVIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV++++  LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVDQLTRNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVRA-AQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A   + +       + ++ D+G     +   L  ++  AC GL   V+  
Sbjct: 131 REKRHLERQHAGEETAAVRETTGGINVV-DNGVTRPLDMNALRALIVSACEGLGAAVNPD 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++    +M   Y EYF ++++ GV+A LL + ++ FDL  L   L   RD  F YLGLQ
Sbjct: 245 -EEVVQADMSTRYAEYFPQFLKRGVEAGLLDDKLLQFDLKRLGEALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV +   WTLFSP    DLHD +G +FE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGGEWTLFSPSTCPDLHDKFGADFEAAYTAYEEKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLVKQPDGTYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LLAE R   + ++ +  L W  L+ R+ T GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLAEARGGYVEVDSSESLDWATLRARIATHGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVT------------------------ 929
           L GLKTTYYLR+ +AT VEKST+    G LNAVP +                        
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTSGGGAAGGAQGAAGGFGAAGGDVSS 961

Query: 930 ---DPNSSTHSLGIPSSCTSDT------ECEVCQ 954
              D  +          CT         ECE CQ
Sbjct: 962 GALDAAALAPVEAEGPVCTMRPGDPGFDECEACQ 995


>gi|167586059|ref|ZP_02378447.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           ubonensis Bu]
          Length = 990

 Score =  993 bits (2566), Expect = 0.0,   Method: Composition-based stats.
 Identities = 549/989 (55%), Positives = 688/989 (69%), Gaps = 51/989 (5%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLGGTEQGAQALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTHNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKI 180
           RE+R   R            A  + ++ D+G     +   L  ++  AC GL   V+   
Sbjct: 131 REKRHLERQHAGEEAPAVESAGGINVV-DNGVTRPLDLNALRALIVSACDGLGAAVNPDP 189

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       
Sbjct: 190 IVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG------ 243

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           ++    EM   Y EYF ++++ GV A LL + ++ FDL  L + L   RD  F YLGLQ 
Sbjct: 244 EEVVQAEMSTRYAEYFPQFLKRGVDAGLLDDKLLQFDLKRLGDALDANRDLQFGYLGLQT 303

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLH++GSRIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFN
Sbjct: 304 LYDRYFLHVDGSRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLFN 363

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGK
Sbjct: 364 SGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGK 423

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 424 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMN 483

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+KI
Sbjct: 484 TANWIPDLFMKRVMEGGDWTLFSPSTCPDLHDKFGAEFETAYTAYEDKVARGEIKLFKKI 543

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVC
Sbjct: 544 PAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVC 603

Query: 601 NLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRA 655
           NLGS+NL+AH           D+DKL  T+  A+R+LDNVIDIN + + KA+ SN  HR 
Sbjct: 604 NLGSVNLVAHLVKQADGSYALDHDKLKRTVSVAMRMLDNVIDINYYAVPKARNSNLKHRP 663

Query: 656 IGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSL 715
           +G+G+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++GSL
Sbjct: 664 VGMGIMGFQDCLHLLRTPYASQAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRGSL 723

Query: 716 WDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
           WD+G+ P D++ LL E R   + ++ +  L W EL+ R+   GMRNSNC+AIAPTATI+N
Sbjct: 724 WDRGILPQDTLKLLTEARGGYVEVDTSESLDWSELRSRIAAHGMRNSNCVAIAPTATISN 783

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           I GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  I
Sbjct: 784 IIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSRI 843

Query: 835 ERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWL 894
           +R+P DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL
Sbjct: 844 DRVPADLRAIYATAFEVDPTWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKLAWL 903

Query: 895 MGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP-----------------------VTDP 931
            GLKTTYYLR+ +AT VEKST+    G LNAVP                           
Sbjct: 904 RGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTSGGAGGAQGAAGGFGATGGDASAAGT 961

Query: 932 NSSTHSLGIPSSCTSDT------ECEVCQ 954
            ++         C          ECE CQ
Sbjct: 962 VNAAPVEAEGPVCMMRPGDPGFDECEACQ 990


>gi|330880141|gb|EGH14290.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
 gi|330966560|gb|EGH66820.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 970

 Score =  993 bits (2566), Expect = 0.0,   Method: Composition-based stats.
 Identities = 554/969 (57%), Positives = 695/969 (71%), Gaps = 26/969 (2%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           S         A   L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+
Sbjct: 10  SPTGAPQASQAQQDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAA 66

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+
Sbjct: 67  ASSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRD 126

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLS 183
            R+  RA ++         P ++I + DG+    +  RL  IV EAC GL +V + ++ +
Sbjct: 127 SRAKERAVRAPEDQVQ-AHPSIRITLADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQT 185

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
           ET KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         A
Sbjct: 186 ETLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSA 244

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           THHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F YLGLQ LYD
Sbjct: 245 THHEMADLYAKALPAYVATGIKFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYD 304

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 305 RYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGT 364

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 365 LRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 424

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 425 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTAN 484

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISA 542
           WIPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G++K+F+ I A
Sbjct: 485 WIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQA 544

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNL
Sbjct: 545 KDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNL 604

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GSINL  H  N + D DKL  TI  AVR+LDNVIDIN +++ +AK SN  HR +GLG+MG
Sbjct: 605 GSINLPNHIVNGKLDTDKLKRTIDVAVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMG 664

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW QG+ P
Sbjct: 665 FQDALYLQHIPYGSDAAVQFADSSMEAVSYYAIQASCDLADERGAYETFQGSLWSQGILP 724

Query: 723 IDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           +DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQ
Sbjct: 725 LDSQQILIEQRGQKYIDVDLKESLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQ 783

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +
Sbjct: 784 SIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQE 843

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTT
Sbjct: 844 LKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTT 903

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCT 945
           YYLR+ +ATS EKST+    GKLNAV          ++  P                   
Sbjct: 904 YYLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAI 961

Query: 946 SDTECEVCQ 954
            + +CE CQ
Sbjct: 962 DEPDCEACQ 970


>gi|289628679|ref|ZP_06461633.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|330866024|gb|EGH00733.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. aesculi str. 0893_23]
          Length = 970

 Score =  992 bits (2565), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/969 (56%), Positives = 693/969 (71%), Gaps = 26/969 (2%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           S             L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+
Sbjct: 10  SPTGAPQASQTPQDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAA 66

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+
Sbjct: 67  ASSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRD 126

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLS 183
            R+  RA ++         P ++I + DG+    +  RL  IV EAC GL +V + ++ +
Sbjct: 127 SRAKERAVRAPEDQVQ-AHPSIRITLADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQT 185

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
           ET KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         A
Sbjct: 186 ETLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSA 244

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           THHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F YLGLQ LYD
Sbjct: 245 THHEMADLYAKALPAYVATGIKFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYD 304

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 305 RYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGT 364

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 365 LRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 424

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 425 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTAN 484

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISA 542
           WIPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G++K+F+ I A
Sbjct: 485 WIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQA 544

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             LWRKML+MLFETGHPW+TFKDPCN+RSPQQH GVVHSSNLCTEITLN++ +E AVCNL
Sbjct: 545 KDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHAGVVHSSNLCTEITLNTNKDEIAVCNL 604

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GSINL  H  N + D DKL  T+  AVR+LDNVIDIN +++ +AK SN  HR +GLG+MG
Sbjct: 605 GSINLPNHIVNGKLDTDKLKRTVDVAVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMG 664

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW +G+ P
Sbjct: 665 FQDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILP 724

Query: 723 IDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           +DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQ
Sbjct: 725 LDSQQILIEQRGEKYIDVDLKETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQ 783

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +
Sbjct: 784 SIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQE 843

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTT
Sbjct: 844 LKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTT 903

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCT 945
           YYLR+ +ATS EKST+    GKLNAV          ++  P                   
Sbjct: 904 YYLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAI 961

Query: 946 SDTECEVCQ 954
            + +CE CQ
Sbjct: 962 DEPDCEACQ 970


>gi|320323422|gb|EFW79510.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320327619|gb|EFW83631.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330876274|gb|EGH10423.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 970

 Score =  992 bits (2565), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/969 (56%), Positives = 694/969 (71%), Gaps = 26/969 (2%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           S             L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+
Sbjct: 10  SPTGAPQASQTPQDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAA 66

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+
Sbjct: 67  ASSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRD 126

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLS 183
            R+  RA ++         P ++I + DG+    +  RL  IV EAC GL +V + ++ +
Sbjct: 127 SRAKERAVRAPEDQVQ-AHPSIRITLADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQT 185

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
           ET KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         A
Sbjct: 186 ETLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSA 244

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           THHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F YLGLQ LYD
Sbjct: 245 THHEMADLYAKALPAYVATGIKFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYD 304

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 305 RYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGT 364

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 365 LRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 424

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 425 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTAN 484

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISA 542
           WIPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G++K+F+ I A
Sbjct: 485 WIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQA 544

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNL
Sbjct: 545 KDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNL 604

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GSINL  H  N + D DKL  T+  AVR+LDNVIDIN +++ +AK SN  HR +GLG+MG
Sbjct: 605 GSINLPNHIVNGKLDTDKLKRTVDVAVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMG 664

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW +G+ P
Sbjct: 665 FQDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILP 724

Query: 723 IDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           +DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQ
Sbjct: 725 LDSQQILIEQRGEKYIDVDLKETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQ 783

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +
Sbjct: 784 SIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQE 843

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTT
Sbjct: 844 LKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTT 903

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCT 945
           YYLR+ +ATS EKST+    GKLNAV          ++  P                   
Sbjct: 904 YYLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAI 961

Query: 946 SDTECEVCQ 954
            + +CE CQ
Sbjct: 962 DEPDCEACQ 970


>gi|213969510|ref|ZP_03397646.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           syringae pv. tomato T1]
 gi|301385966|ref|ZP_07234384.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. tomato Max13]
 gi|302058709|ref|ZP_07250250.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. tomato K40]
 gi|302134400|ref|ZP_07260390.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|213925606|gb|EEB59165.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           syringae pv. tomato T1]
          Length = 970

 Score =  992 bits (2564), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/969 (57%), Positives = 695/969 (71%), Gaps = 26/969 (2%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           S         A   L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+
Sbjct: 10  SPTGAPQASQAQQDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAA 66

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+
Sbjct: 67  ASSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRD 126

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLS 183
            R+  RA ++         P ++I + DG+    +  RL  IV EAC GL +V + ++ +
Sbjct: 127 SRAKERAGRAPEDQVQ-AHPSIRITLADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQT 185

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
           ET KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         A
Sbjct: 186 ETLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSA 244

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           THHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F YLGLQ LYD
Sbjct: 245 THHEMADLYAKALPAYVATGIKFELLNPVLAEFDLEKLGRAINHERDQQFTYLGLQTLYD 304

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 305 RYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGT 364

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 365 LRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 424

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 425 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTAN 484

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISA 542
           WIPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G++K+F+ I A
Sbjct: 485 WIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQA 544

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNL
Sbjct: 545 KDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNL 604

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GSINL  H  N + D DKL  TI  AVR+LDNVIDIN +++ +A+ SN  HR +GLG+MG
Sbjct: 605 GSINLPNHIVNGKLDTDKLKRTIDVAVRMLDNVIDINYYSVPQARNSNLRHRPVGLGIMG 664

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW QG+ P
Sbjct: 665 FQDALYLQHIPYGSDAAVQFADSSMEAVSYYAIQASCDLADERGAYETFQGSLWSQGILP 724

Query: 723 IDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           +DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQ
Sbjct: 725 LDSQQILIEQRGQKYIDVDLKESLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQ 783

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +
Sbjct: 784 SIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQE 843

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTT
Sbjct: 844 LKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTT 903

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCT 945
           YYLR+ +ATS EKST+    GKLNAV          ++  P                   
Sbjct: 904 YYLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAI 961

Query: 946 SDTECEVCQ 954
            + +CE CQ
Sbjct: 962 DEPDCEACQ 970


>gi|257485934|ref|ZP_05639975.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|331010342|gb|EGH90398.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 970

 Score =  992 bits (2564), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/969 (56%), Positives = 694/969 (71%), Gaps = 26/969 (2%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           S             L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+
Sbjct: 10  SPTGAPQASQTPQDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAA 66

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+
Sbjct: 67  ASSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRD 126

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLS 183
            R+  RA ++         P ++I + DG+    +  RL  IV EAC GL +V + ++ +
Sbjct: 127 SRAKERAVRTPEDQVQ-AHPSIRITLADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQT 185

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
           ET KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         A
Sbjct: 186 ETLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSA 244

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           THHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F YLGLQ LYD
Sbjct: 245 THHEMADLYAKALPAYVATGIKFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYD 304

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 305 RYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGT 364

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 365 LRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 424

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 425 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTAN 484

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISA 542
           WIPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G+IK+F+ I A
Sbjct: 485 WIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQA 544

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNL
Sbjct: 545 KDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNL 604

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GSINL  H  + + D DKL  T+  AVR+LDNVIDIN +++ +AK SN  HR +GLG+MG
Sbjct: 605 GSINLPNHIVDGKLDTDKLKRTVDVAVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMG 664

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW +G+ P
Sbjct: 665 FQDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILP 724

Query: 723 IDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           +DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQ
Sbjct: 725 LDSQQILIEQRGEKYIDVDLKETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQ 783

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +
Sbjct: 784 SIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQE 843

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTT
Sbjct: 844 LKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTT 903

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCT 945
           YYLR+ +ATS EKST+    GKLNAV          ++  P                   
Sbjct: 904 YYLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAI 961

Query: 946 SDTECEVCQ 954
            + +CE CQ
Sbjct: 962 DEPDCEACQ 970


>gi|189349323|ref|YP_001944951.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           multivorans ATCC 17616]
 gi|189333345|dbj|BAG42415.1| ribonucleoside-diphosphate reductase alpha chain [Burkholderia
           multivorans ATCC 17616]
          Length = 997

 Score =  992 bits (2564), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/994 (55%), Positives = 691/994 (69%), Gaps = 56/994 (5%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G     P   +         +VI+RNG V +F+PSKI+ A+ KAF+AV G  
Sbjct: 19  RPLGGAEQGAPALAPQATF------ADYKVIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQ 72

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV++++  LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 73  GAASARVRELVDQLTRNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 132

Query: 122 REERSDVRA-AQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A   + +       + ++ D+G     +   L  ++  AC GL   V+  
Sbjct: 133 REKRHLERQHAGEETAAVRETTGGINVV-DNGVTRPLDMNALRALIVSACDGLGAAVNPD 191

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 192 PIVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG----- 246

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++    +M   Y EYF ++++ GV+A LL + ++ FDL  L   L   RD  F YLGLQ
Sbjct: 247 -EEVVQADMSTRYAEYFPQFLKRGVEAGLLDDKLLQFDLKRLGEALDASRDLQFGYLGLQ 305

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 306 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLF 365

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 366 NSGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNG 425

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 426 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 485

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV +   WTLFSP    DLHD +G +FE AY  YE +  RGEIK+F+K
Sbjct: 486 NTANWIPDLFMKRVMEGGEWTLFSPSTCPDLHDKFGADFEAAYTAYEEKVARGEIKLFKK 545

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 546 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 605

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 606 CNLGSVNLVAHLVKQPDGTYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKHR 665

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 666 PVGLGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRGS 725

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LLAE R   + ++ +  L W  L+ R+ T GMRNSNC+AIAPTATI+
Sbjct: 726 LWDRGILPQDTLKLLAEARGGYVEVDSSESLDWATLRARIATHGMRNSNCVAIAPTATIS 785

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 786 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 845

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 846 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 905

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVT------------------------ 929
           L GLKTTYYLR+ +AT VEKST+    G LNAVP +                        
Sbjct: 906 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTSGGGAAGGAQGAAGGFGAAGGDVSS 963

Query: 930 ---DPNSSTHSLGIPSSCTSDT------ECEVCQ 954
              D  +          CT         ECE CQ
Sbjct: 964 GALDAAALAPVEAEGPVCTMRPGDPGFDECEACQ 997


>gi|161525958|ref|YP_001580970.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           multivorans ATCC 17616]
 gi|221202416|ref|ZP_03575448.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans CGD2M]
 gi|221208124|ref|ZP_03581129.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans CGD2]
 gi|160343387|gb|ABX16473.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans ATCC 17616]
 gi|221172027|gb|EEE04469.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans CGD2]
 gi|221177693|gb|EEE10108.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans CGD2M]
          Length = 995

 Score =  992 bits (2564), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/994 (55%), Positives = 691/994 (69%), Gaps = 56/994 (5%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G     P   +         +VI+RNG V +F+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLGGAEQGAPALAPQATF------ADYKVIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV++++  LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVDQLTRNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVRA-AQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A   + +       + ++ D+G     +   L  ++  AC GL   V+  
Sbjct: 131 REKRHLERQHAGEETAAVRETTGGINVV-DNGVTRPLDMNALRALIVSACDGLGAAVNPD 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++    +M   Y EYF ++++ GV+A LL + ++ FDL  L   L   RD  F YLGLQ
Sbjct: 245 -EEVVQADMSTRYAEYFPQFLKRGVEAGLLDDKLLQFDLKRLGEALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV +   WTLFSP    DLHD +G +FE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGGEWTLFSPSTCPDLHDKFGADFEAAYTAYEEKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLVKQPDGTYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LLAE R   + ++ +  L W  L+ R+ T GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLAEARGGYVEVDSSESLDWATLRARIATHGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVT------------------------ 929
           L GLKTTYYLR+ +AT VEKST+    G LNAVP +                        
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTSGGGAAGGAQGAAGGFGAAGGDVSS 961

Query: 930 ---DPNSSTHSLGIPSSCTSDT------ECEVCQ 954
              D  +          CT         ECE CQ
Sbjct: 962 GALDAAALAPVEAEGPVCTMRPGDPGFDECEACQ 995


>gi|110833572|ref|YP_692431.1| ribonucleotide-diphosphate reductase subunit alpha [Alcanivorax
           borkumensis SK2]
 gi|110646683|emb|CAL16159.1| ribonucleoside reductase [Alcanivorax borkumensis SK2]
          Length = 962

 Score =  992 bits (2563), Expect = 0.0,   Method: Composition-based stats.
 Identities = 555/957 (57%), Positives = 707/957 (73%), Gaps = 14/957 (1%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P+ D N  D+      A   P +   ++VIKRNG V  +D  KI+ AI KAF+AVEG  A
Sbjct: 15  PASDSNDQDQSI----ASTAPGQ---LRVIKRNGKVVGYDDDKITVAISKAFLAVEGGTA 67

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S R+ + +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YVLYR
Sbjct: 68  AASSRIHETVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRNGEQKVARDYVLYR 127

Query: 123 EERSDVRAAQSHSKSDAPIAPK--LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI 180
           E+R+  RAA+  S        +  + + M+DG+    +  RLE ++  ACSGL+DV++  
Sbjct: 128 EQRASKRAAEQKSTDLPAPTHQVDMSVTMEDGSKAPLDMARLEHLIRAACSGLEDVNADK 187

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +++ET KN+YDG+S  D+ T+++ ++RT+IE EPNY++VTAR L++K+R E L    +  
Sbjct: 188 IITETVKNLYDGVSIHDVNTSMVITARTMIEVEPNYSQVTARLLMDKIRAEAL-QFLRVA 246

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           ++A+H EM  LY +    YI +G++  LL   + ++DL  L   L   RD  F YLGLQ 
Sbjct: 247 ERASHDEMNALYSDALKAYISKGIELELLSPQLAEYDLDALGAALDGNRDLQFSYLGLQT 306

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYF+H N +RIE+PQ FFMRVAMGLA +E  +E RA+EFYNLLSSF +M STPTLFN
Sbjct: 307 LYDRYFIHHNDTRIELPQCFFMRVAMGLAAEEDNREARAIEFYNLLSSFDYMSSTPTLFN 366

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           +GT  PQLSSC+LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LGA+I GTNG+
Sbjct: 367 AGTLRPQLSSCYLTTVPDDLHGIYGAIQDNAMLSKFAGGLGNDWTPVRALGAYIKGTNGR 426

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 427 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMN 486

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           +ANWIPDLFMKRV     WTLFSP++  DLHDLYG+ FE AY  YE +   GE+K+F+++
Sbjct: 487 SANWIPDLFMKRVINEEDWTLFSPNDTPDLHDLYGEAFEKAYTEYEAKTRSGELKLFKRL 546

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A+ LWRKML+MLFETGHPW TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ EE AVC
Sbjct: 547 PAINLWRKMLSMLFETGHPWFTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNQEEIAVC 606

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGS+NL  H   N  + +KL STI TAVR+LDNVIDIN +++ +AK+SN  HR +GLG+
Sbjct: 607 NLGSVNLAQHVDENGLNIEKLQSTINTAVRMLDNVIDINYYSVPQAKRSNMKHRPVGLGI 666

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ AL+   I YAS +AV  AD SME +S++AI AS +LA+ERGAY +F GSLW QG+
Sbjct: 667 MGFQDALYKQGISYASSDAVTFADTSMEAVSYYAIQASAKLAEERGAYQTFDGSLWSQGI 726

Query: 721 FPIDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
            PIDSI +L + R      ++R+  L WD ++   K  GMRNSN MAIAPTATIANI GV
Sbjct: 727 LPIDSIDILVKQRGEDYCKVDRSQTLDWDSVRAMAKK-GMRNSNVMAIAPTATIANITGV 785

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           SQSI+P+YQNLYVKSN+SG+FTVVN +LV  LK+R LWD  M++DLKY+DGS   IERIP
Sbjct: 786 SQSIEPTYQNLYVKSNLSGEFTVVNPYLVKALKERGLWDNVMVNDLKYYDGSAQPIERIP 845

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            DLK+   TAFE++P WL+E+ASRRQKWIDQAQSLNLY+ E +GKKLD  Y+ AWL+GLK
Sbjct: 846 ADLKEQFRTAFEVEPRWLVEAASRRQKWIDQAQSLNLYIAEANGKKLDVTYKMAWLLGLK 905

Query: 899 TTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
           TTYYLR+  AT  EKST+        +     P     +  +P +C+ D  +CE CQ
Sbjct: 906 TTYYLRAIGATQTEKSTISDGKLNQVSSGPETPAEFNQAADVPKACSIDEPDCEACQ 962


>gi|289648391|ref|ZP_06479734.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. aesculi str. 2250]
          Length = 970

 Score =  992 bits (2563), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/969 (56%), Positives = 693/969 (71%), Gaps = 26/969 (2%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           S             L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+
Sbjct: 10  SPTGAPQASQTPQDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAA 66

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+
Sbjct: 67  ASSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRD 126

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLS 183
            R+  RA ++         P ++I + DG+    +  RL  IV EAC GL +V + ++ +
Sbjct: 127 SRAKERAVRAPEDQVQ-AHPSIRITLADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQT 185

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
           ET KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         A
Sbjct: 186 ETLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSA 244

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           THHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F YLGLQ LYD
Sbjct: 245 THHEMADLYAKALPAYVATGIKFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYD 304

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 305 RYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGT 364

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 365 LRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 424

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 425 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTAN 484

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISA 542
           WIPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G++K+F+ I A
Sbjct: 485 WIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQA 544

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             LWRKML+MLFETGHPW+TFKDPCN+RSPQQH GVVHSSNLCTEITLN++ +E AVCNL
Sbjct: 545 KDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHAGVVHSSNLCTEITLNTNKDEIAVCNL 604

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GSINL  H  N + D DKL  T+  AVR+LDNVIDIN +++ +AK SN  HR +GLG+MG
Sbjct: 605 GSINLPNHIVNGKLDTDKLKRTVDVAVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMG 664

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW +G+ P
Sbjct: 665 FQDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILP 724

Query: 723 IDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           +DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQ
Sbjct: 725 LDSQQILIEQRGEKYIDVDLKETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQ 783

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +
Sbjct: 784 SIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQE 843

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTT
Sbjct: 844 LKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTT 903

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCT 945
           YYLR+ +ATS EKST+    GKLNAV          ++  P                   
Sbjct: 904 YYLRALAATSTEKSTIN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAI 961

Query: 946 SDTECEVCQ 954
            + +CE CQ
Sbjct: 962 DEPDCEACQ 970


>gi|330960619|gb|EGH60879.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. maculicola str. ES4326]
          Length = 970

 Score =  991 bits (2562), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/968 (56%), Positives = 697/968 (72%), Gaps = 23/968 (2%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           ++   G   A  +           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 8   ENSPTGAPQASQTQQDLSATAPGQLRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ 
Sbjct: 68  SSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDS 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  RA ++ ++      P ++I   DG+    +  RL  IV EAC GL +V + ++ +E
Sbjct: 128 RAKERAGRA-TEEQVQAHPSIRITRADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQTE 186

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L       + AT
Sbjct: 187 TLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVAESAT 245

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    Y+  G+K  LL+  + DFDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 246 HHEMADLYAKALPAYVATGIKFELLNPVLADFDLEKLGKAINHERDQQFTYLGLQTLYDR 305

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 306 YFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTL 365

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 366 RPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 425

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 426 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANW 485

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISAV 543
           IPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G+IK+F+ I A 
Sbjct: 486 IPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQAK 545

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLG 603
            LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLG
Sbjct: 546 DLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLG 605

Query: 604 SINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGF 663
           SINL  H  + + D DKL  T+  AVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGF
Sbjct: 606 SINLPNHIVDGKLDTDKLKRTVDVAVRMLDNVIDINYYSVPQARNSNLRHRPVGLGIMGF 665

Query: 664 QSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPI 723
           Q AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+
Sbjct: 666 QDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPL 725

Query: 724 DSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
           DS  +L E R    ++++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQS
Sbjct: 726 DSQQILIEQRGEKYISVDLKETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQS 784

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +L
Sbjct: 785 IEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQEL 844

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           K+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTY
Sbjct: 845 KELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTY 904

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCTS 946
           YLR+ +ATS EKST+    GKLNAV          ++  P                    
Sbjct: 905 YLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAID 962

Query: 947 DTECEVCQ 954
           + +CE CQ
Sbjct: 963 EPDCEACQ 970


>gi|302184854|ref|ZP_07261527.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. syringae 642]
          Length = 970

 Score =  991 bits (2561), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/968 (56%), Positives = 695/968 (71%), Gaps = 23/968 (2%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           ++   G   A  +           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 8   ENSPTGAPQASQTQQDLSATAPGQLRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ 
Sbjct: 68  SSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDS 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  RA ++  +      P ++I   DG+    +  RL  IV EAC GL +V + ++ +E
Sbjct: 128 RAKERAVRAPEEQVQ-AHPSIRITRADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQTE 186

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         AT
Sbjct: 187 TLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSAT 245

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
           HHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F YLGLQ LYDR
Sbjct: 246 HHEMAELYAKALPAYVTAGIKFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDR 305

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT 
Sbjct: 306 YFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTL 365

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
            PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV
Sbjct: 366 RPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGV 425

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW
Sbjct: 426 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANW 485

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISAV 543
           IPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G+IK+F+ I A 
Sbjct: 486 IPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQAK 545

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLG 603
            LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLG
Sbjct: 546 DLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLG 605

Query: 604 SINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGF 663
           SINL  H  + + D DKL  T+  AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGF
Sbjct: 606 SINLPNHIVDGKLDTDKLKRTVDVAVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGF 665

Query: 664 QSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPI 723
           Q AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+
Sbjct: 666 QDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPL 725

Query: 724 DSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
           DS  +L E R    ++++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQS
Sbjct: 726 DSQQILIEQRGEKYISVDLKETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQS 784

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +L
Sbjct: 785 IEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQEL 844

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           K+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTY
Sbjct: 845 KELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTY 904

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCTS 946
           YLR+ +ATS EKST+    GKLNAV          ++  P                    
Sbjct: 905 YLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAID 962

Query: 947 DTECEVCQ 954
           + +CE CQ
Sbjct: 963 EPDCEACQ 970


>gi|66046946|ref|YP_236787.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. syringae B728a]
 gi|63257653|gb|AAY38749.1| Ribonucleoside-diphosphate reductase [Pseudomonas syringae pv.
           syringae B728a]
          Length = 970

 Score =  990 bits (2560), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/977 (56%), Positives = 698/977 (71%), Gaps = 33/977 (3%)

Query: 3   PSKDVNKGDEDAFPS-------LAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFM 55
            +    +      P        L+   P +   ++VIKRNG V  +   KI+ AI KAF+
Sbjct: 2   QTDTTRENSPTGAPQPSQTQQDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFL 58

Query: 56  AVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKIT 115
           AVEG  A+ S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ 
Sbjct: 59  AVEGGNAAASSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVA 118

Query: 116 REYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD 175
           R+YV+YR+ R+  RA ++  +      P ++I   DG+    +  RL  IV EAC GL +
Sbjct: 119 RDYVIYRDSRAKERAVRTPEEQVQ-AHPSIRITRADGSFAPLDMGRLNTIVTEACEGLAE 177

Query: 176 VSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTT 235
           V + ++ +ET KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  
Sbjct: 178 VDADLIQTETLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG- 236

Query: 236 VYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEY 295
                  ATHHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F Y
Sbjct: 237 FLGVADSATHHEMADLYAKALPAYVTAGIKFELLNPVLAEFDLEKLGKAINHERDQQFTY 296

Query: 296 LGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCST 355
           LGLQ LYDRYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M ST
Sbjct: 297 LGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSST 356

Query: 356 PTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIH 415
           PTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I 
Sbjct: 357 PTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIK 416

Query: 416 GTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRR 475
           GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRR
Sbjct: 417 GTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRR 476

Query: 476 THDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEI 534
           THDMNTANWIPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE+YE      G+I
Sbjct: 477 THDMNTANWIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEHYEALTEYPGKI 536

Query: 535 KVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSS 594
           K+F+ I A  LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ 
Sbjct: 537 KLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNK 596

Query: 595 EETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           +E AVCNLGSINL  H  + + D DKL  T+  AVR+LDNVIDIN +++ +AK SN  HR
Sbjct: 597 DEIAVCNLGSINLPNHIVDGKLDTDKLKRTVDVAVRMLDNVIDINYYSVPQAKNSNLRHR 656

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GS
Sbjct: 657 PVGLGIMGFQDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASCDLADERGAYETFQGS 716

Query: 715 LWDQGVFPIDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
           LW +G+ P+DS  +L E R    ++++    L W  ++ RV+  G+RNSN MAIAPTATI
Sbjct: 717 LWSKGILPLDSQQILIEQRGEKYISVDLKETLDWAPVRARVQK-GIRNSNIMAIAPTATI 775

Query: 773 ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
           ANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+ 
Sbjct: 776 ANITGVSQSIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQ 835

Query: 833 NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
            IERIP +LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR A
Sbjct: 836 QIERIPQELKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMA 895

Query: 893 WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------- 942
           W  GLKTTYYLR+ +ATS EKST+    GKLNAV          ++  P           
Sbjct: 896 WYRGLKTTYYLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPA 953

Query: 943 -----SCTSDTECEVCQ 954
                    + +CE CQ
Sbjct: 954 PVPKACAIDEPDCEACQ 970


>gi|186477387|ref|YP_001858857.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           phymatum STM815]
 gi|184193846|gb|ACC71811.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           phymatum STM815]
          Length = 997

 Score =  990 bits (2559), Expect = 0.0,   Method: Composition-based stats.
 Identities = 558/999 (55%), Positives = 702/999 (70%), Gaps = 65/999 (6%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P + + +G +   P   Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 18  RPVEGLAQGADALAPQTGY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 71

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM++G H + R YVLY
Sbjct: 72  GAASARVRELVEQLTQNVVRALVRSRPNGGTFHIEDIQDQVELALMRTGEHNVARAYVLY 131

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKI 180
           RE+R+  R      + DAP+A  L +  D+G     +   L  ++E AC+ L D V+++ 
Sbjct: 132 REKRTQER----GHEVDAPVASGLNVT-DNGVTRPLDMAALRGLIESACANLGDAVNAEP 186

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VT+R LL  +RRE+L       
Sbjct: 187 IVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTSRILLHTIRREIL------E 240

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           ++ T  EM   Y EYF  +I+ GV A LL + ++ FDL  L   L   RD  F YLGLQ 
Sbjct: 241 EEVTQAEMAGRYAEYFPLFIKRGVNAELLDDKLLQFDLKRLGAALDANRDLQFGYLGLQT 300

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLHI+G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFN
Sbjct: 301 LYDRYFLHIDGTRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLFN 360

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGTR  QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGK
Sbjct: 361 SGTRRSQLSSCYLTTVDDDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGK 420

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 421 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMN 480

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+KI
Sbjct: 481 TANWIPDLFMKRVLEGGDWTLFSPSTCPDLHDKFGAEFEAAYTAYEDKVARGEIKLFKKI 540

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVC
Sbjct: 541 PAAQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVC 600

Query: 601 NLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRA 655
           NLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  HR 
Sbjct: 601 NLGSVNLVAHLKEQADGTLALDHDKLKRTISVAMRMLDNVIDINYYAVAKARNSNLKHRP 660

Query: 656 IGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSL 715
           +G+G+MGFQ  LH+L  PYAS EAVE AD SME + ++A  AS ELA+ERG YS+++GSL
Sbjct: 661 VGMGIMGFQDCLHVLRTPYASQEAVEFADRSMEAVCYYAYWASTELAEERGRYSTYRGSL 720

Query: 716 WDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
           WD+G+ P D++ LLA+ R   + ++ +  + W  L+ R+ T GMRNSNC+AIAPTATI+N
Sbjct: 721 WDRGILPQDTLKLLADARGGYVEVDSSESMDWASLRSRIATHGMRNSNCVAIAPTATISN 780

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           I GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DGS+  I
Sbjct: 781 IIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKARGLWDEVMVADLKYFDGSLSRI 840

Query: 835 ERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWL 894
           +R+P DL+ I+ATAFE+D  WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL
Sbjct: 841 DRVPADLRAIYATAFEVDATWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWL 900

Query: 895 MGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTD------------------------ 930
            GLKTTYYLR+ +AT VEKST+    G LNAVP  D                        
Sbjct: 901 RGLKTTYYLRTMAATHVEKSTV--AHGALNAVPSGDGGAGSFGVGGGAASSGTKGGFQAS 958

Query: 931 ---------PNSSTHSLGIPSSCTSDT------ECEVCQ 954
                    P            C          ECE CQ
Sbjct: 959 AASAAATSVPAVEAAPEADGPVCMMRPGDPGFEECEACQ 997


>gi|194290771|ref|YP_002006678.1| ribonucleotide-diphosphate reductase subunit alpha [Cupriavidus
           taiwanensis LMG 19424]
 gi|193224606|emb|CAQ70617.1| Ribonucleoside-diphosphate reductase alpha subunit [Cupriavidus
           taiwanensis LMG 19424]
          Length = 979

 Score =  990 bits (2559), Expect = 0.0,   Method: Composition-based stats.
 Identities = 562/978 (57%), Positives = 700/978 (71%), Gaps = 35/978 (3%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGV---QVIKRNGGVTSFDPSKISRAIMKAFMAVEGK 60
           +     G     P+               ++I+RNG V +F+PSKI+ A+ KAF+AV G 
Sbjct: 10  TGGAAAGVASQAPTTQQTPSAATSNYPDHKIIRRNGAVVAFEPSKIAVAMTKAFLAVNGG 69

Query: 61  GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL 120
             + S RV++I++ LT+  V  L++   S   +HIED+QDQVE SLM+SG H++ R YVL
Sbjct: 70  QGAASARVREIVEQLTDNVVRALVRSRPSGGAIHIEDVQDQVELSLMRSGEHEVARAYVL 129

Query: 121 YREERSDVRAAQSHSKSDAPIAPKLKIMMDD-GTLISFNSKRLEMIVEEACSGLQD-VSS 178
           YRE+R   RA+ S           + I + D G     +   L  +++ ACSGL D VS+
Sbjct: 130 YREKRKAERASASAQAVARVQEAGISINVTDAGVTKPLDIVALHALIDNACSGLGDAVSA 189

Query: 179 KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYK 238
           + +L ET KN+Y+G+  + +  + I ++RTLIEK+P+Y++VTAR LL  +R+E+L T   
Sbjct: 190 EPILKETLKNLYEGVPMTQVYDSAILAARTLIEKDPDYSQVTARILLHTIRKEILGT--- 246

Query: 239 KPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGL 298
              + T  EM   Y EYF ++I  G+ A LL E +  FDL  L   L   RDF F YLGL
Sbjct: 247 ---EVTQAEMATRYAEYFPKFIARGIAAELLDEKLATFDLARLGAALDAGRDFQFNYLGL 303

Query: 299 QILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTL 358
           Q LYDRYFLHI+ +RIEMPQAFFMRVAMGLAL E ++E RA+EFY LLSSF FM STPTL
Sbjct: 304 QTLYDRYFLHIDETRIEMPQAFFMRVAMGLALNEKDREARAIEFYQLLSSFDFMSSTPTL 363

Query: 359 FNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTN 418
           FNSGT+  QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTN
Sbjct: 364 FNSGTQRSQLSSCYLTTVSDDLEGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTN 423

Query: 419 GKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHD 478
           GKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHD
Sbjct: 424 GKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHD 483

Query: 479 MNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFR 538
           MNTANWIPDLFMKRV +NA WTLFSP    DLHD  GK FE AY  YE +A  GE+K+F+
Sbjct: 484 MNTANWIPDLFMKRVMENAEWTLFSPSTCPDLHDKVGKAFEKAYLGYEAKAANGELKLFK 543

Query: 539 KISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA 598
           K+ A+ LWRKML MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E A
Sbjct: 544 KVPAMQLWRKMLGMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIA 603

Query: 599 VCNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTH 653
           VCNLGS+NL+AH A         D+ KL  TIRTA+R+LDNVIDIN + +EKA+ SN  H
Sbjct: 604 VCNLGSVNLVAHLAKQADGSYALDHAKLQKTIRTAMRMLDNVIDINYYAVEKARNSNLRH 663

Query: 654 RAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKG 713
           R +G+G+MGFQ  LH+L  PY+S  AV+ AD SME + ++A  AS ELA+ERG Y ++ G
Sbjct: 664 RPVGMGIMGFQDCLHVLRTPYSSDAAVKFADTSMEAVCYYAYQASTELAEERGRYETYTG 723

Query: 714 SLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
           SLWD+G+ P DS+ LLAE R   L ++ +S + W  L+ R+K  GMRNSNC+AIAPTATI
Sbjct: 724 SLWDRGILPQDSLKLLAEERGGYLDVDMSSSMDWTSLRARIKQHGMRNSNCIAIAPTATI 783

Query: 773 ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
           +NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DGS+ 
Sbjct: 784 SNIIGVSACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKERGLWDEVMVADLKYFDGSLS 843

Query: 833 NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
            I+RIP DL+ I+ATAFE++P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ A
Sbjct: 844 RIDRIPQDLRDIYATAFEVEPTWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLA 903

Query: 893 WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSS----------THSLGIPS 942
           WL GLKTTYYLR+ +AT VEKST+    G LNAV     + S                 +
Sbjct: 904 WLRGLKTTYYLRTMAATHVEKSTVSR--GSLNAVSSGSDSGSALDAAAASAPAMPEAEGA 961

Query: 943 SCTSDT------ECEVCQ 954
            CT         ECE CQ
Sbjct: 962 VCTMRPGDPGFEECEACQ 979


>gi|71734708|ref|YP_275880.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|71555261|gb|AAZ34472.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           syringae pv. phaseolicola 1448A]
          Length = 970

 Score =  989 bits (2557), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/969 (56%), Positives = 693/969 (71%), Gaps = 26/969 (2%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           S             L+   P +   ++VIKRNG V  +   KI+ AI KAF+AVEG  A+
Sbjct: 10  SPTGAPQASQTPQDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAA 66

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+
Sbjct: 67  ASSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRD 126

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLS 183
            R+  RA ++         P ++I + DG+    +  RL  IV EAC  L +V + ++ +
Sbjct: 127 SRAKERAVRAPEDQVQ-AHPSIRITLADGSFAPLDMGRLNTIVTEACESLAEVDANLIQT 185

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
           ET KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         A
Sbjct: 186 ETLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSA 244

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           THHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F YLGLQ LYD
Sbjct: 245 THHEMADLYAKALPAYVATGIKFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYD 304

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 305 RYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGT 364

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 365 LRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 424

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 425 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTAN 484

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISA 542
           WIPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G++K+F+ I A
Sbjct: 485 WIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQA 544

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNL
Sbjct: 545 KDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNL 604

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GSINL  H  N + D DKL  T+  AVR+LDNVIDIN +++ +AK SN  HR +GLG+MG
Sbjct: 605 GSINLPNHIVNGKLDTDKLKRTVDVAVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMG 664

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW +G+ P
Sbjct: 665 FQDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILP 724

Query: 723 IDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           +DS  +L E R    + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQ
Sbjct: 725 LDSQQILIEQRGEKYIDVDLKETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQ 783

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +
Sbjct: 784 SIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQE 843

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTT
Sbjct: 844 LKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTT 903

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCT 945
           YYLR+ +ATS EKST+    GKLNAV          ++  P                   
Sbjct: 904 YYLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAI 961

Query: 946 SDTECEVCQ 954
            + +CE CQ
Sbjct: 962 DEPDCEACQ 970


>gi|299134881|ref|ZP_07028073.1| ribonucleoside-diphosphate reductase, alpha subunit [Afipia sp.
           1NLS2]
 gi|298590691|gb|EFI50894.1| ribonucleoside-diphosphate reductase, alpha subunit [Afipia sp.
           1NLS2]
          Length = 967

 Score =  989 bits (2557), Expect = 0.0,   Method: Composition-based stats.
 Identities = 609/953 (63%), Positives = 737/953 (77%), Gaps = 16/953 (1%)

Query: 12  EDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDI 71
           +   PS + P       +Q+I+RNG V+ FDPSKIS A+ KAF+AVEG  A+ S RV + 
Sbjct: 21  DSLAPSPSEPA------MQIIRRNGTVSRFDPSKISIAMTKAFLAVEGHTAAASRRVHEA 74

Query: 72  IKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA 131
           ++ LT++ V  L +        HIED+QDQVE +LM+S HHK+ R YVLYREER+  RAA
Sbjct: 75  VEQLTQEVVGTLTRRLGEGRTFHIEDVQDQVELALMRSEHHKVARAYVLYREERARERAA 134

Query: 132 QSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYD 191
              S + +   P L++ + +G  +  + KR E+I+ EAC GL  V    VL+E  +N+YD
Sbjct: 135 DRASTTVSSNEPTLQMTLANGARVPLDLKRFELIIREACEGLDAVDPAPVLAEARRNLYD 194

Query: 192 GLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCL 251
           G+S+ +L  A I ++RTL+E+EPNYA V+AR LL+KLR EVL+ V+  P  A+  +M   
Sbjct: 195 GISQDELALASIMAARTLVEQEPNYAYVSARLLLDKLRSEVLSFVHGTPTSASQSDMATR 254

Query: 252 YPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHING 311
           Y EYF  YI+ G++A LL   +   DL  LA+ LK ERD  F++LGLQ LYDRYFLH++G
Sbjct: 255 YAEYFPAYIKTGIEAELLDPELGRHDLARLASALKPERDMLFQFLGLQTLYDRYFLHVHG 314

Query: 312 SRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSC 371
           +RIE+PQAFFMRVAMGLA++E ++E RA+EFYNLLSSF FM STPTLFNSGT  PQLSSC
Sbjct: 315 ARIELPQAFFMRVAMGLAMREIDREGRAIEFYNLLSSFDFMASTPTLFNSGTLRPQLSSC 374

Query: 372 FLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVA 431
           FLTTV DDL GIF A+++NA+LAKYSGGLGNDWTPVRGLGAHI GTNG+SQGV+PFLKVA
Sbjct: 375 FLTTVADDLDGIFKAVKDNALLAKYSGGLGNDWTPVRGLGAHIKGTNGESQGVVPFLKVA 434

Query: 432 NDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMK 491
           NDTA+AVNQGGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRRRTHDMNTANW+PDLFM+
Sbjct: 435 NDTAIAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLFMQ 494

Query: 492 RVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLT 551
           RV Q+  WTLFSPDE  +LHDLYG  F+ AYE YE +A RGE++VF+++ A  LWR+MLT
Sbjct: 495 RVEQDGEWTLFSPDETPELHDLYGPRFKAAYEAYEAKAARGEMRVFKQVRATDLWRRMLT 554

Query: 552 MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF 611
           MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S++E AVCNLGSINLL H 
Sbjct: 555 MLFETGHPWITFKDPCNLRSPQQHVGVVHSSNLCTEITLNTSADEVAVCNLGSINLLNHT 614

Query: 612 ANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLH 671
                D +KL  TI TAVR+LDNVIDIN +TI +A++SN  HR +GLGLMGFQ ALH+  
Sbjct: 615 TREGLDQNKLKRTITTAVRMLDNVIDINFYTIPEARRSNLKHRPVGLGLMGFQDALHVQR 674

Query: 672 IPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAE 731
           IP AS  AV  AD SME IS+HAISAS +LA ERG Y SF GSLW QG+ PIDS+ +L++
Sbjct: 675 IPIASEAAVAFADASMEIISYHAISASADLAVERGRYPSFDGSLWSQGILPIDSVAVLSK 734

Query: 732 VRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYV 791
            RD  A+N +  L W  L++RV+  GMRNSN MAIAPTATI+NICGV+QSI+PSYQNL+V
Sbjct: 735 SRDGTALNASMTLDWTGLRERVRKDGMRNSNVMAIAPTATISNICGVAQSIEPSYQNLFV 794

Query: 792 KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEI 851
           KSNMSGDFTVVN  LV +LK R LWDE M+SDLKY DGS+G I+R+PDDLK ++ATAFE+
Sbjct: 795 KSNMSGDFTVVNEHLVRDLKSRGLWDEVMVSDLKYFDGSVGQIDRVPDDLKALYATAFEV 854

Query: 852 DPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSV 911
           D  WLIESA+RRQKWIDQAQSLNLY+  PSGKKLD +YR AW +GLKTTYYLRSRSAT V
Sbjct: 855 DTSWLIESAARRQKWIDQAQSLNLYIANPSGKKLDQLYRLAWQLGLKTTYYLRSRSATHV 914

Query: 912 EKSTLKGVDGKLNAVPVTD---------PNSSTHSLGIPSSCTSD-TECEVCQ 954
           EKSTLKG DGKLNAV  +          PN++   L    +C+ D  +CE CQ
Sbjct: 915 EKSTLKGTDGKLNAVSASGMLAHAPIIVPNATAPDLDGVKACSIDNPDCEACQ 967


>gi|329893651|ref|ZP_08269785.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [gamma proteobacterium IMCC3088]
 gi|328923578|gb|EGG30890.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [gamma proteobacterium IMCC3088]
          Length = 922

 Score =  988 bits (2555), Expect = 0.0,   Method: Composition-based stats.
 Identities = 558/926 (60%), Positives = 694/926 (74%), Gaps = 8/926 (0%)

Query: 32  IKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSAL 91
           IKRNG V  FD SKIS AI KAF+AVEG  A+ S R+ + +  LT Q +    +   S  
Sbjct: 2   IKRNGQVVPFDNSKISVAITKAFLAVEGGTAAASSRIHETVAKLTTQVMGTFERRMPSGG 61

Query: 92  IVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP-IAPKLKIMMD 150
            +HIEDIQDQVE +LM++G HKI R+YV+YREE++  RA +    ++A   A  + ++  
Sbjct: 62  TIHIEDIQDQVELALMRAGEHKIARDYVIYREEQARKRAQKRALSAEAERAAGAISVLQP 121

Query: 151 DGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLI 210
           DG+    + +RL+ +V EAC+ L DVS+  +L E  +N+YDG++  ++ T+L+ ++RTLI
Sbjct: 122 DGSRAPLDIERLQTVVSEACADLADVSASKILEEALRNLYDGVTLDEVTTSLVITARTLI 181

Query: 211 EKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLH 270
           E+EPNY    AR L + LR E L       Q+AT  EM   YP+    YI +G++  LL 
Sbjct: 182 EQEPNYTYAAARLLCDDLRSEAL-EFLGVTQRATQQEMALYYPQALQAYIAKGIQLELLS 240

Query: 271 ESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLAL 330
             + DFD+  L   ++ ERD  F YLGLQ LYDRYF+H N +R E+PQ FFMR+AMGLA+
Sbjct: 241 PELADFDIARLGAAIQPERDLQFTYLGLQTLYDRYFIHSNETRFELPQVFFMRIAMGLAV 300

Query: 331 KETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQEN 390
           +E +K  RA+EFY LLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+GA+++N
Sbjct: 301 REDDKNARAIEFYQLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYGAIRDN 360

Query: 391 AMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCA 450
           A+L+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAVCA
Sbjct: 361 ALLSKWAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCA 420

Query: 451 YLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDL 510
           YLETWH+D+EEFL+LRKNTGDDRRRTHDMN+ANWIPDLFMKRV +   WTLFSP++  DL
Sbjct: 421 YLETWHLDIEEFLELRKNTGDDRRRTHDMNSANWIPDLFMKRVFEGGEWTLFSPNDTPDL 480

Query: 511 HDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIR 570
           HD YG +FE  YE YE Q   GE+K+F+++ A  LWRKML MLFETGHPWITFKDPCN+R
Sbjct: 481 HDSYGADFEAKYEAYEAQTRSGELKLFKRVKAENLWRKMLGMLFETGHPWITFKDPCNLR 540

Query: 571 SPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVR 630
           SPQ HVGVVHSSNLCTEITLN+S EE AVCNLGS+NL  H   N  + +KL  T+ TAVR
Sbjct: 541 SPQSHVGVVHSSNLCTEITLNTSDEEIAVCNLGSVNLPQHIDENGLNLEKLQKTVTTAVR 600

Query: 631 VLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFI 690
           +LDNVIDIN +++ +A++SN  HR +GLGLMGFQ AL+  HI Y+SPEAVE AD SME I
Sbjct: 601 MLDNVIDINYYSVPQAERSNFRHRPVGLGLMGFQDALYKQHIAYSSPEAVEFADRSMEAI 660

Query: 691 SFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD--ELAMNRTSRLPWDE 748
           S++AI AS  LA+ERG YSSF+GSLW QG+ PIDS+  LAE R    L ++RT  L WD 
Sbjct: 661 SYYAIQASSALAEERGTYSSFEGSLWSQGILPIDSLERLAESRGDQYLQIDRTQTLDWDT 720

Query: 749 LKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVN 808
           L++RV+  GMRNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTVVN +LVN
Sbjct: 721 LRERVRAKGMRNSNVMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVVNPYLVN 780

Query: 809 ELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWID 868
           +LK R+LWD+ M++DLKY+DGS   I+RIP DLK I++TAFE++P W++E+ASRRQKWID
Sbjct: 781 DLKARNLWDKVMVNDLKYYDGSAQAIDRIPADLKAIYSTAFEVEPRWIVEAASRRQKWID 840

Query: 869 QAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPV 928
           QAQSLNLY++  SGKKLD  YR AWL GLKTTYYLRS +AT  EKST+    G LNAV  
Sbjct: 841 QAQSLNLYINNASGKKLDVTYRMAWLSGLKTTYYLRSLAATGTEKSTVD--KGTLNAVAA 898

Query: 929 TDPNSSTHSLGIPSSCTSDTECEVCQ 954
                             D +CE CQ
Sbjct: 899 AAAPQPAPVPKA--CSLDDPDCEACQ 922


>gi|152979866|ref|YP_001354669.1| ribonucleotide-diphosphate reductase subunit alpha
           [Janthinobacterium sp. Marseille]
 gi|151279943|gb|ABR88353.1| ribonucleoside-diphosphate reductase alpha chain [Janthinobacterium
           sp. Marseille]
          Length = 963

 Score =  987 bits (2551), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/960 (57%), Positives = 691/960 (71%), Gaps = 16/960 (1%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P++  N       PS +      +   ++I+RNG V  F+PSKIS A+ KAF+AV G   
Sbjct: 12  PTEIGNIASLAVAPSTSNTQTVGLGEHRIIRRNGAVVGFEPSKISIAVTKAFLAVNGGQG 71

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S RV+++++ LT   V  L++   +    HIEDIQDQVE +LM+SG H + R YVLYR
Sbjct: 72  AASARVRELVEQLTSNVVNALVRRQPAGGTFHIEDIQDQVELALMRSGEHDVARAYVLYR 131

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIV 181
            +R + RA Q  +K  A    +L +  +DG     +  ++  ++  AC GL+  V ++ +
Sbjct: 132 AKRMEERAQQQAAKPVAETH-QLHVT-EDGQRRPLDMNQVRDLINAACIGLEKHVDAEAI 189

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           L ET KN+YDG+   +L  + I ++R L+EK+P Y+ VTAR L+  +R+EV         
Sbjct: 190 LHETVKNLYDGVPVEELHKSAILAARALMEKDPAYSTVTARLLMHTIRKEVFG------L 243

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           +    +    Y EYF ++I++G++A LL   +  FDL  L + L  ERD  F YLGLQ L
Sbjct: 244 EVAQADAPAQYLEYFPKFIKKGIEAELLDAKLGQFDLKKLGDALVPERDLQFGYLGLQTL 303

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLHI  +RIEMPQAF+MRVAMGLAL E  +E+RA+EFYNLLSSF FM STPTLFNS
Sbjct: 304 YDRYFLHIRDTRIEMPQAFYMRVAMGLALNEINREERAIEFYNLLSSFDFMSSTPTLFNS 363

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT+  QLSSC+LTTV DDL GI+ A++ENA+LAKY+GGLGNDWTPVR LGAHI GTNG+S
Sbjct: 364 GTQRSQLSSCYLTTVADDLDGIYEAIKENALLAKYAGGLGNDWTPVRSLGAHIKGTNGRS 423

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNT
Sbjct: 424 QGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLDLRKNTGDDRRRTHDMNT 483

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFMKRV +   WTLFSP +  DLHD  GK FE AY  YE +A RGE+K+F+KI 
Sbjct: 484 ANWIPDLFMKRVMEKGEWTLFSPSDAPDLHDKVGKAFEAAYTGYEAKAARGELKLFKKIQ 543

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A+ LWRKML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCN
Sbjct: 544 ALDLWRKMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCN 603

Query: 602 LGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLM 661
           LGS+N+ AH  + Q D+ KL  T+RTA+R+LDNVIDIN + ++KA+ SN  HR +GLG+M
Sbjct: 604 LGSVNMPAHMKDGQLDHVKLQKTVRTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGIM 663

Query: 662 GFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVF 721
           GFQ  LH++ IPYAS EAV+ AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ 
Sbjct: 664 GFQDCLHMMRIPYASDEAVQFADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGIL 723

Query: 722 PIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           P DS+ LL E R   L  + T  L W  L++R+K  GMRNSNC+AIAPTATI+NI GVS 
Sbjct: 724 PQDSLKLLQEERGGYLEADLTETLDWTPLRERIKQFGMRNSNCVAIAPTATISNIIGVSA 783

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
            I+P+YQNLYVKSN+SG+FT +N +LV +LK R LWDE MISDLKY DGS+  I+RIP D
Sbjct: 784 CIEPTYQNLYVKSNLSGEFTEINEYLVRDLKARGLWDEVMISDLKYFDGSLAKIDRIPQD 843

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           L+ I++TAFE++P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTT
Sbjct: 844 LRDIYSTAFEVEPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTT 903

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDT------ECEVCQ 954
           YYLR+  AT  EKST K               +   +     +C          ECE CQ
Sbjct: 904 YYLRTMGATHTEKSTSKTGALNAVDSGAPSSAAQAAAETDGPACMLRPGDAGFEECEACQ 963


>gi|330980157|gb|EGH78343.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 971

 Score =  987 bits (2551), Expect = 0.0,   Method: Composition-based stats.
 Identities = 549/969 (56%), Positives = 694/969 (71%), Gaps = 24/969 (2%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           ++   G   A  +           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ 
Sbjct: 8   ENSPTGAPQASQTQQDLSATAPGQLRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAA 67

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ 
Sbjct: 68  SSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDS 127

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE 184
           R+  RA ++  +      P ++I   DG+    +  RL  IV EAC GL +V + ++ +E
Sbjct: 128 RAKERAVRAPEEQVQ-AHPSIRITRADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQTE 186

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L         AT
Sbjct: 187 TLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG-FLGVADSAT 245

Query: 245 HHEMQCLYPEYFCRYIEEG-VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           HHEM  LY +    Y+    +K  LL+  + +FDL  L   + +ERD  F YLGLQ LYD
Sbjct: 246 HHEMADLYAKALPAYVTPAGIKFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYD 305

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+GT
Sbjct: 306 RYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGT 365

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
             PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQG
Sbjct: 366 LRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQG 425

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 426 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTAN 485

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEIKVFRKISA 542
           WIPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G+IK+F+ I A
Sbjct: 486 WIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQA 545

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNL
Sbjct: 546 KDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNL 605

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GSINL  H  + + D DKL  T+  AVR+LDNVIDIN +++ +AK SN  HR +GLG+MG
Sbjct: 606 GSINLPNHIVDGKLDTDKLKRTVDVAVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMG 665

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GSLW +G+ P
Sbjct: 666 FQDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILP 725

Query: 723 IDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           +DS  +L E R    ++++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQ
Sbjct: 726 LDSQQILIEQRGEKYISVDLKETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQ 784

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +
Sbjct: 785 SIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQE 844

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTT
Sbjct: 845 LKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTT 904

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS---------------SCT 945
           YYLR+ +ATS EKST+    GKLNAV          ++  P                   
Sbjct: 905 YYLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAI 962

Query: 946 SDTECEVCQ 954
            + +CE CQ
Sbjct: 963 DEPDCEACQ 971


>gi|83719828|ref|YP_441700.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           thailandensis E264]
 gi|257137869|ref|ZP_05586131.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           thailandensis E264]
 gi|83653653|gb|ABC37716.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           thailandensis E264]
          Length = 995

 Score =  987 bits (2551), Expect = 0.0,   Method: Composition-based stats.
 Identities = 555/994 (55%), Positives = 702/994 (70%), Gaps = 56/994 (5%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLAGGAQGAPALASQATY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQTVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A   +  ++P    + +  D+G + + +   L  ++  AC GL D VS +
Sbjct: 131 REKRHLERVHAGEAAAVESPTGGSINVT-DNGVMRALDLNALRALIVSACEGLGDAVSPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMTQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMSTRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+++K
Sbjct: 484 NTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLYKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGSYALDEEKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS EAVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASDEAVEFADRSMEAVCYYAYWASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPALRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPN--------------------- 932
           L GLKTTYYLR+ +AT VEKST+    G LNAVP +                        
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTSGGTSGGAAGGAQGAAGGFGATGGD 961

Query: 933 ------SSTHSLGIPSSCTSDT------ECEVCQ 954
                 ++         CT         ECE CQ
Sbjct: 962 APSGAMNAAPIEADGPVCTMRPGDPGFEECEACQ 995


>gi|82703583|ref|YP_413149.1| ribonucleotide-diphosphate reductase subunit alpha [Nitrosospira
           multiformis ATCC 25196]
 gi|82411648|gb|ABB75757.1| Ribonucleoside-diphosphate reductase [Nitrosospira multiformis ATCC
           25196]
          Length = 956

 Score =  987 bits (2550), Expect = 0.0,   Method: Composition-based stats.
 Identities = 546/960 (56%), Positives = 701/960 (73%), Gaps = 20/960 (2%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P   +   +  + PS   P   +    ++I+RNG V  F+P+KIS A+ KAF+AVEG   
Sbjct: 9   PRPAMAGYEFSSNPSGHDP---RYSQYKIIRRNGSVAGFEPNKISIAMTKAFLAVEGSQG 65

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S RV++++  LTE  V  L++   S    HIEDIQDQVE +LM+SG H + R YVLYR
Sbjct: 66  AASARVREVVARLTEDVVNALMRRQPSGGTFHIEDIQDQVELALMRSGEHDVARAYVLYR 125

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIV 181
           E+R+  RA Q  + +       L ++ +DG  +  ++ RL  ++   C GL + V   ++
Sbjct: 126 EDRARKRAQQKEAGAAEAAGSVLNVL-EDGRRVPLDTARLLALIGSCCEGLGEGVDPALI 184

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           L  T K++YDG+   ++  ++I S+R L+EKEP Y+ VTAR LL  LR EVL       +
Sbjct: 185 LKATLKDLYDGVPMEEVRKSVILSARALLEKEPAYSYVTARLLLHSLRFEVLG------E 238

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           +    EM   Y EYF  +I+ G++A LL E +  FDL  LA  L  ERD  F YLGLQ L
Sbjct: 239 EIVQREMAGRYMEYFPAFIKRGIEAELLDERLAQFDLPRLAQALHAERDLKFGYLGLQTL 298

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLHI   RIE+PQAFFMRVAMGLAL E ++E RA+EFY++LS+F FM STPTLFNS
Sbjct: 299 YDRYFLHIQERRIELPQAFFMRVAMGLALNEIDREARAIEFYHVLSNFDFMSSTPTLFNS 358

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GTR  QLSSC+LTTVPDDL GI+  ++ENA+LAKY+GGLGNDWT VR +G+HI GTNGKS
Sbjct: 359 GTRRSQLSSCYLTTVPDDLDGIYEGIKENALLAKYAGGLGNDWTRVRAMGSHIKGTNGKS 418

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV +DTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNT
Sbjct: 419 QGVVPFLKVVSDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNT 478

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           A W+PDLFMKRV +   WTLFSP +V DLH+ YGK FE AY  YE +  RGE+ +++ I 
Sbjct: 479 ATWVPDLFMKRVMEGGEWTLFSPSDVPDLHEKYGKAFEQAYLAYEDKVARGELDLYKTIP 538

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           AV LWRKML+MLFETGHPWITFKD CNIRSPQ H+GVVHSSNLCTEITLN++ +E AVCN
Sbjct: 539 AVQLWRKMLSMLFETGHPWITFKDACNIRSPQNHIGVVHSSNLCTEITLNTNDQEIAVCN 598

Query: 602 LGSINLLAHFANNQF-DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           LGSINL AH  +    D DKL  T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+
Sbjct: 599 LGSINLAAHIDDGGKLDADKLKRTVSLAMRMLDNVIDINFYAVAKARNSNLRHRPVGLGI 658

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ  LH + IPYAS EAVE AD +ME +++HA  AS ELA+ERG Y+S++GSLWD+G+
Sbjct: 659 MGFQDCLHRMRIPYASDEAVEFADRTMEAMAYHAYWASTELAEERGRYASYRGSLWDRGI 718

Query: 721 FPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
            P D++ LL E R   +  +R+S L W+ L++R++  GMRNSNC+AIAPTATI+NI GVS
Sbjct: 719 LPQDTLDLLQEERGGYIEADRSSTLDWEALRERIRNHGMRNSNCLAIAPTATISNIVGVS 778

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
            SI+P+++NLYVKSN+SG+FT+ N +LV++LK+  LWDE MISD+KY DG++G I+R+P 
Sbjct: 779 ASIEPTFKNLYVKSNLSGEFTIANQYLVSDLKKLGLWDEVMISDIKYFDGALGKIDRVPT 838

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
           +L+K++ATAFE++P WLIE+A+RRQKWIDQ+QSLN+Y+   SGKKLD  Y+ AW+ GLKT
Sbjct: 839 ELRKLYATAFEVEPQWLIEAAARRQKWIDQSQSLNIYIASVSGKKLDETYKLAWVRGLKT 898

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS-----SCTSDTECEVCQ 954
           TYYLRS  ATS EKST++   G LNAVP      +  +  +P+         D ECE CQ
Sbjct: 899 TYYLRSLGATSAEKSTVQA--GSLNAVPAEGSLPAMGAAAVPATDVSFCSVDDPECESCQ 956


>gi|239813963|ref|YP_002942873.1| ribonucleotide-diphosphate reductase subunit alpha [Variovorax
           paradoxus S110]
 gi|239800540|gb|ACS17607.1| ribonucleoside-diphosphate reductase, alpha subunit [Variovorax
           paradoxus S110]
          Length = 971

 Score =  987 bits (2550), Expect = 0.0,   Method: Composition-based stats.
 Identities = 538/972 (55%), Positives = 701/972 (72%), Gaps = 35/972 (3%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           PS    +  +    +   P  + +   Q+I+RNG V  F+P+KI+ A+MKAF+AV G   
Sbjct: 15  PSTPTQQQRD----TAGSPAGQNLAHYQIIRRNGAVVPFEPNKIAIAMMKAFLAVHGTQG 70

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S  V++ +  LT+  +  +++        HIED+QDQVE  LM+ GHH+I R YVLYR
Sbjct: 71  AASASVRETVDALTQGVIRAMVRSRPGGGTFHIEDVQDQVELGLMRGGHHEIARAYVLYR 130

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIV 181
           E R+  R+     + +AP  P L ++ D+G  ++ +  +L+ ++E AC  L D +++  +
Sbjct: 131 ERRTQERS--KQVEQEAPATPTLHVL-DNGERVALDLNQLKGLIESACENLGDSITAAPI 187

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           ++ET +N+YDG+   ++  A I ++RTLIEK+P+Y   TAR LL  + +E++       +
Sbjct: 188 VAETMRNLYDGVPLDEVYKASILAARTLIEKDPDYTFATARLLLHTIFKEIIG------R 241

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           +    E    Y +YF ++I++GV+  LL E ++ +DL  L   LK ERD  F+YLGLQ L
Sbjct: 242 EVMPAERATAYADYFPQFIKKGVENDLLDEKLLQYDLPRLGAALKAERDNQFDYLGLQTL 301

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLH+  SRIE+PQAFFMRVAMGL+L E ++E RA+EFY +LSSF FM STPTLFN+
Sbjct: 302 YDRYFLHVRKSRIELPQAFFMRVAMGLSLGEIDREARAIEFYEVLSSFDFMSSTPTLFNA 361

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT   QLSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LG+HI GTNG+S
Sbjct: 362 GTLRSQLSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGSHIKGTNGES 421

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRTHDMNT
Sbjct: 422 QGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRTHDMNT 481

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFM+RV +   WTLFSP  V DLHDL+G +FE AY  YE +A RGEIK  R I 
Sbjct: 482 ANWIPDLFMRRVMEKGTWTLFSPSNVPDLHDLFGADFEKAYVAYEEKAARGEIKPARTIQ 541

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A  LWRKMLTMLFETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+S  ETAVCN
Sbjct: 542 ASDLWRKMLTMLFETGHPWITFKDACNVRSPQQHAGVVHSSNLCTEITLNTSDTETAVCN 601

Query: 602 LGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLM 661
           LGS+NLL H  + + D +KL  TI TA+R+LDNVIDIN + ++KA+ SN  HR +GLGLM
Sbjct: 602 LGSVNLLQHLKDGKVDQEKLKRTISTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGLM 661

Query: 662 GFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVF 721
           GFQ AL+ L IPYAS EAV+ ADESME I +HA  AS ELA+ERG YSS+KGSLWD+G+ 
Sbjct: 662 GFQDALYELRIPYASQEAVQFADESMEAICYHAYWASTELARERGKYSSYKGSLWDKGIL 721

Query: 722 PIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           PID++ LL + R   + ++R++ L W+ L++++K  GMRNSNC+AIAPTATI+NI GV  
Sbjct: 722 PIDTLDLLEKARGGYVEVDRSATLDWEALRQKIKADGMRNSNCVAIAPTATISNIIGVDA 781

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P + NL VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P D
Sbjct: 782 SIEPCFGNLSVKSNLSGEFTVINHYLVRDLKRLGLWDDVMVMDLKHFDGSLRPIDRVPQD 841

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           +K ++ATAFE++  WL+E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTT
Sbjct: 842 VKALYATAFEVETTWLVEAAARRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTT 901

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSST------------------HSLGIPS 942
           YYLR++SAT  EKST++   G+LNAV      SS                    +  I  
Sbjct: 902 YYLRTQSATHAEKSTVQ--SGRLNAVSSGSDASSGMSALEAAAAAAKAQMSAMPATDIAF 959

Query: 943 SCTSDTECEVCQ 954
               D  CE CQ
Sbjct: 960 CGVDDPTCEACQ 971


>gi|124268398|ref|YP_001022402.1| ribonucleotide-diphosphate reductase subunit alpha [Methylibium
           petroleiphilum PM1]
 gi|124261173|gb|ABM96167.1| Ribonucleoside-diphosphate reductase [Methylibium petroleiphilum
           PM1]
          Length = 971

 Score =  987 bits (2550), Expect = 0.0,   Method: Composition-based stats.
 Identities = 546/959 (56%), Positives = 698/959 (72%), Gaps = 32/959 (3%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           S A P      G Q+I+RNG V +F+P+KI+ A+MKAF+AV G   + S  V++++  LT
Sbjct: 24  SRAAPGSSAYAGYQIIRRNGAVVAFEPNKIAVALMKAFLAVHGTQGAASASVREMVDGLT 83

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           E  V  LL+        HIED+QD VE  LM+ GHH+I R YVLYRE R+  RA Q  + 
Sbjct: 84  ESVVRALLRSRPGGGTFHIEDVQDAVELGLMRGGHHEIARAYVLYRERRAQERAKQGAAP 143

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSE 195
               +A  L ++   G  +  ++ RL+ +VE AC+ L  +V +  +L+ET +N+YDG+  
Sbjct: 144 VTPAVA--LHVIDR-GQRVPLDTGRLQALVESACANLGSEVQAAPILAETQRNLYDGVPI 200

Query: 196 SDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEY 255
            ++  A I ++RTLIEK+P Y + TAR LL  +RRE+L        +  H EMQ  Y +Y
Sbjct: 201 DEVYKAAILAARTLIEKDPAYTRATARLLLHTIRREILG------GEVLHEEMQQRYADY 254

Query: 256 FCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIE 315
           F  +I++GV+A LL E +M +DL  L   LK +RD  F+YLGLQ LYDRYFLH+  +RIE
Sbjct: 255 FPGFIKQGVEAELLDERLMQYDLRRLGEALKADRDLQFDYLGLQTLYDRYFLHVRKARIE 314

Query: 316 MPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTT 375
           +PQAFFMRVAMGLAL E ++E RA+EFY +LSSF FM STPTLFNSGTR  QLSSC+LTT
Sbjct: 315 LPQAFFMRVAMGLALNEVDREARAIEFYEVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTT 374

Query: 376 VPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTA 435
           V DDL GI+ A++ENA+L+K++GGLGNDWTPVR LG+HI GTNG+SQGV+PFLKV NDTA
Sbjct: 375 VADDLDGIYEAIKENALLSKFAGGLGNDWTPVRALGSHIKGTNGESQGVVPFLKVVNDTA 434

Query: 436 VAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ 495
           VAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV +
Sbjct: 435 VAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMRRVIE 494

Query: 496 NAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFE 555
              WTLFSP    DLHD +G  FE AY  YE++ADRGE+K+++++ A  LWRKML+MLFE
Sbjct: 495 GGDWTLFSPSTCPDLHDKFGIAFEQAYTAYEQKADRGELKLYKRVPAKDLWRKMLSMLFE 554

Query: 556 TGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN- 614
           TGHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL  H  +  
Sbjct: 555 TGHPWITFKDACNVRSPQQHVGVVHSSNLCTEITLNTNGSEIAVCNLGSVNLAQHLMHGA 614

Query: 615 ---QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLH 671
              + D+ KL  T+ TA+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ +L+ L 
Sbjct: 615 EGLEIDHAKLRKTVSTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGVMGFQDSLYQLR 674

Query: 672 IPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAE 731
           I YAS +AVE AD SME + +HA  AS ELA+ERG YSS+KGSLWD+G+ PIDS+ LLAE
Sbjct: 675 IAYASQQAVEYADRSMEAVCYHAYWASTELAEERGRYSSYKGSLWDRGILPIDSLDLLAE 734

Query: 732 VR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
            R   + ++R++ L WD L+ R++  GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL 
Sbjct: 735 QRGGYVDVDRSTSLDWDALRARIQQHGMRNSNCVAIAPTATISNIIGVDASIEPSFSNLS 794

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P++LK ++ATAFE
Sbjct: 795 VKSNLSGEFTVINEYLVRDLKKLGLWDDVMVMDLKHFDGSLRRIDRVPEELKSLYATAFE 854

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++P WL+E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW  GLKTTYYLR+  AT 
Sbjct: 855 VEPTWLVEAAARRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWQRGLKTTYYLRTVGATH 914

Query: 911 VEKSTLKGVDGKLNAVPVTD---------------PNSSTHSLGIPSSCTSDTECEVCQ 954
            EKST+K   G LNAV                     SS  +  +      D  CE CQ
Sbjct: 915 AEKSTVKA--GHLNAVSSGSGGVDAVAAAAQAQFDAASSVPATDMKFCAIDDPTCEACQ 971


>gi|171463020|ref|YP_001797133.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171192558|gb|ACB43519.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 990

 Score =  986 bits (2549), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/958 (57%), Positives = 694/958 (72%), Gaps = 33/958 (3%)

Query: 21  PFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTV 80
               ++   ++I+RNG V +F+PSKI+ A+ KAF+AV G   + S RV++ ++ LT   V
Sbjct: 42  TQATQLSDYKIIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHSVV 101

Query: 81  TRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP 140
             LL+   +    HIEDIQDQVE +LM+SG H + R YVLYRE+R+  RAAQ     +  
Sbjct: 102 RALLRSRPNGGTFHIEDIQDQVELALMRSGEHNVARAYVLYREKRNQERAAQQEVSQEVQ 161

Query: 141 IAPK-----LKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLS 194
            A +     +K+  D+G     +   L  ++E AC GL   + +  +++ET KN+YDG+ 
Sbjct: 162 TANQAGESGIKVT-DNGVEKWLDMAALRTVMEAACEGLGTHIDASPIVTETIKNLYDGVP 220

Query: 195 ESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPE 254
            + +  + I +SRTLIEK+P Y++VTAR L+  + +E+L       ++    +MQ  Y  
Sbjct: 221 MAQVYDSAILASRTLIEKDPAYSQVTARILMHVIHKEILG------KEVLQGDMQAEYST 274

Query: 255 YFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRI 314
           YF +YI EG+ A LL   M +FDL  LA  L   RD  F YLGLQ LYDRYFLHI   RI
Sbjct: 275 YFAKYINEGISAELLDPRMREFDLPRLAAALNASRDLQFNYLGLQTLYDRYFLHIEDRRI 334

Query: 315 EMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLT 374
           EMPQAFFMRVAMGL+L E ++E+RA+EFY +LS+F FM STPTLFNS T  PQLSSC+LT
Sbjct: 335 EMPQAFFMRVAMGLSLNELDRERRAIEFYEILSTFDFMSSTPTLFNSATTRPQLSSCYLT 394

Query: 375 TVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDT 434
           TV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDT
Sbjct: 395 TVEDDLDGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDT 454

Query: 435 AVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVT 494
           AVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDM+T+NWIPDLFMKRV 
Sbjct: 455 AVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMSTSNWIPDLFMKRVM 514

Query: 495 QNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLF 554
           +N  WTLFSP    DLH  +GK FE AY  YE++ADRGE+K FR+I A  LWRKML MLF
Sbjct: 515 ENGEWTLFSPSNTPDLHGKFGKAFEEAYVAYEQKADRGELKPFRRIPAQQLWRKMLGMLF 574

Query: 555 ETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA-- 612
           ETGHPWITFKDPCNIRSPQQH+GVVHSSNLCTEITLN++ +E AVCNLGS+NL AH    
Sbjct: 575 ETGHPWITFKDPCNIRSPQQHIGVVHSSNLCTEITLNTNEDEIAVCNLGSVNLTAHMTTD 634

Query: 613 ---NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHL 669
                  D++KL  T+RTA+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LH+
Sbjct: 635 ANGKMILDHEKLQRTVRTAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHM 694

Query: 670 LHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLL 729
             IPYAS EAV+ AD SME + ++A  AS ELA+ERG YS++KGSLWD+G+ P DS+ LL
Sbjct: 695 QRIPYASDEAVKFADSSMEAVCYYAYQASNELAEERGVYSTYKGSLWDRGILPQDSVALL 754

Query: 730 AEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQN 788
           A  R   L ++ +S + W+ L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QN
Sbjct: 755 AAERGGYLEVDSSSTMDWNGLRARIKQYGMRNSNCVAIAPTATISNIIGVSACIEPTFQN 814

Query: 789 LYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATA 848
           L+VKSN+SG+FTVVN +LV +LK R LWDE MI+DLKY DG++  I+RIP DL+ ++ATA
Sbjct: 815 LFVKSNLSGEFTVVNEYLVRDLKDRGLWDEVMIADLKYFDGTLSKIDRIPQDLRDLYATA 874

Query: 849 FEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSA 908
           FE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+ +A
Sbjct: 875 FEVDPTWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTMAA 934

Query: 909 TSVEKSTLKGVDGKLNAVPVT------DPNSSTHSLGIPSSCTSDT------ECEVCQ 954
           T VEKST+    G+LNAV         D  ++         CT         ECE CQ
Sbjct: 935 THVEKSTV--ASGQLNAVSSGGGVNGTDAAAAGGVEADGPVCTMRPGDAGFEECEACQ 990


>gi|256822963|ref|YP_003146926.1| ribonucleoside-diphosphate reductase subunit alpha [Kangiella
           koreensis DSM 16069]
 gi|256796502|gb|ACV27158.1| ribonucleoside-diphosphate reductase, alpha subunit [Kangiella
           koreensis DSM 16069]
          Length = 957

 Score =  986 bits (2549), Expect = 0.0,   Method: Composition-based stats.
 Identities = 567/956 (59%), Positives = 720/956 (75%), Gaps = 12/956 (1%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
            S      +  + P +    P     ++VI+RNG VT +D SKI  A+ KAF+AVEG  A
Sbjct: 10  QSAAKTPTNTPSRPEIEATKPG---EIRVIRRNGKVTPYDDSKIEVAMTKAFLAVEGGAA 66

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S RV + ++ LT+Q      +      I+HIED+QDQVE +LM++G  K+ R YVLYR
Sbjct: 67  AASSRVHETVRQLTKQITDAFKRRMPGGGIIHIEDVQDQVELALMRNGEQKVARSYVLYR 126

Query: 123 EERSDVRAAQSHSKSDAPI-APKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIV 181
           EERS  RAA+  +K DA +   ++ + ++DG+    + +RL  +V EAC  L DV    +
Sbjct: 127 EERSRERAARDTAKLDALVGDNQVMVTVEDGSKRPLDVERLHTVVVEACKDLSDVEPDQI 186

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           L +T +N+YDG++  D   AL+ ++RT+IEKEPNY  VTAR LL+ +R E L  +    +
Sbjct: 187 LKDTMRNLYDGVAIKDAYQALVMTARTMIEKEPNYTYVTARLLLDSIRSEALREL-GVAK 245

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           +AT  EM  +YPE F  Y+  GV+  LL   ++ FDL  +AN +K ERD  F YLG+Q L
Sbjct: 246 RATQSEMNAIYPEAFKAYLSVGVENELLSPELLSFDLDKIANAIKPERDMLFTYLGIQTL 305

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           +DRYF+H +  RIE+PQ F+MRVAMGLA+ E ++E RA+EFY++LS+FH+M STPTLFNS
Sbjct: 306 FDRYFIHKDEVRIELPQVFWMRVAMGLAVNEDDREARAIEFYDVLSTFHYMSSTPTLFNS 365

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT  PQLSSC+LT VPDDL GI+GA+++NA+L+K++GGLGNDWTPVRGLGA+I GTNGKS
Sbjct: 366 GTLRPQLSSCYLTNVPDDLDGIYGAIKDNALLSKFAGGLGNDWTPVRGLGAYIKGTNGKS 425

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKVANDTAVAVNQGGKRKGAVCAYLETWHID+EEFL+LRKNTGDDRRRTHDMN+
Sbjct: 426 QGVVPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDIEEFLELRKNTGDDRRRTHDMNS 485

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANW+PDLF+KRV+ +  WTLFSP+EV DLHDLYGKEFE  YE YE  A  G+IK  + I 
Sbjct: 486 ANWVPDLFLKRVSSDGDWTLFSPNEVPDLHDLYGKEFEERYEYYEEMAKYGKIKTAKTIP 545

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSS-EETAVC 600
           A  LWRKML+MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+ + EE AVC
Sbjct: 546 ANVLWRKMLSMLFETGHPWITFKDPCNLRSPQQHVGVVHSSNLCTEITLNTKAGEEIAVC 605

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGS+NL  H  + + D ++L  T+ TAVR+LDNVIDIN + ++ A+KSN  HR +GLGL
Sbjct: 606 NLGSVNLPKHMKDGKLDTEQLEKTVSTAVRMLDNVIDINFYPVDTARKSNMRHRPVGLGL 665

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ AL+L +IPY S  AV+ AD +ME IS++AI AS +LA+ERG+Y SF GSLW QG+
Sbjct: 666 MGFQDALYLQNIPYTSEAAVDFADNAMEAISYYAIQASTDLAEERGSYESFAGSLWSQGI 725

Query: 721 FPIDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
            PIDSI  L E R    + ++ +S + WD L++RVKTIGMRNSN MAIAPTATI+NI GV
Sbjct: 726 LPIDSIEKLIEERGAEFIEVDTSSTMDWDTLRERVKTIGMRNSNVMAIAPTATISNISGV 785

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           SQSI+P+YQNLYVKSN+SG+FTVVN ++V ELK R LWD  M++DLKY++GS+ +I+RIP
Sbjct: 786 SQSIEPTYQNLYVKSNLSGEFTVVNPYMVKELKARKLWDSVMVNDLKYYEGSLQHIDRIP 845

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            ++K++ ATAFE++P WL+E+ASRRQKWIDQAQSLNLY+ EPSGKKLD +YR AW  GLK
Sbjct: 846 SEIKELFATAFEVEPKWLVEAASRRQKWIDQAQSLNLYMSEPSGKKLDMVYRMAWFRGLK 905

Query: 899 TTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           TTYYLRS  ATS EKST+   DGKLNAV      ++  S    +    + +CE CQ
Sbjct: 906 TTYYLRSLGATSTEKSTI--SDGKLNAVSSGP--AAVGSAAPKACAIDEPDCEACQ 957


>gi|92112800|ref|YP_572728.1| ribonucleotide-diphosphate reductase subunit alpha
           [Chromohalobacter salexigens DSM 3043]
 gi|91795890|gb|ABE58029.1| Ribonucleoside-diphosphate reductase [Chromohalobacter salexigens
           DSM 3043]
          Length = 976

 Score =  986 bits (2548), Expect = 0.0,   Method: Composition-based stats.
 Identities = 554/980 (56%), Positives = 685/980 (69%), Gaps = 41/980 (4%)

Query: 11  DEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQD 70
           D    P  A       + ++VIKR G V +FD SKIS AI KAF+A EG  A+ S R+++
Sbjct: 2   DTSISPGKASVDITAPQRLRVIKRGGEVAAFDGSKISVAITKAFIATEGDNAAASSRIRE 61

Query: 71  IIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRA 130
            +   T+  V   L+       +HIEDIQDQVE +LM++G  K+ R YVLYREE +  R 
Sbjct: 62  FVSEATQSIVDTFLRRMPDGGTLHIEDIQDQVELALMRAGEQKVARAYVLYREEHARAR- 120

Query: 131 AQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMY 190
            Q      A   P L +   DGT+   +  R+E +V +AC GL +V  + ++  + KN+Y
Sbjct: 121 -QPQGADIAKPHPSLNVTQADGTVRPLDLGRVETLVADACEGLANVEPQKIVDASLKNLY 179

Query: 191 DGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQC 250
           DG+    + TAL+ ++RTL+EKEPNY   TAR L + LRRE L +      +AT+ EM  
Sbjct: 180 DGVPIDGVATALMMTARTLVEKEPNYTYATARLLQDNLRREAL-SFLGIADEATYQEMAT 238

Query: 251 LYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHIN 310
           LY   F  YI++G++   L E + +FDL  L   L + RD  F YLGLQ LYDRYFLH +
Sbjct: 239 LYAPAFKAYIDKGIEFEQLDERLREFDLDRLGAALDHTRDNQFTYLGLQTLYDRYFLHHD 298

Query: 311 GSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSS 370
             R E+PQ  FMRVAMGLAL E + E RA+EFY LLSSF +M STPTLFN+GT+  QLSS
Sbjct: 299 DVRYELPQVMFMRVAMGLALNEDDPEARAIEFYELLSSFDYMASTPTLFNAGTQRSQLSS 358

Query: 371 CFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKV 430
           C+LTTVPD L GI+ A+++NA+L+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV
Sbjct: 359 CYLTTVPDQLDGIYSAIRDNALLSKWAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKV 418

Query: 431 ANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFM 490
            NDTAVAVNQGGKRKGAVCAYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTANW+PDLFM
Sbjct: 419 VNDTAVAVNQGGKRKGAVCAYLETWHLDVEEFLELRKNTGDDRRRTHDMNTANWVPDLFM 478

Query: 491 KRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKML 550
           KRV  +  WTLFSP    DLHDLYG  FE  Y  YE     G++K+F+++ A  LWRKML
Sbjct: 479 KRVFDDEEWTLFSPSTCPDLHDLYGAAFEKRYAEYEEMTRNGQLKLFKRVKAKDLWRKML 538

Query: 551 TMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAH 610
           +MLFETGHPWITFKDPCN+RSPQ H GVVHSSNLCTEITLN+S++E AVCNLGS+NL  H
Sbjct: 539 SMLFETGHPWITFKDPCNLRSPQNHAGVVHSSNLCTEITLNTSADEIAVCNLGSVNLAQH 598

Query: 611 FANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLL 670
             + Q D DKL  T++TAVR+LDNVIDIN + + +A+ SN  HR +GLGLMGFQ AL+ L
Sbjct: 599 IVDGQLDGDKLKKTVKTAVRMLDNVIDINYYAVPQARNSNFKHRPVGLGLMGFQDALYQL 658

Query: 671 HIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLA 730
            I YAS +AV  AD SME IS+HAI AS +LA ERG Y SF+GSLW +GV PIDSI  LA
Sbjct: 659 GIAYASDDAVTFADTSMELISYHAIEASSDLATERGRYQSFEGSLWSKGVLPIDSIAKLA 718

Query: 731 EVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQN 788
           E R    + ++ ++   W  L+ +V   GMRNSN MAIAPTATI+NICGV+QSI+P+YQN
Sbjct: 719 EERGADYIEVDTSTTQDWARLRDKVTRQGMRNSNVMAIAPTATISNICGVTQSIEPTYQN 778

Query: 789 LYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATA 848
           L+VKSN+SG+FTVVN+++VN+LK R LWDE MI+DLKY+DGS+  I+RIPDDLK  +A+A
Sbjct: 779 LFVKSNLSGEFTVVNAYMVNDLKARGLWDEVMINDLKYYDGSVQPIDRIPDDLKARYASA 838

Query: 849 FEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSA 908
           FE++P WL+E+A+RRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+  A
Sbjct: 839 FEVEPKWLVEAAARRQKWIDQAQSLNLYIAGVSGKKLDVTYRMAWFRGLKTTYYLRALGA 898

Query: 909 TSVEKSTLKGVDGKLNAVPVTDPN---------------------------------SST 935
           TSVEKST+    GKLNAV  T  +                                  S 
Sbjct: 899 TSVEKSTVDR--GKLNAVGNTGGSASPQPAAAPSPSPSPAASDAGGEARGIDDFLTGKSG 956

Query: 936 HSLGIPSSCTSDT-ECEVCQ 954
                PS+   D   CE CQ
Sbjct: 957 SGSRAPSAGDIDELGCEACQ 976


>gi|254492424|ref|ZP_05105596.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [Methylophaga thiooxidans DMS010]
 gi|224462316|gb|EEF78593.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [Methylophaga thiooxydans DMS010]
          Length = 976

 Score =  986 bits (2548), Expect = 0.0,   Method: Composition-based stats.
 Identities = 555/975 (56%), Positives = 702/975 (72%), Gaps = 33/975 (3%)

Query: 13  DAFPSLAYPFPE-KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDI 71
            + P+     P     G  VI+RNG VT FD  KI+ AI KAF+AVEG  A  S R+ D 
Sbjct: 2   ASEPAQTTHTPSSAESGYSVIRRNGKVTDFDSGKIAVAITKAFLAVEGDSAQNSRRIHDT 61

Query: 72  IKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA 131
           +K LT Q    LL+       VHIEDIQDQVE +LM+ G +K+ R YV+YRE++S+ RA 
Sbjct: 62  VKKLTGQITDNLLRRLDDGGTVHIEDIQDQVELALMREGEYKVARSYVVYREKQSEKRAE 121

Query: 132 QSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYD 191
           +            L + + DGT    +  RL  ++ EAC GL +V  + +L +T +N++D
Sbjct: 122 EEKKHPQPANETTLHVTLADGTRQPLDIDRLHNLITEACEGLAEVDREAILRDTQRNLFD 181

Query: 192 GLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCL 251
           G+ ESD+E AL+  +RT IEK+P Y+ + AR L++ +RRE L+ V+K P++A  +EM  +
Sbjct: 182 GVKESDVEKALVMGARTFIEKDPAYSTLAARLLMDGIRREALSFVFKMPKQAAQNEMVDI 241

Query: 252 YPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHING 311
           YP+YF  YI   ++  L+   +  FDL  L   LK E DF F YLGLQ LYDRYF+H +G
Sbjct: 242 YPDYFKSYIHTAIEKELVDSELGLFDLDRLGKALKPELDFDFTYLGLQTLYDRYFIHYDG 301

Query: 312 SRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSC 371
           +R E+PQAF+MRVAMGLA+ E  +E+RA+EFYNLLSSF FM STPTLFNSGT  PQLSSC
Sbjct: 302 TRFELPQAFYMRVAMGLAINELNREERAIEFYNLLSSFDFMSSTPTLFNSGTLRPQLSSC 361

Query: 372 FLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVA 431
           +LTTVPDDL GI+ A+++NA+L+KY+GGLGNDWT VRGLGAHI GTNGKSQGV+PFLKVA
Sbjct: 362 YLTTVPDDLSGIYNAMRDNALLSKYAGGLGNDWTRVRGLGAHIKGTNGKSQGVVPFLKVA 421

Query: 432 NDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMK 491
           NDTAVAVNQGGKRKGAVCAYLETWHID+EEFLD+RKNTGDDRRRTHDMNTANWIPD+FMK
Sbjct: 422 NDTAVAVNQGGKRKGAVCAYLETWHIDIEEFLDMRKNTGDDRRRTHDMNTANWIPDMFMK 481

Query: 492 RVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLT 551
           RV +   WTLFSP+EV DLHDL G  FE AY  YE +A RGEI+ F+++ A  LWRKML 
Sbjct: 482 RVAEEGQWTLFSPEEVDDLHDLTGLAFEKAYTEYEEKAARGEIRNFKQLPATDLWRKMLG 541

Query: 552 MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF 611
           MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGS+N++ H 
Sbjct: 542 MLFETGHPWVTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTSDKEIAVCNLGSVNMVKHI 601

Query: 612 ANNQF-DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLL 670
             N   D  KL  T+RTA+R+LDNVI+ N +++ +A+ SN  HR +GLG+MGFQ AL+ L
Sbjct: 602 DENGKLDTQKLQKTVRTAMRMLDNVIEYNYYSVPQARNSNLLHRPVGLGIMGFQDALYKL 661

Query: 671 HIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLA 730
            +PY+S E V+ ADESME +S++AI AS +LA ERG Y S++GSLW +G+ PIDSI LL 
Sbjct: 662 RLPYSSEETVKFADESMEAVSYYAIEASSDLAAERGKYQSYEGSLWSKGILPIDSIKLLQ 721

Query: 731 EVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNL 789
           E R   L  + +  + WD L+ ++K  GMRNSN MAIAPTATI+NICGVSQSI+P+YQN+
Sbjct: 722 EARGEYLQQDDSQTMDWDALRDKIKRQGMRNSNTMAIAPTATISNICGVSQSIEPTYQNI 781

Query: 790 YVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAF 849
           +VKSN+SG+FTV+N ++V +LK RDLWDE MI+DLKY DGS+ +I+RIPD+LK ++ TAF
Sbjct: 782 FVKSNLSGEFTVINPYMVEDLKARDLWDEVMINDLKYFDGSLQSIDRIPDELKALYTTAF 841

Query: 850 EIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSAT 909
           E+D  WLIE+ASRRQKWIDQAQSLNLY+ EPSGKK+D +Y+ AW+ GLKTTYYLRS  AT
Sbjct: 842 EMDARWLIEAASRRQKWIDQAQSLNLYMAEPSGKKMDNLYKLAWVRGLKTTYYLRSMGAT 901

Query: 910 SVEKSTLKGVDGKLNAVPVTDPNSSTHSL-----------------------------GI 940
             EK++           P      ++                                  
Sbjct: 902 GAEKTSSAPTPPPSAQKPTGPTPVASAPTASPVASSAAASAPLASAAADPEEFLGEGMEA 961

Query: 941 PSSCTS-DTECEVCQ 954
           P +C+  + +CE CQ
Sbjct: 962 PQACSILEPDCEACQ 976


>gi|91787005|ref|YP_547957.1| ribonucleotide-diphosphate reductase subunit alpha [Polaromonas sp.
           JS666]
 gi|91696230|gb|ABE43059.1| Ribonucleoside-diphosphate reductase [Polaromonas sp. JS666]
          Length = 969

 Score =  985 bits (2547), Expect = 0.0,   Method: Composition-based stats.
 Identities = 537/972 (55%), Positives = 699/972 (71%), Gaps = 34/972 (3%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           +     G+  +  S A   P  +   Q+I+RNG V  F+P+KI+ A+MKAF+AV G   +
Sbjct: 11  TSGGLAGNPVSNDSSAPTNP--LAHYQIIRRNGSVVPFEPNKIAVAMMKAFLAVHGTQGA 68

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S  V++ +  LT+  +  L++        HIED+QDQVE  LM+ GHH+I R YVLYRE
Sbjct: 69  ASASVRETVDGLTQAVIRALMRSRPGGGTFHIEDVQDQVELGLMRGGHHEIARAYVLYRE 128

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVL 182
           +RS  RA Q    + AP AP L +  D G  ++ + + L+ ++E +C+ L  DV    ++
Sbjct: 129 KRSQERARQPQ--TPAPEAPMLHVT-DGGQRVALDVRNLQALIEASCANLGADVKPDPIV 185

Query: 183 SETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQK 242
           +ET +N+YDG+   ++  A I ++RTLIEK+P+Y   TAR L+  +RREVL       ++
Sbjct: 186 AETMRNLYDGVPIDEVYKASILAARTLIEKDPDYTYATARLLMHTIRREVLG------EE 239

Query: 243 ATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILY 302
            +  EM   Y EYF ++I +GV+  LL E +  FDL  L   LK ERD  F+YLGLQ L+
Sbjct: 240 VSQEEMHSRYAEYFPKFIAKGVQNELLDEKLQQFDLARLGAALKPERDLKFDYLGLQTLF 299

Query: 303 DRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSG 362
           DRYFLH+   RIE+PQAFFMRVAMGL+L E ++E RA+EFY +LSSF FM STPTLFN+G
Sbjct: 300 DRYFLHVRKQRIELPQAFFMRVAMGLSLGEIDREARAIEFYEILSSFDFMSSTPTLFNAG 359

Query: 363 TRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQ 422
           T   QLSSC+LTTV DDL GI+ A++ENA+L+K++GGLGNDWTPVR LGAHI GTNG+SQ
Sbjct: 360 TLRSQLSSCYLTTVADDLGGIYDAIKENALLSKFAGGLGNDWTPVRALGAHIKGTNGESQ 419

Query: 423 GVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTA 482
           GV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTA
Sbjct: 420 GVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTA 479

Query: 483 NWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISA 542
           NWIPDLFM+RV +   WTLFSP +  DLHD +GKEFE  Y  YE +A+RGEIK  RK+ A
Sbjct: 480 NWIPDLFMRRVMEKGTWTLFSPSDTPDLHDKFGKEFEKIYTAYEARAERGEIKPARKLQA 539

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             +WRKML+MLFETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+S  ETAVCNL
Sbjct: 540 TDMWRKMLSMLFETGHPWITFKDACNVRSPQQHAGVVHSSNLCTEITLNTSDTETAVCNL 599

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GS+NL+ H  +   D+DKL  TI TA+R+LDNVIDIN + ++KA+ SN  HR +GLG+MG
Sbjct: 600 GSVNLVQHLKDGAIDHDKLKKTITTAMRMLDNVIDINYYAVKKARDSNMRHRPVGLGIMG 659

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ  L+ L +PYAS EAVE AD+SME + +HA  AS ELA+ERG Y+S+KGSLWD+G+ P
Sbjct: 660 FQDCLYELRVPYASQEAVEFADKSMEAVCYHAYWASTELAKERGKYASYKGSLWDKGILP 719

Query: 723 IDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
           +D++ +LAE R   + ++R++ L WD L++++   GMRNSNC+AIAPTATI+NI GV   
Sbjct: 720 LDTLDMLAEERGGYVEVDRSATLDWDALRQKIAQDGMRNSNCVAIAPTATISNIIGVDAC 779

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P + NL VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  ++R+P ++
Sbjct: 780 IEPCFGNLSVKSNLSGEFTVINHYLVRDLKRLGLWDDVMVVDLKHFDGSLRPVDRVPQEI 839

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           K ++ATAFE++  W++E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTY
Sbjct: 840 KALYATAFEVETSWIVEAAARRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTY 899

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVTDPNS-------------------STHSLGIPS 942
           YLR+  AT  EKST+K   GK+N+V      S                   ++ +  I  
Sbjct: 900 YLRTMGATHAEKSTVKA--GKMNSVSSGPEASGSGKSALEVAAAAAQAQMNASPATDIKF 957

Query: 943 SCTSDTECEVCQ 954
               D  CE CQ
Sbjct: 958 CAIDDPGCEACQ 969


>gi|167895963|ref|ZP_02483365.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 7894]
          Length = 995

 Score =  985 bits (2546), Expect = 0.0,   Method: Composition-based stats.
 Identities = 557/994 (56%), Positives = 701/994 (70%), Gaps = 56/994 (5%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPFAGGAQGAPALASQTTY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQTVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A     ++A  A  + +  D+G   + +   L  ++  AC GL D VS +
Sbjct: 131 REKRHLERVHAGETEAAEASPAGGINVT-DNGVTRALDLNALRALIVSACEGLGDAVSPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMTQVYDSSILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMTTRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGSYALDEEKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS EAVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASDEAVEFADRSMEAVCYYAYWASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPALRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPN--------------------- 932
           L GLKTTYYLR+ +AT VEKST+    G LNAVP +                        
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTSGGTSGGAAGGAQGAAGGFGAAGGD 961

Query: 933 ------SSTHSLGIPSSCTSDT------ECEVCQ 954
                 ++         CT         ECE CQ
Sbjct: 962 APSGAMNAAPVEADGPVCTMRPGDPGFEECEACQ 995


>gi|134294682|ref|YP_001118417.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           vietnamiensis G4]
 gi|134137839|gb|ABO53582.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           vietnamiensis G4]
          Length = 996

 Score =  984 bits (2544), Expect = 0.0,   Method: Composition-based stats.
 Identities = 549/995 (55%), Positives = 692/995 (69%), Gaps = 57/995 (5%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLGGTEQGAQALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTHNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVRAAQSHSKSDAPIAPK--LKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSS 178
           RE+R   R       + A       + ++ D+G     +   L  ++  AC GL   V++
Sbjct: 131 REKRHLERQHAGEEAAAAGAESNTGINVV-DNGVTRPLDMNALRALIVSACDGLGTAVNA 189

Query: 179 KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYK 238
             +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L     
Sbjct: 190 DPIVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG---- 245

Query: 239 KPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGL 298
             ++    +M   Y EYF ++++ GV A LL + ++ FDL  L   L   RD  F YLGL
Sbjct: 246 --EEVVQADMSARYAEYFPQFLKRGVDAGLLDDKLLQFDLKRLGEALDANRDLQFGYLGL 303

Query: 299 QILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTL 358
           Q LYDRYFLH++G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTL
Sbjct: 304 QTLYDRYFLHVDGTRIEMPQAFFMRVAMGLSLNEIDRETRAIEFYNVLSSFDFMSSTPTL 363

Query: 359 FNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTN 418
           FNSGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTN
Sbjct: 364 FNSGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTN 423

Query: 419 GKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHD 478
           GKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHD
Sbjct: 424 GKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHD 483

Query: 479 MNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFR 538
           MNTANWIPDLFMKRV + + WTLFSP    DLHD +G +FE AY  YE +  RGEIK+F+
Sbjct: 484 MNTANWIPDLFMKRVMEGSDWTLFSPSTCPDLHDKFGADFEKAYTAYEDKVARGEIKLFK 543

Query: 539 KISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA 598
           KI A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E A
Sbjct: 544 KIPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIA 603

Query: 599 VCNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTH 653
           VCNLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  H
Sbjct: 604 VCNLGSVNLVAHLVKQADGSYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKH 663

Query: 654 RAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKG 713
           R +G+G+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++G
Sbjct: 664 RPVGMGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRG 723

Query: 714 SLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
           SLWD+G+ P D++ LLAE R   + ++ +  L W  L+ R+   GMRNSNC+AIAPTATI
Sbjct: 724 SLWDRGILPQDTLKLLAEARGGYVEVDTSESLDWSTLRSRIAAHGMRNSNCVAIAPTATI 783

Query: 773 ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
           +NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG + 
Sbjct: 784 SNIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLS 843

Query: 833 NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
            I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ A
Sbjct: 844 RIDRIPADLRAIYATAFEVDPTWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKLA 903

Query: 893 WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVT----------------------- 929
           WL GLKTTYYLR+ +AT VEKST+    G LNAVP +                       
Sbjct: 904 WLRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTSGGSSSGGAQGAAGGFGAAGGDVS 961

Query: 930 ----DPNSSTHSLGIPSSCTSDT------ECEVCQ 954
               +  +          CT         ECE CQ
Sbjct: 962 SGGLNAAALAPVEADGPVCTMRPGDPGFDECEACQ 996


>gi|107021672|ref|YP_619999.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
            cenocepacia AU 1054]
 gi|116688618|ref|YP_834241.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
            cenocepacia HI2424]
 gi|170731917|ref|YP_001763864.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
            cenocepacia MC0-3]
 gi|105891861|gb|ABF75026.1| Ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
            cenocepacia AU 1054]
 gi|116646707|gb|ABK07348.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
            cenocepacia HI2424]
 gi|169815159|gb|ACA89742.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
            cenocepacia MC0-3]
          Length = 1001

 Score =  984 bits (2544), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/1000 (55%), Positives = 688/1000 (68%), Gaps = 62/1000 (6%)

Query: 2    HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
             P     +G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17   RPLGGTEQGAKALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62   ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
             + S RV++ ++ LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71   GAASARVREQVEQLTHNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122  REERSDVRAAQSHSKSDAPIAPK--LKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSS 178
            RE+R   R       + A       + ++ D+G     +   L  ++  AC GL   V+ 
Sbjct: 131  REKRHLERQHAGEEAAAAGGESATGINVV-DNGVTRPLDQNALRALIVSACDGLGAAVNP 189

Query: 179  KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYK 238
              +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L     
Sbjct: 190  DPIVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG---- 245

Query: 239  KPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGL 298
              ++    EM   Y EYF ++++ GV A LL + ++ FDL  L   L   RD  F YLGL
Sbjct: 246  --EEVVQAEMSTRYAEYFPQFLKRGVDAGLLDDKLLQFDLKRLGEALDANRDLQFGYLGL 303

Query: 299  QILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTL 358
            Q LYDRYFLH+ G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTL
Sbjct: 304  QTLYDRYFLHVEGTRIEMPQAFFMRVAMGLSLNEIDRETRAIEFYNVLSSFDFMSSTPTL 363

Query: 359  FNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTN 418
            FNSGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTN
Sbjct: 364  FNSGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTN 423

Query: 419  GKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHD 478
            GKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHD
Sbjct: 424  GKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHD 483

Query: 479  MNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFR 538
            MNTANWIPDLFMKRV +   WTLFSP    DLHD +G +FE AY  YE +  RGEIK+F+
Sbjct: 484  MNTANWIPDLFMKRVMEGGDWTLFSPSTCPDLHDKFGADFEKAYTAYEDKVARGEIKLFK 543

Query: 539  KISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA 598
            KI A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E A
Sbjct: 544  KIPAAQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIA 603

Query: 599  VCNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTH 653
            VCNLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  H
Sbjct: 604  VCNLGSVNLVAHLVKQADGSYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKH 663

Query: 654  RAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKG 713
            R +G+G+MGFQ  LHLL  PYAS EAVE AD SME + ++A  AS ELA+ERG YSS++G
Sbjct: 664  RPVGMGIMGFQDCLHLLRTPYASQEAVEFADRSMEAVCYYAYHASTELAEERGRYSSYRG 723

Query: 714  SLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
            SLWD+G+ P D++ LLAE R   + ++ +  L W  L+ R+ T GMRNSNC+AIAPTATI
Sbjct: 724  SLWDRGILPQDTLKLLAEARGGYVEVDTSESLDWTALRARIATHGMRNSNCVAIAPTATI 783

Query: 773  ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
            +NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG + 
Sbjct: 784  SNIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLS 843

Query: 833  NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
             I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ A
Sbjct: 844  RIDRIPADLRAIYATAFEVDPTWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKLA 903

Query: 893  WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPV------------------------ 928
            WL GLKTTYYLR+ +AT VEKST+    G LNAVP                         
Sbjct: 904  WLRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTGGAGSGGSSSGGAQGAAGGFGAAG 961

Query: 929  --------TDPNSSTHSLGIPSSCTSDT------ECEVCQ 954
                        +          CT         ECE CQ
Sbjct: 962  GAASSGAVNAAAALAPVEADGPVCTMRPGDPGFDECEACQ 1001


>gi|331006662|ref|ZP_08329943.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [gamma proteobacterium IMCC1989]
 gi|330419530|gb|EGG93915.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [gamma proteobacterium IMCC1989]
          Length = 963

 Score =  984 bits (2544), Expect = 0.0,   Method: Composition-based stats.
 Identities = 559/958 (58%), Positives = 705/958 (73%), Gaps = 9/958 (0%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P+                        ++VIKRNG V  +   KI+ A+ KAF+AVEG  A
Sbjct: 9   PTNTSPLEKSSTGSYQTSVTATAPGKLRVIKRNGTVMPYAEDKIAIAVTKAFLAVEGGTA 68

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S RV + +K  T+Q      +   S   VHIEDIQDQVE +LM++G HK+ R+YVLYR
Sbjct: 69  AASSRVHETVKLFTQQISDTFNRRMPSGGTVHIEDIQDQVELTLMRNGEHKVARDYVLYR 128

Query: 123 EERSDVRAAQSHSKSDAPIA--PKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI 180
            ER+ VRA+ + + S   ++  PKL + +++G     +  R+  IV EAC GL DVS   
Sbjct: 129 AERARVRASATPAVSAEALSKYPKLNVTLENGDTAPLDMARIHTIVTEACEGLSDVSVDA 188

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +L E  +N+YDG++ SD+ T+L+ ++RTL+EKEPNY+  TAR L +KLR E L       
Sbjct: 189 ILDEAMRNLYDGVALSDINTSLVITARTLVEKEPNYSYATARLLQDKLRAEALG-FLGIA 247

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           ++ATHHEM   Y +    YIE+G++  LL  S+ +FD+  L   L + RD  F YLGLQ 
Sbjct: 248 EQATHHEMAHYYAQALPAYIEKGIELELLAPSLRNFDIPALGKALDHTRDSQFTYLGLQT 307

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYF+H N  RIE+PQ FFMRVAMGLA++E +  +RA+EFY LLSSF +M STPTLFN
Sbjct: 308 LYDRYFIHSNDVRIELPQIFFMRVAMGLAVEEDKPTERAIEFYRLLSSFDYMSSTPTLFN 367

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           +GT  PQLSSC+LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LG++I GTNGK
Sbjct: 368 AGTLRPQLSSCYLTTVPDDLHGIYGAMQDNAMLSKWAGGLGNDWTPVRALGSYIKGTNGK 427

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKVANDTAVAVNQGGKRKGA+CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 428 SQGVVPFLKVANDTAVAVNQGGKRKGAMCAYLETWHMDIEEFLELRKNTGDDRRRTHDMN 487

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANW+PDLFMKRV     WTLF+P E  DLHDL G  FE  YE YER ADRGEIK F++I
Sbjct: 488 TANWVPDLFMKRVFDKKEWTLFTPSEAPDLHDLCGTAFETRYEEYERMADRGEIKHFKRI 547

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSS-EETAV 599
            A +LWRKML MLFETGHPWITFKD CN+RSPQQHVGV+HSSNLCTEITLN+S+ +E AV
Sbjct: 548 PAESLWRKMLGMLFETGHPWITFKDSCNLRSPQQHVGVIHSSNLCTEITLNTSAGDEIAV 607

Query: 600 CNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLG 659
           CNLGS+NL  H  N + +  KL +T+ TAVR+LDNVIDIN + +E A+ SN  HR IGLG
Sbjct: 608 CNLGSVNLAQHIENGELNTTKLEATVNTAVRMLDNVIDINYYAVEAARTSNMRHRPIGLG 667

Query: 660 LMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQG 719
           LMGFQ AL+     Y+S +AVE AD SME IS+ AI+AS  LA ERG Y +F+GSLW +G
Sbjct: 668 LMGFQDALYKQGFAYSSDQAVEFADRSMEAISYFAINASSNLAAERGQYPTFEGSLWSKG 727

Query: 720 VFPIDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICG 777
             PIDSI  L + R    + M+R+  L W  L+ +V+  GMRNSN MAIAPTATIANI G
Sbjct: 728 ELPIDSIETLVKQRGEKYIEMDRSQTLDWSSLRSKVQKQGMRNSNVMAIAPTATIANITG 787

Query: 778 VSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERI 837
           VSQSI+P+YQNLYVKSN+SG+FTVVN +L+++LK+RDLWD  M++DLKY++GS+  +ERI
Sbjct: 788 VSQSIEPTYQNLYVKSNLSGEFTVVNPYLIHDLKKRDLWDAVMVNDLKYYEGSVQKVERI 847

Query: 838 PDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGL 897
           P DLK ++ATAFE++P W++ +ASRRQKW+DQAQSLNLY+   +GKKLD  YR AW  GL
Sbjct: 848 PADLKALYATAFEVEPRWIVSAASRRQKWLDQAQSLNLYIAGANGKKLDVTYRMAWYSGL 907

Query: 898 KTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
           KTTYYLR+ SAT+ EKST+ G  G LNAV     +++  +  +P +C+ D  +CE CQ
Sbjct: 908 KTTYYLRALSATTTEKSTVSG--GTLNAVSSNAESAAPVAAAVPKACSIDEPDCEACQ 963


>gi|145588392|ref|YP_001154989.1| ribonucleotide-diphosphate reductase subunit alpha
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145046798|gb|ABP33425.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 993

 Score =  984 bits (2543), Expect = 0.0,   Method: Composition-based stats.
 Identities = 548/957 (57%), Positives = 694/957 (72%), Gaps = 32/957 (3%)

Query: 23  PEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTR 82
             ++   ++I+RNG V +F+PSKI+ A+ KAF+AV G   + S RV++ ++ LT   V  
Sbjct: 44  ATQLSDYKIIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHSVVRA 103

Query: 83  LLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA 142
           LL+   +    HIEDIQDQVE +LM+SG H + R YVLYRE+R+  RAAQ     ++  A
Sbjct: 104 LLRSRPNGGTFHIEDIQDQVELALMRSGEHNVARAYVLYREKRNQERAAQQEVAQESQSA 163

Query: 143 PK-----LKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSES 196
            +     +K+  D+G     +   L  ++E AC GL   + +  +++ET KN+YDG+  +
Sbjct: 164 GQATESGIKVT-DNGVEKWLDMAALRTVIEAACEGLGNHIDATPIITETIKNLYDGVPMA 222

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
            +  + I +SRTLIEK+P +++VTAR L+  +R+E+L       ++    +MQ  Y  YF
Sbjct: 223 QVYDSAILASRTLIEKDPAFSQVTARILMHVIRKEILG------KEVLQGDMQSEYGTYF 276

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
            +YI EG+ A LL   M +FDL  LA  L   RD  F YLGLQ LYDRYFLHI   RIEM
Sbjct: 277 AKYINEGISAELLDPRMREFDLPRLAAALNASRDLQFNYLGLQTLYDRYFLHIEDRRIEM 336

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQAFFMRVAMGL+L E ++E+RA+EFY +LS+F FM STPTLFNS T  PQLSSC+LTTV
Sbjct: 337 PQAFFMRVAMGLSLNELDRERRAIEFYEILSTFDFMSSTPTLFNSATTRPQLSSCYLTTV 396

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAV
Sbjct: 397 EDDLDGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAV 456

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT+NWIPDLFMKRV +N
Sbjct: 457 AVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTSNWIPDLFMKRVMEN 516

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLFSP    DLHD YGK FE AY  YE++ADRGE+K FR+I A  LWRKML MLFET
Sbjct: 517 GDWTLFSPSNTPDLHDKYGKAFEEAYVAYEQKADRGELKPFRRIPAQQLWRKMLGMLFET 576

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKDPCNIRSPQQH+GVVHSSNLCTEITLN++  E AVCNLGS+NL AH   +  
Sbjct: 577 GHPWITFKDPCNIRSPQQHIGVVHSSNLCTEITLNTNETEIAVCNLGSVNLTAHMTTDAN 636

Query: 617 -----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLH 671
                D++KL  T+RTA+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LH+  
Sbjct: 637 GKLVLDHEKLQRTVRTAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHMQR 696

Query: 672 IPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAE 731
           IPYAS EAV+ AD SME + ++A  AS ELA+ERG YS++ GSLWD+G+ P DS+ LLA+
Sbjct: 697 IPYASEEAVKFADSSMEAVCYYAYQASNELAEERGVYSTYTGSLWDRGILPQDSVALLAQ 756

Query: 732 VR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
            R   L ++ +S + W  L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNL+
Sbjct: 757 ERGGYLEVDNSSTMDWSGLRARIKQYGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLF 816

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTVVN +LV +LK R LWDE MI+DLKY DG++  I+RIP DL+ ++ATAFE
Sbjct: 817 VKSNLSGEFTVVNEYLVRDLKDRGLWDEVMIADLKYFDGTLSKIDRIPQDLRDLYATAFE 876

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+ +AT 
Sbjct: 877 VEPSWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDDTYKLAWLRGLKTTYYLRTMAATH 936

Query: 911 VEKSTLK-------GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDT------ECEVCQ 954
           VEKST+           G +N    T  +++         CT         ECE CQ
Sbjct: 937 VEKSTVASGQLNSVSSGGGVNGTDATAASAAGGVEADGPVCTMRPGDAGFEECEACQ 993


>gi|171318521|ref|ZP_02907673.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
            ambifaria MEX-5]
 gi|171096307|gb|EDT41213.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
            ambifaria MEX-5]
          Length = 1001

 Score =  983 bits (2542), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/1000 (55%), Positives = 692/1000 (69%), Gaps = 62/1000 (6%)

Query: 2    HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
             P     +G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17   RPLGGTEQGAKALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62   ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
             + S RV++ ++ LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71   GAASARVREQVEQLTHSVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122  REERSDVRA--AQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSS 178
            RE+R   R    +  + +    +  + ++ D+G     +   L  ++  AC+GL   V+ 
Sbjct: 131  REKRHLERQHAGEEAAAAGGEASAGINVV-DNGVTRPLDMNALRELIVSACAGLGAAVNP 189

Query: 179  KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYK 238
            + +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L     
Sbjct: 190  EPIVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG---- 245

Query: 239  KPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGL 298
              ++    EM   Y EYF ++++ GV A LL + ++ FDL  L   L   RD  F YLGL
Sbjct: 246  --EEVLQAEMSTRYTEYFPQFLKRGVDAGLLDDKLLQFDLKRLGEALDANRDLQFGYLGL 303

Query: 299  QILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTL 358
            Q LYDRYFLH+ G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTL
Sbjct: 304  QTLYDRYFLHVEGTRIEMPQAFFMRVAMGLSLNEIDRETRAIEFYNVLSSFDFMSSTPTL 363

Query: 359  FNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTN 418
            FNSGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTN
Sbjct: 364  FNSGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTN 423

Query: 419  GKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHD 478
            GKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHD
Sbjct: 424  GKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHD 483

Query: 479  MNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFR 538
            MNTANWIPDLFMKRV + A WTLFSP    DLHD +G +FE AY  YE +  RGEIK+F+
Sbjct: 484  MNTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGADFEKAYTAYEDKVARGEIKLFK 543

Query: 539  KISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA 598
            KI A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E A
Sbjct: 544  KIPAAQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIA 603

Query: 599  VCNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTH 653
            VCNLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  H
Sbjct: 604  VCNLGSVNLVAHLVKQADGSYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKH 663

Query: 654  RAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKG 713
            R +G+G+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++G
Sbjct: 664  RPVGMGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYHASTELAEERGRYSSYRG 723

Query: 714  SLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
            SLWD+G+ P D++ LLAE R   + ++ +  L W  L+ R+   GMRNSNC+AIAPTATI
Sbjct: 724  SLWDRGILPQDTLKLLAEARGGYVEVDTSESLDWTALRARIAAHGMRNSNCVAIAPTATI 783

Query: 773  ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
            +NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG + 
Sbjct: 784  SNIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLS 843

Query: 833  NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
             I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ A
Sbjct: 844  RIDRIPADLRAIYATAFEVDPTWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKLA 903

Query: 893  WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP------------------------- 927
            WL GLKTTYYLR+ +AT VEKST+    G LNAVP                         
Sbjct: 904  WLRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTGGAGSGGSGSGGAQGAAGGFGAAG 961

Query: 928  -------VTDPNSSTHSLGIPSSCTSDT------ECEVCQ 954
                   V    +          CT         ECE CQ
Sbjct: 962  GGASSGAVNAAPALAPVEADGPVCTMRPGDPGFDECEACQ 1001


>gi|206561766|ref|YP_002232531.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
            cenocepacia J2315]
 gi|198037808|emb|CAR53752.1| putative ribonucleoside reductase [Burkholderia cenocepacia J2315]
          Length = 1003

 Score =  983 bits (2542), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/1000 (55%), Positives = 687/1000 (68%), Gaps = 62/1000 (6%)

Query: 2    HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
             P     +G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 19   RPLGGTEQGAKALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 72

Query: 62   ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
             + S RV++ ++ LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 73   GAASARVREQVEQLTHNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 132

Query: 122  REERSDVRAAQSHSKSDAPIAPK--LKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSS 178
            RE+R   R       + A       + ++ D+G     +   L  ++  AC GL   V+ 
Sbjct: 133  REKRHLERQHAGEEAAAAGGESTTGINVV-DNGVTRPLDLNALRALIVSACDGLGAAVNP 191

Query: 179  KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYK 238
              +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L     
Sbjct: 192  DPIVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG---- 247

Query: 239  KPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGL 298
              ++    EM   Y EYF ++++ GV A LL + ++ FDL  L   L   RD  F YLGL
Sbjct: 248  --EEVVQAEMSTRYAEYFPQFLKRGVDAGLLDDKLLQFDLKRLGEALDANRDLQFGYLGL 305

Query: 299  QILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTL 358
            Q LYDRYFLH++G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTL
Sbjct: 306  QTLYDRYFLHVDGTRIEMPQAFFMRVAMGLSLNEIDRETRAIEFYNVLSSFDFMSSTPTL 365

Query: 359  FNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTN 418
            FNSGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTN
Sbjct: 366  FNSGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTN 425

Query: 419  GKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHD 478
            GKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHD
Sbjct: 426  GKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHD 485

Query: 479  MNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFR 538
            MNTANWIPDLFMKRV + A WTLFSP    DLHD +G +FE AY  YE +  RGEIK+F+
Sbjct: 486  MNTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGADFEKAYTAYEDKVARGEIKLFK 545

Query: 539  KISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA 598
            KI A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E A
Sbjct: 546  KIPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIA 605

Query: 599  VCNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTH 653
            VCNLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  H
Sbjct: 606  VCNLGSVNLVAHLVKQADGSYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKH 665

Query: 654  RAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKG 713
            R +G+G+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++G
Sbjct: 666  RPVGMGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRG 725

Query: 714  SLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
            SLWD+G+ P D++ LL E R   + ++ +  L W  L+ R+   GMRNSNC+AIAPTATI
Sbjct: 726  SLWDRGILPQDTLKLLTEARGGYVEVDTSESLDWTTLRSRIAAHGMRNSNCVAIAPTATI 785

Query: 773  ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
            +NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG + 
Sbjct: 786  SNIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLS 845

Query: 833  NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
             I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ A
Sbjct: 846  RIDRIPADLRAIYATAFEVDPTWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKLA 905

Query: 893  WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPV------------------------ 928
            WL GLKTTYYLR+ +AT VEKST+    G LNAVP                         
Sbjct: 906  WLRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTGGAGSGGSGSGGAQGAAGGFGAAG 963

Query: 929  --------TDPNSSTHSLGIPSSCTSDT------ECEVCQ 954
                        +          CT         ECE CQ
Sbjct: 964  GDASSGAINAAPALAPVEADGPVCTMRPGDPGFDECEACQ 1003


>gi|121606274|ref|YP_983603.1| ribonucleotide-diphosphate reductase subunit alpha [Polaromonas
           naphthalenivorans CJ2]
 gi|120595243|gb|ABM38682.1| ribonucleoside-diphosphate reductase, alpha subunit [Polaromonas
           naphthalenivorans CJ2]
          Length = 967

 Score =  983 bits (2541), Expect = 0.0,   Method: Composition-based stats.
 Identities = 542/968 (55%), Positives = 700/968 (72%), Gaps = 32/968 (3%)

Query: 8   NKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIR 67
           + G   +    A P    +   Q+I+RNG V +F+PSKI+ A+MKAF+AV G   + S  
Sbjct: 11  SSGVPASNSIHATPASGALANYQIIRRNGSVVAFEPSKIAVAMMKAFLAVHGTQGAASAS 70

Query: 68  VQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSD 127
           V++ +  LT+  V  L++   S    HIED+QDQVE  LM+ GHH+I R YVLYRE+ + 
Sbjct: 71  VRETVDTLTQAVVRALMRSRPSGGTFHIEDVQDQVELGLMRGGHHEIARAYVLYREKHNQ 130

Query: 128 VRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETY 186
            RA Q   ++  P  P+L +M D G  ++ + + L+ ++E +C+ L  DV    ++SET 
Sbjct: 131 ERARQ--LQAQTPALPQLHVM-DGGKRVALDLRNLQALIEASCANLGTDVKPDPIVSETM 187

Query: 187 KNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHH 246
           +N+YDG+   ++  A I ++RTLIEK+P+Y   TAR LL  +R+EVL       ++ +H 
Sbjct: 188 RNLYDGVPIEEVYKASILAARTLIEKDPDYTYATARLLLHTIRKEVLD------EEISHE 241

Query: 247 EMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYF 306
            M   Y  YF  +I +G+K  LL E +  FDL  L   LK ERD  F+YLGLQ L+DRYF
Sbjct: 242 AMAVRYVTYFPEFIAKGIKNELLDEKLQQFDLARLGAALKPERDLQFDYLGLQTLFDRYF 301

Query: 307 LHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHP 366
           LHI   RIE+PQAFFMRVAMGL+L ET++E RA+EFY +LSSF FM STPTLFN+GT   
Sbjct: 302 LHIRKQRIELPQAFFMRVAMGLSLNETDREARAIEFYEILSSFDFMSSTPTLFNAGTLRS 361

Query: 367 QLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIP 426
           QLSSC+LTTV DDL GI+ A++ENA+L+K++GGLGNDWTPVR +GAHI GTNG+SQGV+P
Sbjct: 362 QLSSCYLTTVADDLGGIYDAIKENALLSKFAGGLGNDWTPVRAMGAHIKGTNGESQGVVP 421

Query: 427 FLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIP 486
           FLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT+NWIP
Sbjct: 422 FLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTSNWIP 481

Query: 487 DLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALW 546
           DLFM+RV +   WTLFSP +  DLHD +G++FE AY  YE +A+RGE+K  RK+ A  +W
Sbjct: 482 DLFMRRVMEKGSWTLFSPSDTPDLHDKFGQDFEKAYVAYEARAERGELKPSRKLQATDMW 541

Query: 547 RKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSIN 606
           RKML+MLFETGHPWITFKD CNIRSPQQH GVVHSSNLCTEITLN+S+ ETAVCNLGSIN
Sbjct: 542 RKMLSMLFETGHPWITFKDACNIRSPQQHAGVVHSSNLCTEITLNTSATETAVCNLGSIN 601

Query: 607 LLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSA 666
           L+ H  +   D+DKL  TI TA+R+LDNVIDIN + +EKA+ SN  HR +GLGLMGFQ  
Sbjct: 602 LVQHLKDGALDHDKLKKTITTAMRMLDNVIDINYYAVEKARHSNMRHRPVGLGLMGFQDC 661

Query: 667 LHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSI 726
           L+ L +PYAS  AVE AD SME I +HA  AS ELA+ERG Y S+KGSLWDQG+ P+D++
Sbjct: 662 LYELRVPYASQAAVEFADTSMEAICYHAYWASTELARERGQYESYKGSLWDQGILPLDTL 721

Query: 727 GLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPS 785
            +LA+ R   + ++R++ L WD L++++ T GMRNSNC+AIAPTATI+NI GV   I+P 
Sbjct: 722 DMLAKERGGYVEVDRSATLDWDALRQKIATDGMRNSNCVAIAPTATISNIIGVDACIEPC 781

Query: 786 YQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIH 845
           + NL VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P+D+K ++
Sbjct: 782 FGNLSVKSNLSGEFTVINHYLVRDLKKLGLWDDVMVVDLKHFDGSLRPIDRVPNDIKALY 841

Query: 846 ATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRS 905
           ATAFEI+  WL+E+ SRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ GLKTTYYLR+
Sbjct: 842 ATAFEIETSWLVEAGSRRQKWIDQAQSLNIYMAGASGKKLDETYKLAWVRGLKTTYYLRT 901

Query: 906 RSATSVEKSTLKGVDGKLNAVPVTDPNS-------------------STHSLGIPSSCTS 946
           +SAT  EKST++   GK+N+V      +                   +T +  I      
Sbjct: 902 QSATHAEKSTVQA--GKMNSVSSAPAAAMLGMSAIDKAAAAAQAQMSATPATDIKFCAID 959

Query: 947 DTECEVCQ 954
           D  CE CQ
Sbjct: 960 DPGCEACQ 967


>gi|149927166|ref|ZP_01915423.1| ribonucleotide-diphosphate reductase alpha subunit [Limnobacter sp.
           MED105]
 gi|149824105|gb|EDM83326.1| ribonucleotide-diphosphate reductase alpha subunit [Limnobacter sp.
           MED105]
          Length = 969

 Score =  983 bits (2541), Expect = 0.0,   Method: Composition-based stats.
 Identities = 542/969 (55%), Positives = 696/969 (71%), Gaps = 41/969 (4%)

Query: 14  AFPSLAYPF-PEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           + P+ A P         ++I+RNG V  F+PSKI+ A+ KAF+AV G   + S R+++++
Sbjct: 14  SKPAGAAPVVDSAYSNYKIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQGAASARIRELV 73

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
           + +T   V  L++   S  I HIEDIQDQVE +LM+SG  ++ R YVLYRE R+  RAA+
Sbjct: 74  EQMTGSVVNALVRRQPSGGIFHIEDIQDQVELALMRSGEAEVARAYVLYRERRAQERAAK 133

Query: 133 SHSKSDAPIAPKLKIMMDDGT-LISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYD 191
              +++      +     DG      + + L+ ++E A  GL ++    +  ET KN+YD
Sbjct: 134 QVEQAEQHALNVM-----DGDIKRPLDVEALKALIESAAVGLNEIDVAHLQKETLKNLYD 188

Query: 192 GLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCL 251
           G+   ++  + I +SR +IE EP+Y  VT+R LL  +RRE++       ++    EM  +
Sbjct: 189 GVKIDEVFKSAILASRAMIENEPSYTLVTSRLLLHTIRREIIG------REIAQDEMAQV 242

Query: 252 YPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHING 311
           YPEYF ++I++G+ A LL   +  FD+  L   LKYERD  F+YLGLQ LYDRYFLH+ G
Sbjct: 243 YPEYFPQFIKKGIAAGLLDNRLAQFDMKKLGAALKYERDLQFDYLGLQTLYDRYFLHVEG 302

Query: 312 SRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSC 371
           +RIEMPQAF+MRVAMGLAL E ++E RA+EFY +LS+F FM STPTLFNSGT   QLSSC
Sbjct: 303 TRIEMPQAFYMRVAMGLALNEVDREARAIEFYEVLSTFDFMSSTPTLFNSGTIRSQLSSC 362

Query: 372 FLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVA 431
           +LTT+ DDL  I+  ++ENA+L+K++GGLGNDWTPVR LG+HI GTNGKSQGV+PFLKV 
Sbjct: 363 YLTTIGDDLDDIYEGIKENALLSKFAGGLGNDWTPVRALGSHIKGTNGKSQGVVPFLKVV 422

Query: 432 NDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMK 491
           NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMK
Sbjct: 423 NDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMK 482

Query: 492 RVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLT 551
           RV +   WTLFSP +  DLHDLYGK FE AY  YE +A RG++K+F+ + A  LWRK+L+
Sbjct: 483 RVMEGGNWTLFSPSDCPDLHDLYGKAFEKAYVGYEEKAARGDLKLFKTVEAAKLWRKILS 542

Query: 552 MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF 611
           MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL  H 
Sbjct: 543 MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNENEIAVCNLGSVNLTRHL 602

Query: 612 ANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSA 666
                     D++KL  T+  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ A
Sbjct: 603 KPADNGELVLDHEKLQKTVGVAMRMLDNVIDINYYAVAKARNSNLRHRPVGMGMMGFQDA 662

Query: 667 LHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSI 726
           LH++  PYAS +AVE ADESME I ++A  AS ELA ERGAYS+FKGSLWD+G+ P+DS+
Sbjct: 663 LHMMRKPYASRDAVEFADESMEAICYYAYEASTELAAERGAYSTFKGSLWDKGIMPLDSL 722

Query: 727 GLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPS 785
            LL E R   + ++ +SR+ WD L+ R+K  GMRNSNC+AIAPTATI+NI GV+ SI+P+
Sbjct: 723 KLLEEERGGYVEVDTSSRMDWDALRARIKKHGMRNSNCVAIAPTATISNIIGVAASIEPT 782

Query: 786 YQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIH 845
           +QNLYVKSN+SG+FT+VN  LV +LK+  +WDE MISDLKY DGS+  I+RIP+DLK+++
Sbjct: 783 FQNLYVKSNLSGEFTIVNEHLVRDLKRLGIWDEVMISDLKYFDGSVMKIDRIPEDLKRLY 842

Query: 846 ATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRS 905
           ATAFE+DP WL+E+A+RRQKWIDQ QSLN+Y+   SGK+LD  Y+ AW+ GLKTTYYLR+
Sbjct: 843 ATAFEMDPRWLVEAAARRQKWIDQGQSLNIYMAGVSGKRLDDTYKLAWIRGLKTTYYLRT 902

Query: 906 RSATSVEKSTLKGVDGKLNAVPVTDPNSS--------------THSLGIPSSCTSDT--- 948
             AT  EKSTL G  G+LN+V      S+                       CT      
Sbjct: 903 IGATHAEKSTLAG--GELNSVNAEGGASAAFTSAPATGLVPNLPEQEIEGKVCTMRPGDA 960

Query: 949 ---ECEVCQ 954
              ECE CQ
Sbjct: 961 GFDECEACQ 969


>gi|312795098|ref|YP_004028020.1| ribonucleoside-diphosphate reductase alpha chain [Burkholderia
            rhizoxinica HKI 454]
 gi|312166873|emb|CBW73876.1| Ribonucleoside-diphosphate reductase alpha chain (EC 1.17.4.1)
            [Burkholderia rhizoxinica HKI 454]
          Length = 1046

 Score =  983 bits (2540), Expect = 0.0,   Method: Composition-based stats.
 Identities = 556/1002 (55%), Positives = 701/1002 (69%), Gaps = 58/1002 (5%)

Query: 1    MHPSKDVNKGDEDAFPSL----------AYPFPEK-IKGVQVIKRNGGVTSFDPSKISRA 49
            M  +++V      A   L              P+  +   +VI+RNG V SF+PSKI+ A
Sbjct: 55   MQTTENVTSQQPSAAAGLPHGGGAAHGARALAPQATLADYKVIRRNGSVVSFEPSKIAIA 114

Query: 50   IMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQS 109
            + KAF+AV G   + S RV++ ++ LT+  V  L++   +    HIEDIQDQVE +LM++
Sbjct: 115  VTKAFLAVNGGQGAASARVRESVETLTQAVVRALVRSRPNGGTFHIEDIQDQVELALMRA 174

Query: 110  GHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEA 169
            G H + R YVLYRE+R+  RA   H  +  P    L +  D+G +   +   L  ++  A
Sbjct: 175  GEHNVARAYVLYREKRAAERA---HEVAQQPAQGGLNV-NDNGIVRPLDLAALRNVITAA 230

Query: 170  CSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKL 228
            C GL + VS++ +++ET KN+YDG+  S +  + I ++RT+IEKEP Y++VTAR LL  +
Sbjct: 231  CDGLGEAVSAEPIVAETVKNLYDGVPLSQVYDSAILAARTMIEKEPAYSQVTARLLLHTI 290

Query: 229  RREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYE 288
            RRE+L       ++    EM   Y EYF ++++ GV+A LL E ++ FDL  L + L   
Sbjct: 291  RREILG------EEVLQSEMGARYAEYFPQFLKRGVEAELLDEKLLQFDLKKLGDALDAS 344

Query: 289  RDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSS 348
            RD  F YLGLQ LYDRYFLH++G RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LS+
Sbjct: 345  RDLKFGYLGLQTLYDRYFLHVDGQRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLST 404

Query: 349  FHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVR 408
            F FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR
Sbjct: 405  FDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLEGIYEALKENALLSKFAGGLGNDWTRVR 464

Query: 409  GLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKN 468
             LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKN
Sbjct: 465  ALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKN 524

Query: 469  TGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ 528
            TGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +
Sbjct: 525  TGDDRRRTHDMNTANWIPDLFMKRVIEGGDWTLFSPSSCPDLHDKFGAEFEQAYVAYEEK 584

Query: 529  ADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEI 588
            A RGE+K+F+KI A  LWRKML MLFETGHPWITFKDPC +RSPQQHVGVVHSSNLCTEI
Sbjct: 585  AARGELKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPCXVRSPQQHVGVVHSSNLCTEI 644

Query: 589  TLNSSSEETAVCNLGSINLLAHFAN-----NQFDYDKLASTIRTAVRVLDNVIDINCHTI 643
            TLN+S  E AVCNLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + +
Sbjct: 645  TLNTSDNEIAVCNLGSVNLVAHMKQGADXGYVLDHDKLKRTISVAMRMLDNVIDINYYAV 704

Query: 644  EKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQ 703
             KA+ SN  HR +G+G+MGFQ  LHLL  PYAS +AVE AD SME I ++A  AS ELA 
Sbjct: 705  AKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASQQAVEFADRSMEAICYYAYWASTELAS 764

Query: 704  ERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSN 762
            ERG YSS++GSLWD+G+ P D++ LLA+ R   + ++ +  + W  L++R+ T GMRNSN
Sbjct: 765  ERGRYSSYRGSLWDRGILPQDTLKLLADSRGGYVEVDSSETMDWAALRERIATHGMRNSN 824

Query: 763  CMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMIS 822
            C+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK R LWDE M++
Sbjct: 825  CVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKARGLWDEVMVA 884

Query: 823  DLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSG 882
            DLKY DGS+  I+RIP DL++ +ATAFE+DP WL+E+A+RRQKWIDQAQSLN+Y+   SG
Sbjct: 885  DLKYFDGSLARIDRIPADLRETYATAFEVDPKWLVEAAARRQKWIDQAQSLNIYMAGASG 944

Query: 883  KKLDFIYRQAWLMGLKTTYYLRSRSATSVEKST------------------------LKG 918
            KKLD IY+ AWL GLKTTYYLR+ +AT VEKST                        + G
Sbjct: 945  KKLDEIYKLAWLRGLKTTYYLRTIAATHVEKSTVAHGALNAVPSSDGGVGAMHGAGGVSG 1004

Query: 919  VDGKLNAVPVTDPNSSTHSLGIPSSCTSDT------ECEVCQ 954
                 NA      ++ +        C          ECE CQ
Sbjct: 1005 SATARNAGVHAAADAGSQDEIAGPVCMLRPGDAGFDECEACQ 1046


>gi|307731038|ref|YP_003908262.1| ribonucleoside-diphosphate reductase subunit alpha [Burkholderia
           sp. CCGE1003]
 gi|307585573|gb|ADN58971.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. CCGE1003]
          Length = 1000

 Score =  982 bits (2538), Expect = 0.0,   Method: Composition-based stats.
 Identities = 557/933 (59%), Positives = 693/933 (74%), Gaps = 25/933 (2%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
            +    +G++   P   Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G   
Sbjct: 18  QTFGQAQGNQALAPQATY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQG 71

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S RV+++++ LT+  V  LL+   +    HIEDIQDQVE +LM+ G H + R YVLYR
Sbjct: 72  AASARVRELVEQLTQNVVRALLRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLYR 131

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIV 181
           E+R+  RA   H +  A   P L +  D+G     +   L  I+E AC+ L D VS++ +
Sbjct: 132 EKRTQARA---HDEQAAGSTPGLSVT-DNGVTRPLDMAALRGIIESACANLGDAVSAEPI 187

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           ++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       +
Sbjct: 188 VAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREIL------EE 241

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           + T  EM   Y EYF ++I+ GV+A LL + ++ FDL  L   L   RD  F YLGLQ L
Sbjct: 242 EVTQAEMGERYAEYFPQFIKRGVQAELLDDKLLQFDLKRLGAALDANRDLQFGYLGLQTL 301

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLH +G RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFNS
Sbjct: 302 YDRYFLHHDGVRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLFNS 361

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GTR  QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKS
Sbjct: 362 GTRRSQLSSCYLTTVDDDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKS 421

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT
Sbjct: 422 QGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNT 481

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+KI 
Sbjct: 482 ANWIPDLFMKRVMEGGDWTLFSPSTCPDLHDKFGAEFEAAYTAYEDKVARGEIKLFKKIP 541

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCN
Sbjct: 542 AAQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCN 601

Query: 602 LGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAI 656
           LGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  HR +
Sbjct: 602 LGSVNLVAHLKEQADGTLALDHDKLKRTISVAMRMLDNVIDINYYAVAKARNSNLKHRPV 661

Query: 657 GLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLW 716
           G+G+MGFQ  LHLL  PYAS EAV+ AD SME + ++A  AS ELA+ERG YSS++GSLW
Sbjct: 662 GMGIMGFQDCLHLLRTPYASEEAVKFADTSMEAVCYYAYYASTELAEERGRYSSYRGSLW 721

Query: 717 DQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANI 775
           D+G+ P DS+ LLAE R   + ++ +  + W EL++R+ T GMRNSNC+AIAPTATI+NI
Sbjct: 722 DRGILPQDSVKLLAEARGGYVEVDSSESMDWSELRQRIATYGMRNSNCIAIAPTATISNI 781

Query: 776 CGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIE 835
            GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DG++  I+
Sbjct: 782 IGVSACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGTLSRID 841

Query: 836 RIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLM 895
           RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD IY+ AW+ 
Sbjct: 842 RIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEIYKLAWVR 901

Query: 896 GLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPV 928
           GLKTTYYLR+ +AT VEKST+    G LNAV  
Sbjct: 902 GLKTTYYLRTMAATHVEKSTV--AHGALNAVSS 932


>gi|53720600|ref|YP_109586.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei K96243]
 gi|53726101|ref|YP_104056.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           mallei ATCC 23344]
 gi|67643594|ref|ZP_00442339.1| ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide
           reductase) [Burkholderia mallei GB8 horse 4]
 gi|76810342|ref|YP_334882.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 1710b]
 gi|121601276|ref|YP_991781.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           mallei SAVP1]
 gi|124384186|ref|YP_001027274.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           mallei NCTC 10229]
 gi|126439753|ref|YP_001060485.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 668]
 gi|126448585|ref|YP_001082789.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           mallei NCTC 10247]
 gi|126454560|ref|YP_001067749.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 1106a]
 gi|134280283|ref|ZP_01766994.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 305]
 gi|166998594|ref|ZP_02264452.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei PRL-20]
 gi|167825889|ref|ZP_02457360.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 9]
 gi|217420768|ref|ZP_03452273.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 576]
 gi|226196789|ref|ZP_03792368.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|237813880|ref|YP_002898331.1| ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide
           reductase) [Burkholderia pseudomallei MSHR346]
 gi|242315545|ref|ZP_04814561.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1106b]
 gi|254178878|ref|ZP_04885532.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei ATCC 10399]
 gi|254180585|ref|ZP_04887183.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1655]
 gi|254190978|ref|ZP_04897484.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254199123|ref|ZP_04905538.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei S13]
 gi|254202775|ref|ZP_04909138.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei FMH]
 gi|254208117|ref|ZP_04914467.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei JHU]
 gi|254257988|ref|ZP_04949042.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1710a]
 gi|254299328|ref|ZP_04966778.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 406e]
 gi|52211014|emb|CAH37002.1| putative ribonucleoside reductase [Burkholderia pseudomallei
           K96243]
 gi|52429524|gb|AAU50117.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei ATCC 23344]
 gi|76579795|gb|ABA49270.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1710b]
 gi|121230086|gb|ABM52604.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei SAVP1]
 gi|124292206|gb|ABN01475.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei NCTC 10229]
 gi|126219246|gb|ABN82752.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 668]
 gi|126228202|gb|ABN91742.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1106a]
 gi|126241455|gb|ABO04548.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei NCTC 10247]
 gi|134248290|gb|EBA48373.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 305]
 gi|147747022|gb|EDK54099.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei FMH]
 gi|147752011|gb|EDK59078.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei JHU]
 gi|157809187|gb|EDO86357.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 406e]
 gi|157938652|gb|EDO94322.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160694792|gb|EDP84800.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei ATCC 10399]
 gi|169656953|gb|EDS88350.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei S13]
 gi|184211124|gb|EDU08167.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1655]
 gi|217396180|gb|EEC36197.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 576]
 gi|225931049|gb|EEH27057.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|237505593|gb|ACQ97911.1| ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide
           reductase) [Burkholderia pseudomallei MSHR346]
 gi|238524966|gb|EEP88396.1| ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide
           reductase) [Burkholderia mallei GB8 horse 4]
 gi|242138784|gb|EES25186.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1106b]
 gi|243065277|gb|EES47463.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei PRL-20]
 gi|254216677|gb|EET06061.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1710a]
          Length = 995

 Score =  982 bits (2537), Expect = 0.0,   Method: Composition-based stats.
 Identities = 557/994 (56%), Positives = 701/994 (70%), Gaps = 56/994 (5%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPFAGGAQGAPALASQTTY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQTVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A     ++A  A  + +  D+G   + +   L  ++  AC GL D VS +
Sbjct: 131 REKRHLERVHAGEAEAAEASPAGGINVT-DNGVTRALDLNALRALIVSACEGLGDAVSPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMTQVYDSSILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMTTRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGSYALDEEKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS EAVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASDEAVEFADRSMEAVCYYAYWASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPALRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPN--------------------- 932
           L GLKTTYYLR+ +AT VEKST+    G LNAVP +                        
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTSGGTSGGAAGGAQGAAGGFGAAGGD 961

Query: 933 ------SSTHSLGIPSSCTSDT------ECEVCQ 954
                 ++         CT         ECE CQ
Sbjct: 962 APSGAMNAAPVEADGPVCTMRPGDPGFEECEACQ 995


>gi|319791702|ref|YP_004153342.1| ribonucleoside-diphosphate reductase, alpha subunit [Variovorax
           paradoxus EPS]
 gi|315594165|gb|ADU35231.1| ribonucleoside-diphosphate reductase, alpha subunit [Variovorax
           paradoxus EPS]
          Length = 971

 Score =  981 bits (2536), Expect = 0.0,   Method: Composition-based stats.
 Identities = 540/972 (55%), Positives = 701/972 (72%), Gaps = 35/972 (3%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           PS  V +  +    +   P  + +   Q+I+RNG V  F+P+KI+ A+MKAF+AV G   
Sbjct: 15  PSTPVQQQRD----TAGSPTGQNLAHYQIIRRNGAVVPFEPNKIAIAMMKAFLAVHGTQG 70

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S  V++ +  LT+  +  +++        HIED+QDQVE  LM+ GHH+I R YVLYR
Sbjct: 71  AASASVRETVDVLTQGVIRAMVRSRPGGGTFHIEDVQDQVELGLMRGGHHEIARAYVLYR 130

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIV 181
           E R+  R+     + +AP  P L ++ D+G  ++ +  +L+ ++E AC  L D +++  +
Sbjct: 131 ERRTQERS--KQVEQEAPATPTLHVL-DNGERVALDLNQLKGLIESACENLGDSITAAPI 187

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           ++ET +N+YDG+   ++  A I ++RTLIEK+P+Y   TAR LL  + +E++        
Sbjct: 188 VAETMRNLYDGVPLDEVYKASILAARTLIEKDPDYTFATARLLLHTIFKEIIGREVMPVD 247

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           +AT       Y +YF ++I++GV+  LL E ++ +DL  L   LK ERD  F+YLGLQ L
Sbjct: 248 RAT------AYADYFPQFIKKGVENDLLDEKLLQYDLPRLGAALKAERDNQFDYLGLQTL 301

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLH+  +RIE+PQAFFMRVAMGL+L E ++E RA+EFY +LSSF FM STPTLFN+
Sbjct: 302 YDRYFLHVRKTRIELPQAFFMRVAMGLSLGEIDREARAIEFYEVLSSFDFMSSTPTLFNA 361

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT   QLSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LG+HI GTNG+S
Sbjct: 362 GTLRSQLSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGSHIKGTNGES 421

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRTHDMNT
Sbjct: 422 QGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRTHDMNT 481

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFM+RV +   WTLFSP  V DLHDL+G +FE AY  YE +A RGEIK  R I 
Sbjct: 482 ANWIPDLFMRRVMEKGTWTLFSPSNVPDLHDLFGADFEKAYVAYEEKAARGEIKPARTIQ 541

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A  LWRKMLTMLFETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+S  ETAVCN
Sbjct: 542 ASDLWRKMLTMLFETGHPWITFKDACNVRSPQQHAGVVHSSNLCTEITLNTSDTETAVCN 601

Query: 602 LGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLM 661
           LGS+NLL H  + + D +KL  TI TA+R+LDNVIDIN + ++KA+ SN  HR +GLGLM
Sbjct: 602 LGSVNLLQHLKDGKVDQEKLKRTISTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGLM 661

Query: 662 GFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVF 721
           GFQ AL+ L IPYAS EAV+ ADESME I +HA  AS ELA+ERG YSS+KGSLWD+G+ 
Sbjct: 662 GFQDALYELRIPYASQEAVQFADESMEAICYHAYWASTELAKERGKYSSYKGSLWDKGIL 721

Query: 722 PIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           PID++ LL + R   + ++R++ L WD L+ ++K  GMRNSNC+AIAPTATI+NI GV  
Sbjct: 722 PIDTLDLLEQARGGYVEVDRSATLDWDALRAKIKADGMRNSNCVAIAPTATISNIIGVDA 781

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SI+P + NL VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P D
Sbjct: 782 SIEPCFGNLSVKSNLSGEFTVINHYLVRDLKRLGLWDDVMVMDLKHFDGSLRPIDRVPQD 841

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           +K ++ATAFE++  WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTT
Sbjct: 842 VKALYATAFEVETTWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTT 901

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSST------------------HSLGIPS 942
           YYLR++SAT  EKST++   G+LNAV   +   S                    +  I  
Sbjct: 902 YYLRTQSATHAEKSTVQ--SGRLNAVSSGNDAPSGMSALEAAAAAAKAQMSAMPATDIAF 959

Query: 943 SCTSDTECEVCQ 954
               D  CE CQ
Sbjct: 960 CGVDDPTCEACQ 971


>gi|332530700|ref|ZP_08406631.1| ribonucleotide-diphosphate reductase subunit alpha [Hylemonella
           gracilis ATCC 19624]
 gi|332039868|gb|EGI76263.1| ribonucleotide-diphosphate reductase subunit alpha [Hylemonella
           gracilis ATCC 19624]
          Length = 988

 Score =  981 bits (2536), Expect = 0.0,   Method: Composition-based stats.
 Identities = 528/985 (53%), Positives = 685/985 (69%), Gaps = 45/985 (4%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           +              A      +   Q+I+RNG V  F+PSKI+ A+MKAF+AV G   +
Sbjct: 15  ATTTLPQGASMTHGAALGANSALAHYQIIRRNGAVVPFEPSKIAVALMKAFLAVHGAQGA 74

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S  V++ +  LT+  V  L +        HIED+QDQVE  LM+ GHH++ R YVLYR 
Sbjct: 75  ASASVRETVDGLTQAVVRALTRSRPGGGTFHIEDVQDQVELGLMRGGHHEVARAYVLYRA 134

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVL 182
           +R++ R    H+   AP  P L +  D+G  ++ +  RL+ ++E AC+ L  DV +  ++
Sbjct: 135 KRAEER--AQHAAQAAPQTPVLHVT-DNGQRVALDLNRLQRLIESACANLSADVKADPIV 191

Query: 183 SETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQK 242
           +ET +N+YDG+   ++  A I ++RTLIEK+P+Y   TAR L   + +EVL       + 
Sbjct: 192 AETLRNLYDGVPLEEVYKAAILAARTLIEKDPDYTYATARLLFHTIAKEVLG------RD 245

Query: 243 ATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILY 302
               EM+  Y +YF  +I++GV A LL+  ++ +DL  L   LK ERD  F+YLGLQ LY
Sbjct: 246 VQPSEMKQAYADYFPGFIKKGVDAELLNPELLQYDLKRLGAALKSERDQQFDYLGLQTLY 305

Query: 303 DRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSG 362
           DRYFLH+  +RIE+PQAFFMRVAMGLAL E ++E RA+EFY +LSSF FM STPTLFNSG
Sbjct: 306 DRYFLHVKKTRIELPQAFFMRVAMGLALNEIDREARAIEFYEVLSSFDFMSSTPTLFNSG 365

Query: 363 TRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQ 422
           T   QLSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LG+HI GTNG+SQ
Sbjct: 366 TLRSQLSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGSHIKGTNGESQ 425

Query: 423 GVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTA 482
           GV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTA
Sbjct: 426 GVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTA 485

Query: 483 NWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISA 542
           NWIPDLFM+RV +   WTLFSP +  DLHDL+G  FE AY  YE +A RGE+K  + + A
Sbjct: 486 NWIPDLFMRRVMEKGEWTLFSPSDAPDLHDLFGSAFEKAYVAYEAKAKRGELKPSKTVPA 545

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
           + LWRKML+MLFETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+S  ETAVCNL
Sbjct: 546 IDLWRKMLSMLFETGHPWITFKDACNVRSPQQHAGVVHSSNLCTEITLNTSDTETAVCNL 605

Query: 603 GSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           GS+NL  H  + + D++KL  TI TA+R+LDNVIDIN + ++KA+ SN  HR +GLG+M 
Sbjct: 606 GSVNLKQHITDGKLDHEKLKKTISTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGVMA 665

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ AL+ + IPYAS  AV+ ADESME I ++A  AS ELA+ERG YSS++GSLW +G+ P
Sbjct: 666 FQDALYEMRIPYASDAAVQFADESMEAICYYAYWASTELARERGVYSSYQGSLWSKGILP 725

Query: 723 IDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
            D++ LLA  R   + ++R++ L W+ L+K++   GMRNSNC+AIAPTATI+NI GV  S
Sbjct: 726 PDTLELLARERGGYVEVDRSATLDWELLRKKIAADGMRNSNCVAIAPTATISNIIGVDAS 785

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P + NL VKSN+SG+FT++N +LV +LK+  LWDE M+ DLK+ DGS+  I+R+P D+
Sbjct: 786 IEPCFGNLSVKSNLSGEFTIINGYLVKDLKRLGLWDEVMVMDLKHFDGSLLPIDRVPQDI 845

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           K ++ATAFE++P WL+E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW  GLKTTY
Sbjct: 846 KALYATAFEVEPSWLVEAAARRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWTRGLKTTY 905

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHS------------------------ 937
           YLR+ SAT  EKST+    G+LNAV      +   +                        
Sbjct: 906 YLRTTSATQAEKSTV--AAGRLNAVSSGSSETGAAAMAPVTSKPASAKKVSALEAAAAAA 963

Query: 938 --------LGIPSSCTSDTECEVCQ 954
                     I      D  CE CQ
Sbjct: 964 QTQMAVAATDIKFCAIDDPGCEACQ 988


>gi|120609558|ref|YP_969236.1| ribonucleotide-diphosphate reductase subunit alpha [Acidovorax
           citrulli AAC00-1]
 gi|120588022|gb|ABM31462.1| ribonucleoside-diphosphate reductase, alpha subunit [Acidovorax
           citrulli AAC00-1]
          Length = 983

 Score =  981 bits (2535), Expect = 0.0,   Method: Composition-based stats.
 Identities = 534/988 (54%), Positives = 682/988 (69%), Gaps = 43/988 (4%)

Query: 1   MHPSKDVNKGDEDAFPSLAYPFPE--KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVE 58
           + PS      D+        P      +   Q+I+RNG V  F+P KI+ A+MKAF+AV 
Sbjct: 5   LSPSSATTAPDQTPTAQGTEPAAGGHPLSHYQIIRRNGAVVPFEPQKIAVAMMKAFLAVH 64

Query: 59  GKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREY 118
           G   + S  V++ +  LT+  V  L++        HIED+QD VE SLM+ GHH++ R Y
Sbjct: 65  GTQGAASASVRETVDTLTQSVVRALMRSRPGGGTFHIEDVQDNVELSLMRGGHHEVARAY 124

Query: 119 VLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVS 177
           VLYRE R+  RA Q H +   P  P L ++ D+G  +  +  RL  +++ AC+ L  DV 
Sbjct: 125 VLYRERRTQERAHQQHDRQPVPSTPVLHVI-DNGQRVPLDEARLRGLIDSACANLGADVH 183

Query: 178 SKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVY 237
           +  +++ET +N+YDG+   ++  A I ++RTLIEK+P+Y   TAR LL  + REVL    
Sbjct: 184 AAPIVAETLRNLYDGVPMDEVYKASILAARTLIEKDPDYTYATARLLLHTIVREVLGQ-- 241

Query: 238 KKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLG 297
                    +M   Y  YF ++I++GV   LL   ++ +DLV L   L   RD  F+YLG
Sbjct: 242 ----DVVPADMGPAYAAYFPQFIQKGVDNELLDPRLLQYDLVRLGAALDAGRDQQFDYLG 297

Query: 298 LQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPT 357
           LQ LYDRYFLH+  +RIE+PQ FFMRVAMGLAL E ++E RA+EFY +LSSF FM STPT
Sbjct: 298 LQTLYDRYFLHVRKTRIELPQCFFMRVAMGLALNEPDREARAIEFYEVLSSFDFMSSTPT 357

Query: 358 LFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGT 417
           LFNSGT   QLSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LG+HI GT
Sbjct: 358 LFNSGTLRSQLSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGSHIKGT 417

Query: 418 NGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTH 477
           NG+SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRTH
Sbjct: 418 NGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRTH 477

Query: 478 DMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVF 537
           DMNTANWIPDLFM+RV +   WTLFSP  V DLHDL+G +FE AY  YE +A RGEIK  
Sbjct: 478 DMNTANWIPDLFMRRVMEKGTWTLFSPSSVPDLHDLFGADFEKAYVAYEEKAARGEIKPS 537

Query: 538 RKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEET 597
           R + A  LWRK+LTMLFETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+S  ET
Sbjct: 538 RTVQATDLWRKILTMLFETGHPWITFKDACNVRSPQQHAGVVHSSNLCTEITLNTSDAET 597

Query: 598 AVCNLGSINLLAHFANNQF----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTH 653
           AVCNLGS+NL+ H  +       D+ KL  TI TA+R+LDNVIDIN + +EKA+ SN  H
Sbjct: 598 AVCNLGSVNLVRHLKDGPNGKELDHAKLRKTISTAMRMLDNVIDINYYAVEKARNSNMRH 657

Query: 654 RAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKG 713
           R +GLGLM FQ +L+ L IPYAS  AVE AD SME I ++A  AS ELAQERG YSS+ G
Sbjct: 658 RPVGLGLMAFQDSLYELRIPYASQAAVEFADRSMEAICYYAYWASTELAQERGKYSSYPG 717

Query: 714 SLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
           SLWD+G+ PID++ LL + R   + ++R + L WD L++++   GMRNSNC+AIAPTATI
Sbjct: 718 SLWDRGILPIDTLDLLEKARGGYVEVDRAATLDWDALRQKIARDGMRNSNCVAIAPTATI 777

Query: 773 ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
           +NI GV  SI+PS+ NL VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+  GS+ 
Sbjct: 778 SNIVGVDASIEPSFGNLSVKSNLSGEFTVINGYLVRDLKRLGLWDDVMVMDLKHFKGSLH 837

Query: 833 NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
            I+R+P D+K +++TAFE+ P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ A
Sbjct: 838 PIDRVPQDVKALYSTAFEVAPTWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDETYKLA 897

Query: 893 WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHS--------------- 937
           W+ GLKTTYYLR++SAT VE ST+     +LNAV     ++   +               
Sbjct: 898 WVRGLKTTYYLRTQSATHVEMSTVNTR--QLNAVSSGSDSAMQAAGTGAARPSALDAAAA 955

Query: 938 -----------LGIPSSCTSDTECEVCQ 954
                        +      D  CE CQ
Sbjct: 956 AAQSQAAALPATDVKFCAIDDPTCEACQ 983


>gi|309783063|ref|ZP_07677782.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia sp.
           5_7_47FAA]
 gi|308918171|gb|EFP63849.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 994

 Score =  981 bits (2535), Expect = 0.0,   Method: Composition-based stats.
 Identities = 563/993 (56%), Positives = 694/993 (69%), Gaps = 52/993 (5%)

Query: 2   HPSK-DVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK 60
           +PS+   + G     P  A      +   ++I+RNG V SF+PSKI+ A+ KAF+AV G 
Sbjct: 14  NPSQFAQSAGGTAVAPGTASGV--NLADYKIIRRNGAVVSFEPSKIAVAMTKAFLAVNGG 71

Query: 61  GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL 120
             + S RV++++   T+  V  LL+   +    HIED+QDQVE +LM+SG H + R YVL
Sbjct: 72  QGAASARVRELVDQQTQNVVRALLRSRPNGGTFHIEDVQDQVELALMRSGEHDVARAYVL 131

Query: 121 YREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           YRE R+  RA    +    P    L +  D G     +   L  ++  AC GL + V  +
Sbjct: 132 YRERRAQERAQAGET-QQQPAFIGLNVT-DGGISRPLDMAALRNVIVSACEGLGEAVDPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +L ET KN+Y+G+  + +  + I +SRTLIEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PILKETVKNLYEGVPMTQVYDSAILASRTLIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y +YF ++IE G+ A LL + +  FDL  L   L   RDF F YLGLQ
Sbjct: 245 -EEVTQAEMSTRYVDYFPQFIERGINAELLDDKLAQFDLARLGAALDASRDFQFNYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLHIN +RIEMPQAFFMRVAMGLAL E ++E RA+EFY LLSSF FM STPTLF
Sbjct: 304 TLYDRYFLHINETRIEMPQAFFMRVAMGLALNEIDREARAIEFYQLLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVSDDLDGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV +   WTLFSP    DLHD  GK FE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGGEWTLFSPSTCPDLHDKVGKAFEQAYLAYEDKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           + A+ LWRKML MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AV
Sbjct: 544 MPALQLWRKMLGMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH           D++KL  T+RTA+R+LDNVIDIN + ++KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLVKQPDGSVVLDHEKLKKTVRTAMRMLDNVIDINYYAVKKARDSNLRHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +G+G+MGFQ ALH+L +PYAS  AV+ AD SME + ++A  AS ELA+ERG YSS+KGS
Sbjct: 664 PVGMGIMGFQDALHVLRVPYASEAAVQFADTSMEAVCYYAYWASTELAEERGRYSSYKGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P DS+ LLAE R   L  + +S + WD L+ R+K  GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDSLKLLAEERGGYLEADMSSTMDWDSLRGRIKQYGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P+YQNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DGS+  
Sbjct: 784 NIIGVSACIEPTYQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGSLAR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ ++ATAFE++P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW
Sbjct: 844 IDRIPQDLRDLYATAFEVEPQWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTH----------------- 936
           L GLKTTYYLR+  AT VEKST+    G LNAV                           
Sbjct: 904 LRGLKTTYYLRTIGATHVEKSTVSR--GTLNAVSSGSDVGGVSAAGASGVTSAAPTSALD 961

Query: 937 ---------SLGIPSSCTSDT------ECEVCQ 954
                         + CT         ECE CQ
Sbjct: 962 AAAATAQAMPEAEGAVCTMRPGDPGFEECEACQ 994


>gi|241664220|ref|YP_002982580.1| ribonucleotide-diphosphate reductase subunit alpha [Ralstonia
           pickettii 12D]
 gi|240866247|gb|ACS63908.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           pickettii 12D]
          Length = 994

 Score =  980 bits (2534), Expect = 0.0,   Method: Composition-based stats.
 Identities = 563/993 (56%), Positives = 694/993 (69%), Gaps = 52/993 (5%)

Query: 2   HPSK-DVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK 60
           +PS+   + G     P  A      +   ++I+RNG V SF+PSKI+ A+ KAF+AV G 
Sbjct: 14  NPSQFAQSAGGTAVAPGTASGV--NLADYKIIRRNGAVVSFEPSKIAVAMTKAFLAVNGG 71

Query: 61  GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL 120
             + S RV++++   T+  V  LL+   +    HIED+QDQVE +LM+SG H + R YVL
Sbjct: 72  QGAASARVRELVDQQTQNVVRALLRSRPNGGTFHIEDVQDQVELALMRSGEHDVARAYVL 131

Query: 121 YREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           YRE R+  RA    +    P    L +  D G     +   L  ++  AC GL D V  +
Sbjct: 132 YRERRAQERAQAGET-QQQPAFIGLNVT-DGGISRPLDMVALRNVIVSACEGLGDAVDPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +L ET KN+Y+G+  + +  + I +SRTLIEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PILKETVKNLYEGVPMTQVYDSAILASRTLIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y +YF ++I+ G+ A LL + +  FDL  L   L   RDF F YLGLQ
Sbjct: 245 -EEVTQAEMSTRYVDYFPQFIKRGINAELLDDKLAQFDLARLGAALDASRDFQFNYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLHIN +RIEMPQAFFMRVAMGLAL E ++E RA+EFY LLSSF FM STPTLF
Sbjct: 304 TLYDRYFLHINETRIEMPQAFFMRVAMGLALNEIDREARAIEFYQLLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVSDDLDGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV +   WTLFSP    DLHD  GK FE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGGEWTLFSPSTCPDLHDKVGKAFEQAYLAYEDKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           + A+ LWRKML MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AV
Sbjct: 544 MPALQLWRKMLGMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH           D++KL  T+RTA+R+LDNVIDIN + ++KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLVKQADGSVVLDHEKLKKTVRTAMRMLDNVIDINYYAVKKARDSNLRHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +G+G+MGFQ ALH+L +PYAS  AV+ AD SME + ++A  AS ELA+ERG YSS+KGS
Sbjct: 664 PVGMGIMGFQDALHVLRVPYASEAAVQFADTSMEAVCYYAYWASTELAEERGRYSSYKGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P DS+ LLAE R   L  + +S + WD L+ R+K  GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDSLKLLAEERGGYLEADMSSTMDWDSLRGRIKQYGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P+YQNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DGS+  
Sbjct: 784 NIIGVSACIEPTYQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGSLAR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ ++ATAFE++P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW
Sbjct: 844 IDRIPQDLRDLYATAFEVEPQWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTH----------------- 936
           L GLKTTYYLR+  AT VEKST+    G LNAV                           
Sbjct: 904 LRGLKTTYYLRTIGATHVEKSTVSR--GTLNAVSSGSDVGGVSAAGASGVTSAAPTSALD 961

Query: 937 ---------SLGIPSSCTSDT------ECEVCQ 954
                         + CT         ECE CQ
Sbjct: 962 AAAATAQAMPEAEGAVCTMRPGDPGFEECEACQ 994


>gi|113869189|ref|YP_727678.1| ribonucleotide-diphosphate reductase subunit alpha [Ralstonia
           eutropha H16]
 gi|113527965|emb|CAJ94310.1| Ribonucleoside-diphosphate reductase alpha subunit [Ralstonia
           eutropha H16]
          Length = 977

 Score =  980 bits (2534), Expect = 0.0,   Method: Composition-based stats.
 Identities = 556/977 (56%), Positives = 700/977 (71%), Gaps = 36/977 (3%)

Query: 6   DVNKGDEDAFPSLAYPFPEKI----KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
                     P+                ++I+RNG V +F+PSKI+ A+ KAF+AV G  
Sbjct: 9   TTGGAAAGIAPTAQQTPANAANTNYPDHKIIRRNGAVVAFEPSKIAVAMTKAFLAVNGGQ 68

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV++I++ LT+  V  L++   +   +HIED+QD VE +LM+SG H++ R YVLY
Sbjct: 69  GAASARVREIVEQLTDNVVRALVRSRPNGGAIHIEDVQDHVELALMRSGEHEVARAYVLY 128

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDG-TLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R D RA  +           + + + DG      +   L  +++ ACSGL + VS++
Sbjct: 129 REKRKDERAQANAQAVARVQEGGISVNVTDGGVTHVLDIAALHDLIDNACSGLGNAVSAE 188

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +L ET KN+YDG+  + +  + I ++RTLIEK+P+Y++VTAR LL  +R+E+L T    
Sbjct: 189 PILKETLKNLYDGVPMTQVYDSAILAARTLIEKDPDYSQVTARILLHTIRKEILGT---- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
             + T  EM   Y EYF ++I  G++A LL E +  FDL  L   L   RDF F YLGLQ
Sbjct: 245 --EVTQAEMSTRYAEYFPKFIARGIEAELLDEQLATFDLARLGAALDAGRDFQFNYLGLQ 302

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLHI+ +RIEMPQAFFMRVAMGLAL E ++E RA+EFY LLSSF FM STPTLF
Sbjct: 303 TLYDRYFLHIDETRIEMPQAFFMRVAMGLALNEKDREARAIEFYQLLSSFDFMSSTPTLF 362

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 363 NSGTRRSQLSSCYLTTVSDDLEGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNG 422

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 423 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDM 482

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV +   WTLFSP    DLHD  GKEFE AY  YE +A  GE+K+F+K
Sbjct: 483 NTANWIPDLFMKRVMEGGEWTLFSPATCPDLHDKVGKEFEKAYLGYEAKAASGELKLFKK 542

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           + A+ LWRKML MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AV
Sbjct: 543 LPALQLWRKMLGMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNESEIAV 602

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D+ KL  T+RTA+R+LDNVIDIN + ++KA+ SN  HR
Sbjct: 603 CNLGSVNLVAHMAKQADGTYALDHAKLQKTVRTAMRMLDNVIDINYYAVDKARNSNLRHR 662

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +G+G+MGFQ  LH+L  PY+S  AV+ AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 663 PVGMGIMGFQDCLHVLRTPYSSDAAVKFADTSMEAVCYYAYHASTELAEERGRYSSYEGS 722

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P DS+ LLAE R   L ++ ++ + WD L+ R+K  GMRNSNC+AIAPTATI+
Sbjct: 723 LWDRGILPQDSLKLLAEERGGYLDVDMSATMDWDALRARIKQHGMRNSNCIAIAPTATIS 782

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DGS+  
Sbjct: 783 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKERGLWDEVMVADLKYFDGSLSR 842

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE++P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW
Sbjct: 843 IDRIPQDLRDIYATAFEVEPTWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAW 902

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSS----------THSLGIPSS 943
           + GLKTTYYLR+ +AT VEKST+    G LNAV     + S                 + 
Sbjct: 903 VRGLKTTYYLRTMAATHVEKSTVSR--GSLNAVSSGSDSGSALDAAAASAPAMPEAEGAV 960

Query: 944 CTSDT------ECEVCQ 954
           CT         ECE CQ
Sbjct: 961 CTMRPGDPGFEECEACQ 977


>gi|171057073|ref|YP_001789422.1| ribonucleotide-diphosphate reductase subunit alpha [Leptothrix
           cholodnii SP-6]
 gi|170774518|gb|ACB32657.1| ribonucleoside-diphosphate reductase, alpha subunit [Leptothrix
           cholodnii SP-6]
          Length = 958

 Score =  980 bits (2533), Expect = 0.0,   Method: Composition-based stats.
 Identities = 543/945 (57%), Positives = 685/945 (72%), Gaps = 18/945 (1%)

Query: 19  AYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQ 78
           A        G Q+I+RNG V +F+P KI+ A+MKAF+AV G   + S  V++ +  LTE 
Sbjct: 23  AAANASAYVGYQIIRRNGAVVAFEPHKITVALMKAFLAVHGTHGAASASVRETVDGLTEA 82

Query: 79  TVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSD 138
            V  L++   S    HIEDIQDQVE  LM+ GHH + R YVLYRE R+  RA+Q    + 
Sbjct: 83  VVRALMRSRPSGGSFHIEDIQDQVELGLMRGGHHDVARAYVLYRERRTQERASQGR--AP 140

Query: 139 APIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESD 197
               P + +    G  +  +  RL  ++E AC+ L  +     VL+ET +N+YDG+S  +
Sbjct: 141 VAAEPAVMVTDR-GQRVPLDMARLAGLIEAACADLGPEAIGAPVLAETRRNLYDGVSIDE 199

Query: 198 LETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFC 257
           +  A I ++RTLIEK+P+Y++VTAR L+  +RR+VL       ++ T  EM   Y +YF 
Sbjct: 200 VYKASILAARTLIEKDPSYSRVTARLLMHTIRRDVLG------EEVTQAEMAARYADYFP 253

Query: 258 RYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMP 317
            +I++GV A LL E M  FDL  L   LK ERD  F+YLGLQ LYDRYFLHI   RIEMP
Sbjct: 254 AFIKKGVDAELLDERMAQFDLARLGAALKAERDLNFDYLGLQTLYDRYFLHIRKQRIEMP 313

Query: 318 QAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVP 377
           QAFFMRVAMGLAL E ++E RA+EFY +LS+F FM STPTLFN+GTR  QLSSC+LTTVP
Sbjct: 314 QAFFMRVAMGLALNEIDREARAIEFYEVLSAFDFMSSTPTLFNAGTRRSQLSSCYLTTVP 373

Query: 378 DDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVA 437
           DDL GI+ A+++NA+L+K++GGLGNDWTPVR LG+HI GTNG+SQGV+PFLKV NDTAVA
Sbjct: 374 DDLEGIYDAIKDNALLSKFAGGLGNDWTPVRALGSHIKGTNGESQGVVPFLKVVNDTAVA 433

Query: 438 VNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNA 497
           VNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +  
Sbjct: 434 VNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGG 493

Query: 498 GWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETG 557
            WTLFSP    DLHDL+G  FE AY  YE +ADRGEI  F+++ AV LWRK+L+MLFETG
Sbjct: 494 DWTLFSPANCPDLHDLFGTAFEAAYTAYEARADRGEITFFKRVRAVDLWRKILSMLFETG 553

Query: 558 HPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFD 617
           HPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN+++ E AVCNLGS+NL  H  + + D
Sbjct: 554 HPWITFKDACNVRSPQQHVGVVHSSNLCTEITLNTNAGEIAVCNLGSVNLAQHVKDGEVD 613

Query: 618 YDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASP 677
             KL  T+ TA+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ AL+ L +PYAS 
Sbjct: 614 QAKLCRTVTTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGIMGFQDALYQLRVPYASN 673

Query: 678 EAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DEL 736
           EAVE AD SME + +HA  AS ELA ERG Y++++GSLWD+G+ PIDSI LLAE R   L
Sbjct: 674 EAVEFADRSMEAVCYHAYWASTELAAERGRYATYRGSLWDRGILPIDSIALLAEQRGGYL 733

Query: 737 AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
            ++  + L WD L+ R+   GMRNSNC+AIAPTATI+NI GV  SI+P + NL VKSN+S
Sbjct: 734 DVDTRTTLDWDALRARIAQYGMRNSNCVAIAPTATISNIIGVDASIEPCFGNLSVKSNLS 793

Query: 797 GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
           G+FTVVN +LV +LK   LWD+ M+ DLK+ DGS+  I+R+P++LK+++ATAFE++  WL
Sbjct: 794 GEFTVVNEYLVRDLKALGLWDDVMVMDLKHFDGSLRRIDRVPEELKRLYATAFEVETQWL 853

Query: 857 IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
           +E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+  AT  EKST+
Sbjct: 854 VEAAARRQKWIDQAQSLNIYMAGASGKKLDETYKLAWLRGLKTTYYLRTMGATHAEKSTV 913

Query: 917 KG-------VDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           K             +A      +S+  +  +      D  CE CQ
Sbjct: 914 KAGSMNAVSNGAHGSASEPAAVSSNEPATDVKFCAIDDPSCEACQ 958


>gi|170699975|ref|ZP_02891002.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           ambifaria IOP40-10]
 gi|170135123|gb|EDT03424.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           ambifaria IOP40-10]
          Length = 999

 Score =  980 bits (2533), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/997 (55%), Positives = 686/997 (68%), Gaps = 58/997 (5%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLGGTEQGAKALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV++ ++ LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVREQVEQLTHSVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKI 180
           RE+R   R       +    A     ++D+G     +   L  ++  AC+GL   V+ + 
Sbjct: 131 REKRHLERQHAGEEAAAGGEASAGINVVDNGVTRPLDMNALRELIVSACAGLGAAVNPEP 190

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       
Sbjct: 191 IVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG------ 244

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           ++    EM   Y EYF ++++ GV A LL + ++ FDL  L   L   RD  F YLGLQ 
Sbjct: 245 EEVLQAEMSTRYTEYFPQFLKRGVDAGLLDDKLLQFDLKRLGEALDANRDLQFGYLGLQT 304

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLH+ G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFN
Sbjct: 305 LYDRYFLHVEGTRIEMPQAFFMRVAMGLSLNEIDRETRAIEFYNVLSSFDFMSSTPTLFN 364

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGK
Sbjct: 365 SGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGK 424

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 425 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMN 484

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+KI
Sbjct: 485 TANWIPDLFMKRVMEGTDWTLFSPSTCPDLHDKFGAEFEAAYTAYEDKVARGEIKLFKKI 544

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVC
Sbjct: 545 PAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVC 604

Query: 601 NLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRA 655
           NLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  HR 
Sbjct: 605 NLGSVNLVAHLVKQADGSYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKHRP 664

Query: 656 IGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSL 715
           +G+G+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++GSL
Sbjct: 665 VGMGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRGSL 724

Query: 716 WDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
           WD+G+ P D++ LL E R   + ++ +  L W  L+ R+   GMRNSNC+AIAPTATI+N
Sbjct: 725 WDRGILPQDTLKLLTEARGGYVEVDTSESLDWTTLRSRIAAHGMRNSNCVAIAPTATISN 784

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           I GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  I
Sbjct: 785 IIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSRI 844

Query: 835 ERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWL 894
           +RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL
Sbjct: 845 DRIPADLRAIYATAFEVDPTWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKLAWL 904

Query: 895 MGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPV-------------------------- 928
            GLKTTYYLR+ +AT VEKST+    G LNAVP                           
Sbjct: 905 RGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTGGAGGGSSSGGAQGAAGGFGAAGGDA 962

Query: 929 -----TDPNSSTHSLGIPSSCTSDT------ECEVCQ 954
                    +          CT         ECE CQ
Sbjct: 963 SSGAVNAAAALAPVEADGPVCTMRPGDAGFDECEACQ 999


>gi|300309721|ref|YP_003773813.1| ribonucleoside reductase large subunit [Herbaspirillum seropedicae
           SmR1]
 gi|300072506|gb|ADJ61905.1| ribonucleoside reductase (large chain) oxidoreductase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 994

 Score =  980 bits (2532), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/980 (56%), Positives = 695/980 (70%), Gaps = 47/980 (4%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
            A           +   ++I+RNG V  F+PSKIS A+ KAF+AV G   + S RV++++
Sbjct: 24  SAESQAVASQTAGLGEYRIIRRNGAVVGFEPSKISIAVTKAFLAVNGGQGAASARVREMV 83

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
           + LT   V+ L++   +    HIEDIQDQVE +LM+SG H + R YVLYR +R + RA Q
Sbjct: 84  EQLTTNVVSALVRRQPTGGTFHIEDIQDQVELALMRSGEHDVARAYVLYRAKRMEERAQQ 143

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYD 191
             +     +AP+L +  +DG     +   +  ++  AC GL++ V  + +L+ET KN+YD
Sbjct: 144 GAATKTEVVAPQLHVT-EDGQSRPLDINEVRSLIAAACVGLEEHVDGEAILAETVKNLYD 202

Query: 192 GLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCL 251
           G+   +L  + I ++R L+EK+P Y++VT+R L+  +R+EV        ++    +    
Sbjct: 203 GVPVEELYKSAILAARALMEKDPAYSQVTSRLLMHTIRKEVFG------KEVAQADAPAE 256

Query: 252 YPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHING 311
           Y EYF +Y+++G++A LL   +  FDL  LA  LK ERD  F Y+GLQ LYDRYFLHI G
Sbjct: 257 YLEYFPQYVKKGIEAELLDTKLAQFDLAKLAAALKPERDLQFGYIGLQTLYDRYFLHIGG 316

Query: 312 SRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSC 371
           +RIEMPQAF+MRVAMGLAL E ++E RA+EFY+LLSSF FM STPTLFNSGT+  QLSSC
Sbjct: 317 TRIEMPQAFYMRVAMGLALNEIDRETRAIEFYDLLSSFDFMSSTPTLFNSGTQRSQLSSC 376

Query: 372 FLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVA 431
           +LTTV DDL GI+ A++ENA+LAK++GGLGNDWTPVR LGAHI GTNGKSQGV+PFLKV 
Sbjct: 377 YLTTVADDLDGIYEAIKENALLAKFAGGLGNDWTPVRALGAHIKGTNGKSQGVVPFLKVV 436

Query: 432 NDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMK 491
           NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMK
Sbjct: 437 NDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMK 496

Query: 492 RVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLT 551
           RV +   WTLFSP +  DLHD +G+ FE AY  YE +A RGE+K+F+K+ A  LWRKML+
Sbjct: 497 RVMEKGEWTLFSPSDTPDLHDKFGRAFEEAYTAYEAKAARGELKLFKKVQANDLWRKMLS 556

Query: 552 MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF 611
           MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL AH 
Sbjct: 557 MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLPAHL 616

Query: 612 ANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLH 671
            N + D+ KL  TIRTA+R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ  LH+  
Sbjct: 617 VNGELDHAKLQKTIRTAMRMLDNVIDINYYAVKKARDSNLRHRPVGMGIMGFQDCLHIKR 676

Query: 672 IPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAE 731
           +PYAS +AVE AD SME + ++A  AS ELA+ERG Y+S++GSLWD+G+ P DS+ LLA+
Sbjct: 677 VPYASMDAVEFADRSMEAVCYYAYMASTELAEERGRYASYRGSLWDRGILPQDSLKLLAQ 736

Query: 732 VRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
            R   L  + T  L W  L+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLY
Sbjct: 737 ERGGYLETDSTETLDWAALRARIAEHGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLY 796

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FT +N +LV +LK R LWDE M++DLKY DGS+  I+RIP DL+ I+ATAFE
Sbjct: 797 VKSNLSGEFTEINEYLVRDLKARGLWDEVMVADLKYFDGSLAKIDRIPQDLRDIYATAFE 856

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           +DP WL+E+ASRRQKWIDQAQSLN+Y+   SGK+LD  Y+ AWL GLKTTYYLR+  AT 
Sbjct: 857 VDPSWLVEAASRRQKWIDQAQSLNIYMAGASGKRLDETYKLAWLRGLKTTYYLRTIGATH 916

Query: 911 VEKSTLKGVDGKLNAVPVTD------------------------------PNSSTHSLGI 940
            EKST +   G LNAV V                                PN        
Sbjct: 917 TEKSTSRA--GALNAVAVDGGAGAMASASGTAVPAAPIASAATASAAYVMPNPGAAIEAD 974

Query: 941 PSSCTSDT------ECEVCQ 954
              CT         ECE CQ
Sbjct: 975 GPVCTMRPGDAGFEECEACQ 994


>gi|209521090|ref|ZP_03269820.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia sp.
            H160]
 gi|209498473|gb|EDZ98598.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia sp.
            H160]
          Length = 1003

 Score =  980 bits (2532), Expect = 0.0,   Method: Composition-based stats.
 Identities = 560/1000 (56%), Positives = 696/1000 (69%), Gaps = 68/1000 (6%)

Query: 6    DVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRS 65
              ++G +   P  +Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S
Sbjct: 21   GQSQGAQGLAPQASY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAAS 74

Query: 66   IRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREER 125
             RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLYRE+R
Sbjct: 75   ARVRELVEQLTQNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKR 134

Query: 126  SDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSE 184
            +  RA   H  ++A   P L +  D+G     +   L  I+E AC+ L D VS++ +++E
Sbjct: 135  NQARAHDEH--AEAASTPGLNVT-DNGITRPLDMAALRSIIESACANLGDAVSAEPIVAE 191

Query: 185  TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
            T KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       ++ T
Sbjct: 192  TVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREIL------EEEVT 245

Query: 245  HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
              EM   Y EYF ++I+ G+ A LL + +  FDL  L   L   RD  F YLGLQ LYDR
Sbjct: 246  QAEMGERYAEYFPQFIKRGIGAGLLDDKLQQFDLKRLGAALDANRDLQFGYLGLQTLYDR 305

Query: 305  YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
            YFLH +G RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFNSGT 
Sbjct: 306  YFLHHDGVRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNILSSFDFMSSTPTLFNSGTH 365

Query: 365  HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
              QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV
Sbjct: 366  RSQLSSCYLTTVDDDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGV 425

Query: 425  IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
            +PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANW
Sbjct: 426  VPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANW 485

Query: 485  IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
            IPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+K+ A  
Sbjct: 486  IPDLFMKRVMEGGDWTLFSPSTCPDLHDKFGAEFEAAYTAYEDKVARGEIKLFKKLPAAQ 545

Query: 545  LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
            LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS
Sbjct: 546  LWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGS 605

Query: 605  INLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLG 659
            +NL+AH           D+DKL  T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG
Sbjct: 606  VNLVAHLKEQADGTLALDHDKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLG 665

Query: 660  LMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQG 719
            +MGFQ  LH+L  PYAS EAVE AD SME + ++A  AS ELA+ERG YSS++GSLWD+G
Sbjct: 666  IMGFQDCLHMLRTPYASQEAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRG 725

Query: 720  VFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
            + P DS+ LLAE R   + ++ +  + W  L+ R+ T GMRNSNC+AIAPTATI+NI GV
Sbjct: 726  ILPQDSVALLAEARGGYVEVDSSESMDWPALRSRIATYGMRNSNCVAIAPTATISNIIGV 785

Query: 779  SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
            S  I+P+YQNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DG++  I+RIP
Sbjct: 786  SACIEPTYQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIP 845

Query: 839  DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
             DL+ I+ATAFE+DP+WL+ESASRRQKWIDQAQSLN+Y+   SGKKLD IY+ AWL GLK
Sbjct: 846  ADLRAIYATAFEVDPVWLVESASRRQKWIDQAQSLNIYMAGASGKKLDEIYKLAWLRGLK 905

Query: 899  TTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDP--------------------------- 931
            TTYYLR+ +AT VEKST+    G LNAV                                
Sbjct: 906  TTYYLRTMAATHVEKSTV--AHGALNAVSSGHDGSGGAGGAAGGFGVGGGAAGGLGGGFQ 963

Query: 932  -----------NSSTHSLGIPSSCTSDT------ECEVCQ 954
                                   C          ECE CQ
Sbjct: 964  AAAAAAPTAAVAVEAAPEADGPVCMMRPGDPGFDECEACQ 1003


>gi|326315614|ref|YP_004233286.1| ribonucleoside-diphosphate reductase subunit alpha [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323372450|gb|ADX44719.1| ribonucleoside-diphosphate reductase, alpha subunit [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 983

 Score =  980 bits (2532), Expect = 0.0,   Method: Composition-based stats.
 Identities = 534/988 (54%), Positives = 681/988 (68%), Gaps = 43/988 (4%)

Query: 1   MHPSKDVNKGDEDAFPSLAYPFPE--KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVE 58
           + PS      D+        P      +   Q+I+RNG V  F+P KI+ A+MKAF+AV 
Sbjct: 5   LSPSSATTAPDQTPTAQGTEPAAGGHPLSHYQIIRRNGAVVPFEPQKIAVAMMKAFLAVH 64

Query: 59  GKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREY 118
           G   + S  V++ +  LT+  V  L++        HIED+QD VE SLM+ GHH++ R Y
Sbjct: 65  GTQGAASASVRETVDTLTQSVVRALMRSRPGGGTFHIEDVQDNVELSLMRGGHHEVARAY 124

Query: 119 VLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVS 177
           VLYRE R+  RA Q H +   P  P L ++ D+G  +  +  RL  +++ AC+ L QDV 
Sbjct: 125 VLYRERRTQERAHQQHDRQPVPSTPVLHVI-DNGQRVPLDEARLRGLIDSACANLGQDVH 183

Query: 178 SKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVY 237
           +  +++ET +N+YDG+   ++  A I ++RTLIEK+P+Y   TAR LL  + REVL    
Sbjct: 184 AAPIVAETLRNLYDGVPMDEVYKASILAARTLIEKDPDYTYATARLLLHTIVREVLGQ-- 241

Query: 238 KKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLG 297
                    +M   Y  YF ++I++GV   LL   ++ +DL  L   L   RD  F+YLG
Sbjct: 242 ----DVVPADMGPAYAAYFPQFIQKGVDNELLDPRLLQYDLARLGAALDAGRDQQFDYLG 297

Query: 298 LQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPT 357
           LQ LYDRYFLH+  +RIE+PQ FFMRVAMGLAL E ++E RA+EFY +LSSF FM STPT
Sbjct: 298 LQTLYDRYFLHVRKTRIELPQCFFMRVAMGLALNEPDREARAIEFYEVLSSFDFMSSTPT 357

Query: 358 LFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGT 417
           LFNSGT   QLSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LG+HI GT
Sbjct: 358 LFNSGTLRSQLSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGSHIKGT 417

Query: 418 NGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTH 477
           NG+SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRTH
Sbjct: 418 NGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRTH 477

Query: 478 DMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVF 537
           DMNTANWIPDLFM+RV +   WTLFSP  V DLHDL+G +FE AY  YE +A RGEIK  
Sbjct: 478 DMNTANWIPDLFMRRVMEKGTWTLFSPSSVPDLHDLFGADFEKAYVAYEEKAARGEIKPS 537

Query: 538 RKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEET 597
           R + A  LWRK+LTMLFETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+S  ET
Sbjct: 538 RTLQATDLWRKILTMLFETGHPWITFKDACNVRSPQQHAGVVHSSNLCTEITLNTSDAET 597

Query: 598 AVCNLGSINLLAHFANNQF----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTH 653
           AVCNLGS+NL+ H  +       D+ KL  TI TA+R+LDNVIDIN + +EKA+ SN  H
Sbjct: 598 AVCNLGSVNLVRHLKDGPNGKELDHAKLRKTISTAMRMLDNVIDINYYAVEKARNSNMRH 657

Query: 654 RAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKG 713
           R +GLGLM FQ +L+ L IPYAS  AVE AD SME I ++A  AS ELAQERG YSS+ G
Sbjct: 658 RPVGLGLMAFQDSLYELRIPYASQAAVEFADRSMEAICYYAYWASTELAQERGKYSSYPG 717

Query: 714 SLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
           SLWD+G+ PID++ LL + R   + ++R + L WD L++++   GMRNSNC+AIAPTATI
Sbjct: 718 SLWDRGILPIDTLDLLEKARGGYVEVDRATSLDWDALRQKIARDGMRNSNCVAIAPTATI 777

Query: 773 ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
           +NI GV  SI+PS+ NL VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+  GS+ 
Sbjct: 778 SNIVGVDASIEPSFGNLSVKSNLSGEFTVINGYLVRDLKRLGLWDDVMVMDLKHFKGSLH 837

Query: 833 NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
            I+R+P D+K +++TAFE+ P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ A
Sbjct: 838 PIDRVPQDVKALYSTAFEVAPTWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDETYKLA 897

Query: 893 WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHS--------------- 937
           W+ GLKTTYYLR++SAT VE ST+     +LNAV      +   +               
Sbjct: 898 WVRGLKTTYYLRTQSATHVEMSTVNTR--QLNAVSSGSDGAMQAAGSGTARPGALDAAAA 955

Query: 938 -----------LGIPSSCTSDTECEVCQ 954
                        +      D  CE CQ
Sbjct: 956 AAQSQAAALPATDVKFCAIDDPTCEACQ 983


>gi|330815477|ref|YP_004359182.1| Ribonucleotide-diphosphate reductase alpha subunit [Burkholderia
           gladioli BSR3]
 gi|327367870|gb|AEA59226.1| Ribonucleotide-diphosphate reductase alpha subunit [Burkholderia
           gladioli BSR3]
          Length = 993

 Score =  980 bits (2532), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/992 (55%), Positives = 691/992 (69%), Gaps = 54/992 (5%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P    ++G     P   +         +VI+RNG V +F+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLGTASQGAPALAPQATF------ADYKVIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  LL+   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQSVVRALLRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKI 180
           RE+R   RA           +  L +    G     + K L  +V  AC GL   V+   
Sbjct: 131 REKRHLERAHSDAPVETPDGSSGLTVTDK-GVSRPLDMKALHGLVAAACEGLGSAVNPDP 189

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       
Sbjct: 190 IVAETVKNLYDGVPLSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG------ 243

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           ++    EMQ  Y EYF ++++ GV+A LL + ++ FDLV L   L   RD  F YLGLQ 
Sbjct: 244 EEVAQGEMQARYAEYFPQFLKRGVEAELLDDKLLQFDLVRLGEALDASRDLQFGYLGLQT 303

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLH+ G+RIEMPQAF+MRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLFN
Sbjct: 304 LYDRYFLHVEGTRIEMPQAFYMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLFN 363

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGTR  QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGK
Sbjct: 364 SGTRRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGK 423

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 424 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMN 483

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGE+K+F+KI
Sbjct: 484 TANWIPDLFMKRVMEGGDWTLFSPSTCPDLHDKFGAEFEAAYLGYEEKVARGELKLFKKI 543

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKML MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  E AVC
Sbjct: 544 PAAQLWRKMLGMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTSDSEIAVC 603

Query: 601 NLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRA 655
           NLGS+NL+AH A         D+DKL  T+  A+R+LDNVIDIN + + KA+ SN  HR 
Sbjct: 604 NLGSVNLVAHLAKQADGSYALDHDKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHRP 663

Query: 656 IGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSL 715
           +GLG+MGFQ  LHLL  P++S  AVE AD SME + ++A  AS ELA+ERG YSS+ GSL
Sbjct: 664 VGLGIMGFQDCLHLLRTPFSSDTAVEFADRSMEAVCYYAYWASTELAEERGRYSSYTGSL 723

Query: 716 WDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
           WD+G+ P D++ LL E R   + ++ +  L W  L+ R+   GMRNSNC+AIAPTATI+N
Sbjct: 724 WDRGILPQDTLKLLEEARGGYVEVDMSESLDWTSLRGRISVHGMRNSNCIAIAPTATISN 783

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           I GVS  I+P++QNL+VKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  I
Sbjct: 784 IIGVSPCIEPTFQNLFVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSRI 843

Query: 835 ERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWL 894
           +RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+++   SGKKLD IY+ AW+
Sbjct: 844 DRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIFMAGASGKKLDEIYKLAWV 903

Query: 895 MGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPN---------------------- 932
            GLKTTYYLR+ +AT VEKST+    G LNAVP +                         
Sbjct: 904 RGLKTTYYLRTMAATHVEKSTV--AHGALNAVPSSGGMGGGSAGGAQGAGSFGAAGGAAP 961

Query: 933 ----SSTHSLGIPSSCTSDT------ECEVCQ 954
               S+         CT         ECE CQ
Sbjct: 962 TGALSAAPIEADGPVCTMRPGDPGFEECEACQ 993


>gi|323527396|ref|YP_004229549.1| ribonucleoside-diphosphate reductase subunit alpha [Burkholderia
           sp. CCGE1001]
 gi|323384398|gb|ADX56489.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. CCGE1001]
          Length = 1006

 Score =  980 bits (2532), Expect = 0.0,   Method: Composition-based stats.
 Identities = 556/928 (59%), Positives = 689/928 (74%), Gaps = 25/928 (2%)

Query: 6   DVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRS 65
              +G +   P   Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S
Sbjct: 21  GQAQGAQALAPQATY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAAS 74

Query: 66  IRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREER 125
            RV+++++ LT+  V  LL+   +    HIEDIQDQVE +LM+ G H + R YVLYRE+R
Sbjct: 75  ARVRELVEQLTQNVVRALLRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKR 134

Query: 126 SDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSE 184
           +  R    H +  A   P L +  D+G     +   L  I+E AC+ L D VS++ +++E
Sbjct: 135 TQAR---GHDEQAAASTPGLSVT-DNGVTRPLDMAALRGIIESACANLGDAVSAEPIVAE 190

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       ++ T
Sbjct: 191 TVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREIL------EEEVT 244

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
             EM   Y EYF ++I+ GV+A LL + ++ FDL  L   L   RD  F YLGLQ LYDR
Sbjct: 245 QAEMGERYAEYFPQFIKRGVQAELLDDKLLQFDLKRLGAALDANRDLQFGYLGLQTLYDR 304

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YFLH +G RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFNSGTR
Sbjct: 305 YFLHHDGVRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTR 364

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
             QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV
Sbjct: 365 RSQLSSCYLTTVDDDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGV 424

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW
Sbjct: 425 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANW 484

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+KI A  
Sbjct: 485 IPDLFMKRVMEGGDWTLFSPSTCPDLHDKFGAEFEAAYTAYEDKVARGEIKLFKKIPAAQ 544

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS
Sbjct: 545 LWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGS 604

Query: 605 INLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLG 659
           +NL+AH           D+DKL  T+  A+R+LDNVIDIN + + KA+ SN  HR +G+G
Sbjct: 605 VNLVAHLKEQADGTLALDHDKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMG 664

Query: 660 LMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQG 719
           +MGFQ  LHLL  PYAS EAV+ AD SME + ++A  AS ELAQERG YSS++GSLWD+G
Sbjct: 665 IMGFQDCLHLLRTPYASEEAVKFADTSMEAVCYYAYYASTELAQERGRYSSYRGSLWDRG 724

Query: 720 VFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
           + P DS+ LLAE R   + ++ +  + W EL+ R+ T GMRNSNC+AIAPTATI+NI GV
Sbjct: 725 ILPQDSVKLLAEARGGYVEVDSSESMDWTELRSRIATYGMRNSNCIAIAPTATISNIIGV 784

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           S  I+P++QNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DG++  I+RIP
Sbjct: 785 SACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIP 844

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD IY+ AW+ GLK
Sbjct: 845 ADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEIYKLAWVRGLK 904

Query: 899 TTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           TTYYLR+ +AT VEKST+    G LNAV
Sbjct: 905 TTYYLRTMAATHVEKSTV--AHGALNAV 930


>gi|134095933|ref|YP_001101008.1| ribonucleotide-diphosphate reductase subunit alpha [Herminiimonas
           arsenicoxydans]
 gi|133739836|emb|CAL62887.1| Ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide
           reductase) [Herminiimonas arsenicoxydans]
          Length = 966

 Score =  980 bits (2532), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/964 (57%), Positives = 690/964 (71%), Gaps = 21/964 (2%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P++  N        S        +   ++++RNG V  F+PSKIS A+ KAF+AV G   
Sbjct: 12  PTEISNIAPLAVAASTPSVNSAALGDYRILRRNGAVVGFEPSKISIAVTKAFLAVNGGQG 71

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S RV+++++ LT   V  L++   +    HIEDIQDQVE +LM+SG H + R YVLYR
Sbjct: 72  AASARVRELVEQLTTNVVNALMRRQPAGGTFHIEDIQDQVELALMRSGEHDVARAYVLYR 131

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIV 181
            +R + RA Q  +K       +L +  ++G     +  ++  ++  AC GL+  V +  +
Sbjct: 132 FKRMEERAQQQAAKPVVETEHQLHVT-ENGQRRPLDMNQVRDLITAACIGLEKHVDADAI 190

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           L ET KN+YDG+   +L  + I ++R L+EK+P Y+ VTAR L+  +R+EV        +
Sbjct: 191 LRETVKNLYDGVPVEELHKSAILAARALMEKDPAYSTVTARLLMHTIRKEVFG------R 244

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           +         Y  YF  +I++G+ A LL   + +FDL  LA+ LK ERD  F YLGLQ L
Sbjct: 245 EVAQANAPAEYLVYFAEFIKKGIAAELLDAKLGEFDLKKLADALKPERDLQFGYLGLQTL 304

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLHI   RIEMPQAF+MRVAMGLAL E  +E+RA+EFYNLLSSF FM STPTLFNS
Sbjct: 305 YDRYFLHIADQRIEMPQAFYMRVAMGLALNEANREERAIEFYNLLSSFDFMSSTPTLFNS 364

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT+  QLSSC+LTTV DDL GI+ A++ENA+LAKY+GGLGNDWTPVR LGAHI GTNG+S
Sbjct: 365 GTQRSQLSSCYLTTVADDLGGIYDAIKENALLAKYAGGLGNDWTPVRSLGAHIKGTNGRS 424

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNT
Sbjct: 425 QGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLDLRKNTGDDRRRTHDMNT 484

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFMKRV +   WTLFSP +  DLHD  GK FE AY  YE +A RGE+K+F+KI 
Sbjct: 485 ANWIPDLFMKRVMEKGEWTLFSPSDAPDLHDKVGKAFEEAYTGYEAKAARGELKLFKKIQ 544

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A+ LWRKML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCN
Sbjct: 545 ALDLWRKMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNESEIAVCN 604

Query: 602 LGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLM 661
           LGS+N+ AH  + + D+ KL  TIRTA+R+LDNVIDIN + + KA+ SN  HR +G+G+M
Sbjct: 605 LGSVNMPAHMKDGKLDHVKLQKTIRTAMRMLDNVIDINYYAVNKARDSNLRHRPVGMGIM 664

Query: 662 GFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVF 721
           GFQ  LH++ IPYAS +AV+ AD SME + ++A  AS ELA+ERG YSS+KGSLWD+G+ 
Sbjct: 665 GFQDCLHMMRIPYASNDAVQFADNSMEAVCYYAYYASTELAEERGRYSSYKGSLWDRGIL 724

Query: 722 PIDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
           P DS+ LLA+ R    L  + +    W  L+ R+K  GMRNSNC+AIAPTATI+NI GVS
Sbjct: 725 PQDSLKLLADERGAKYLEADYSETFDWTPLRARIKEFGMRNSNCVAIAPTATISNIIGVS 784

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
             I+P+YQNLYVKSN+SG+FT +N +LV +LK R LWDE MISDLKY DGS+  I+RIP 
Sbjct: 785 ACIEPTYQNLYVKSNLSGEFTEINEYLVRDLKARGLWDEVMISDLKYFDGSLAKIDRIPQ 844

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
           DL+ I+ATAFE++P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKT
Sbjct: 845 DLRDIYATAFEVEPSWLVEAASRRQKWIDQAQSLNIYMSGASGKKLDDTYKLAWLRGLKT 904

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVPVT---DPNSSTHSLGIPSSCTSDT------EC 950
           TYYLR+  AT  EKST K   G LNAV         + + +     +C          EC
Sbjct: 905 TYYLRTMGATHTEKSTSK--TGALNAVDSGGGSSTAAQSAAETDGPACILRPGDAGFEEC 962

Query: 951 EVCQ 954
           E CQ
Sbjct: 963 EACQ 966


>gi|187930115|ref|YP_001900602.1| ribonucleotide-diphosphate reductase subunit alpha [Ralstonia
           pickettii 12J]
 gi|187727005|gb|ACD28170.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           pickettii 12J]
          Length = 994

 Score =  980 bits (2532), Expect = 0.0,   Method: Composition-based stats.
 Identities = 561/993 (56%), Positives = 696/993 (70%), Gaps = 52/993 (5%)

Query: 2   HPSK-DVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK 60
           +PS+   + G     P  A      +   ++I+RNG V SF+PSKI+ A+ KAF+AV G 
Sbjct: 14  NPSQFAQSAGGTAVAPGTASGV--NLADYKIIRRNGAVVSFEPSKIAVAMTKAFLAVNGG 71

Query: 61  GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL 120
             + S RV++++   T+  V  LL+   +    HIED+QDQVE +LM+SG H + R YVL
Sbjct: 72  QGAASARVRELVDQQTQNVVRALLRSRPNGGTFHIEDVQDQVELALMRSGEHDVARAYVL 131

Query: 121 YREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           YRE R+  RA    +    P    L +  D G     +   L  ++  AC GL + V  +
Sbjct: 132 YRERRAQERAQAGET-QQQPAFIGLNVT-DGGITRPLDMAALRNVIVSACEGLGEAVDPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +L ET KN+Y+G+  + +  + I +SRTLIEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PILKETVKNLYEGVPMTQVYDSAILASRTLIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y +YF ++I+ G+ A LL + +  FDL  L   L   RDF F YLGLQ
Sbjct: 245 -EEVTQAEMSTRYVDYFPQFIKRGINAELLDDKLAQFDLARLGAALDASRDFQFNYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLHI+ +RIEMPQAFFMRVAMGLAL E ++E RA+EFY LLSSF FM STPTLF
Sbjct: 304 TLYDRYFLHISETRIEMPQAFFMRVAMGLALNEIDREARAIEFYQLLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVSDDLDGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV +   WTLFSP    DLHD  GK FE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGGEWTLFSPSTCPDLHDKVGKAFEQAYLAYEDKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           + A+ LWRKML MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AV
Sbjct: 544 MPALQLWRKMLGMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH           D++KL  T+RTA+R+LDNVIDIN + ++KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLVKQADGSVVLDHEKLKKTVRTAMRMLDNVIDINYYAVKKARDSNLRHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +G+G+MGFQ ALH+L +PYAS  AV+ AD SME + ++A  AS ELA+ERG YSS+KGS
Sbjct: 664 PVGMGIMGFQDALHVLRVPYASDAAVQFADTSMEAVCYYAYWASTELAEERGRYSSYKGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P DS+ LLAE R   L  + +S + WD L+ R+K  GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDSLKLLAEERGGYLEADMSSTMDWDSLRGRIKQYGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P+YQNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DGS+  
Sbjct: 784 NIIGVSACIEPTYQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGSLAR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ ++ATAFE++P+WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW
Sbjct: 844 IDRIPQDLRDLYATAFEVEPLWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDP---------------------- 931
           L GLKTTYYLR+  AT VEKST+    G LNAV                           
Sbjct: 904 LRGLKTTYYLRTIGATHVEKSTVSR--GTLNAVSSGSDIGGVSAAGASGVTSAAPASALD 961

Query: 932 ----NSSTHSLGIPSSCTSDT------ECEVCQ 954
                +        + CT         ECE CQ
Sbjct: 962 AAAATAQAMPEAEGAVCTMRPGDPGFEECEACQ 994


>gi|293603287|ref|ZP_06685716.1| ribonucleotide-diphosphate reductase alpha subunit [Achromobacter
           piechaudii ATCC 43553]
 gi|292818322|gb|EFF77374.1| ribonucleotide-diphosphate reductase alpha subunit [Achromobacter
           piechaudii ATCC 43553]
          Length = 976

 Score =  979 bits (2531), Expect = 0.0,   Method: Composition-based stats.
 Identities = 531/982 (54%), Positives = 685/982 (69%), Gaps = 37/982 (3%)

Query: 3   PSKDVNKGDEDAFPSLAYPFP-----EKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAV 57
            +   +     A P      P      +     +I+RNG V  F+PSKI+ A+ KAF+AV
Sbjct: 2   QTTIASVTRPSAVPPSQTDSPADANGGQWASYNIIRRNGSVVGFEPSKIAIAMTKAFLAV 61

Query: 58  EGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITRE 117
            G   + S RV+++++NLT Q V  L+++  +    HIEDIQDQVE +LM+SG H + R 
Sbjct: 62  NGGQGAASARVRELVENLTSQAVNALVRNRPNGGTFHIEDIQDQVELALMRSGEHDVARA 121

Query: 118 YVLYREERSDVRA-----AQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSG 172
           YVLYRE+R+  RA           + AP    L +    G     +   L   +  A  G
Sbjct: 122 YVLYREKRTQERAAAAAAEGQEKSAAAPAEHVLNVTDA-GVRRPLDLAELRATIVAAGEG 180

Query: 173 LQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRRE 231
           L + + S+ +L ET KN+YDG+   ++  + I S+R L+EK+P Y++VTAR LL  +R+E
Sbjct: 181 LAEFIDSEAILKETVKNLYDGIPVDEVFKSAILSARALVEKDPAYSQVTARLLLHTIRKE 240

Query: 232 VLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDF 291
           VL       ++ +   M   Y EYF  +I  G++  LL   + ++DL  L   L  +RD 
Sbjct: 241 VLG------EEVSQDGMVARYAEYFPTFIARGIEGGLLSPELANYDLTRLGKALNAKRDL 294

Query: 292 AFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHF 351
            F YLGLQ LYDRYFLHI G+RIE+PQ FFMRVAMGLAL+E ++E RA+EFY +LSSF F
Sbjct: 295 QFGYLGLQTLYDRYFLHIRGTRIELPQVFFMRVAMGLALREADRETRAIEFYEILSSFDF 354

Query: 352 MCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLG 411
           M STPTLFNSGT H QLSSC+LTTV DDL GI+ A++ENA+LAKY+GGLGNDWTPVR L 
Sbjct: 355 MSSTPTLFNSGTLHSQLSSCYLTTVSDDLEGIYDAIKENALLAKYAGGLGNDWTPVRALR 414

Query: 412 AHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGD 471
           +HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLE+WH+D+EEFL+LRKNTGD
Sbjct: 415 SHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLESWHLDIEEFLELRKNTGD 474

Query: 472 DRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADR 531
           +RRRTHDMNTANWIPDLFMKRV +   WTLFSP +  DLHD YG+ FE AY  YE++   
Sbjct: 475 ERRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPSDCPDLHDKYGRAFEEAYIGYEKRVAS 534

Query: 532 GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN 591
           GE+K+++K+ A+ LWRKML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN
Sbjct: 535 GELKLYKKMPALTLWRKMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN 594

Query: 592 SSSEETAVCNLGSINLLAHFAN-----NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKA 646
           ++  E AVCNLGS+NL+AH         + D DK+  T+  A+R+LDNVIDIN + +EKA
Sbjct: 595 TNESEIAVCNLGSVNLVAHMKPAAGGGFELDLDKIKRTVSIAMRMLDNVIDINYYAVEKA 654

Query: 647 KKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERG 706
           + SN  HR +G+G+MGFQ  L ++ +PYAS  AVE AD SME + +HA  AS  LA+ERG
Sbjct: 655 RNSNARHRPVGMGIMGFQDCLQMMRVPYASQAAVEFADRSMEAVCYHAYFASSLLAEERG 714

Query: 707 AYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMA 765
            Y S++GSLW +G+ P D++ +L + R   + ++ +S L WD L+ R+K  GMRNSNC+A
Sbjct: 715 RYQSYEGSLWSRGILPQDTLKMLRDERGGHVEVDESSTLDWDTLRARIKQHGMRNSNCVA 774

Query: 766 IAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLK 825
           IAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+  LWDE M++DLK
Sbjct: 775 IAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKKLGLWDEVMVADLK 834

Query: 826 YHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKL 885
           Y DGS+  I+R+P +L++++ATAFE++P WL+E ASRRQKWIDQAQSLN+Y+   SGKKL
Sbjct: 835 YFDGSLSRIDRVPSELRELYATAFEVEPSWLVECASRRQKWIDQAQSLNIYMAGASGKKL 894

Query: 886 DFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD-------GKLNAVPVTDPNSSTHSL 938
           D  Y+ AW  GLKTTYYLR+  ATS EKST +G +       G+  A  V          
Sbjct: 895 DDTYKLAWTRGLKTTYYLRTLGATSAEKSTGRGGELNAVTAGGQSTAAAVGAAPVLPEPE 954

Query: 939 GIPSSCTSDT------ECEVCQ 954
            + + CT         ECE CQ
Sbjct: 955 VLGAVCTMRPGDPGFEECEACQ 976


>gi|311103858|ref|YP_003976711.1| ribonucleoside-diphosphate reductase subunit alpha [Achromobacter
           xylosoxidans A8]
 gi|310758547|gb|ADP13996.1| ribonucleoside-diphosphate reductase, alpha subunit [Achromobacter
           xylosoxidans A8]
          Length = 976

 Score =  979 bits (2531), Expect = 0.0,   Method: Composition-based stats.
 Identities = 535/984 (54%), Positives = 692/984 (70%), Gaps = 41/984 (4%)

Query: 3   PSKDVNKGDEDAFPSLAYPFP-----EKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAV 57
            +   +     A P      P      +     +I+RNG V  F+P+KI+ A+ KAF+AV
Sbjct: 2   QTTIASVTRPTAVPPSQTDSPADANGGQWASYNIIRRNGSVVGFEPNKIAIAMTKAFLAV 61

Query: 58  EGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITRE 117
            G   + S RV+++++NLT Q V  L+++  +    HIEDIQDQVE +LM+SG H + R 
Sbjct: 62  NGGQGAASARVRELVENLTGQAVNALVRNRPNGGTFHIEDIQDQVELALMRSGEHDVARA 121

Query: 118 YVLYREERSDVRAAQS-----HSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSG 172
           YVLYRE+R+  RAA +       K+ AP    L +    G     +   L   +E A  G
Sbjct: 122 YVLYREKRTQERAAAAAAADTQEKAAAPQEHVLNVTDA-GVRRPLDLAELRATIEAAGEG 180

Query: 173 LQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRRE 231
           L + + ++ +L ET KN+YDG+   ++  + I S+R L+EK+P Y++VTAR LL  +R+E
Sbjct: 181 LAEFIDTEAILKETVKNLYDGIPVDEVFKSAILSARALVEKDPAYSQVTARLLLHTIRKE 240

Query: 232 VLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDF 291
           VL       ++ +   M   Y EYF  +I  G++  LL   +  +DL  L + L  +RD 
Sbjct: 241 VLG------EEVSQDGMAARYAEYFPTFIARGIEGGLLSPDLASYDLTKLGHALNAKRDL 294

Query: 292 AFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHF 351
            F YLGLQ LYDRYFLHI G+RIE+PQ FFMRVAMGLAL+E ++E RA+EFY +LSSF F
Sbjct: 295 QFGYLGLQTLYDRYFLHIRGTRIELPQVFFMRVAMGLALREADRETRAIEFYEILSSFDF 354

Query: 352 MCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLG 411
           M STPTLFNSGT H QLSSC+LTTV DDL GI+ A++ENA+LAKY+GGLGNDWTPVR L 
Sbjct: 355 MSSTPTLFNSGTLHSQLSSCYLTTVSDDLEGIYDAIKENALLAKYAGGLGNDWTPVRALR 414

Query: 412 AHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGD 471
           +HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLE+WH+D+EEFL+LRKNTGD
Sbjct: 415 SHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLESWHLDIEEFLELRKNTGD 474

Query: 472 DRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADR 531
           +RRRTHDMNTANWIPDLFMKRV +   WTLFSP +  DLHD YG+ FE AY  YE +   
Sbjct: 475 ERRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPSDCPDLHDKYGRAFEEAYVGYEARVAS 534

Query: 532 GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN 591
           GE+K+F+K+ A+ LWRKML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN
Sbjct: 535 GELKLFKKMPALNLWRKMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN 594

Query: 592 SSSEETAVCNLGSINLLAHFAN-----NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKA 646
           ++  E AVCNLGS+NL+AH         + D+DK+  T+  A+R+LDNVIDIN + ++KA
Sbjct: 595 TNESEIAVCNLGSVNLVAHMKPAAGGGFELDHDKIKRTVSIAMRMLDNVIDINYYAVDKA 654

Query: 647 KKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERG 706
           + SN  HR +G+G+MGFQ  L ++ +PYAS  AVE AD SME + +HA  AS  LA+ERG
Sbjct: 655 RNSNARHRPVGMGIMGFQDCLQMMRVPYASQSAVEFADRSMEAVCYHAYWASSLLAEERG 714

Query: 707 AYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMA 765
            Y S++GSLW +G+ P D++ +L + R   + ++ +S L WD L+ R+K  GMRNSNC+A
Sbjct: 715 RYQSYEGSLWSRGILPQDTLKMLRDERGGHVEVDESSTLDWDTLRARIKKHGMRNSNCIA 774

Query: 766 IAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLK 825
           IAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+  LWDE M++DLK
Sbjct: 775 IAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKKLGLWDEVMVADLK 834

Query: 826 YHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKL 885
           Y DGS+  I+R+P +L+ ++ATAFE++P WL+E ASRRQKWIDQAQSLN+Y+   SGKKL
Sbjct: 835 YFDGSLSRIDRVPSELRDLYATAFEVEPSWLVECASRRQKWIDQAQSLNIYMAGASGKKL 894

Query: 886 DFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSS---------TH 936
           D  Y+ AW  GLKTTYYLR+  ATS EKST +G  G+LNAV     ++S           
Sbjct: 895 DDTYKLAWKRGLKTTYYLRTLGATSAEKSTGRG--GELNAVSAGGQSTSAAVAAAPVLPE 952

Query: 937 SLGIPSSCTSDT------ECEVCQ 954
              + + CT         ECE CQ
Sbjct: 953 PEVLGAVCTMRPGDPGFEECEACQ 976


>gi|167618619|ref|ZP_02387250.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           thailandensis Bt4]
          Length = 953

 Score =  979 bits (2530), Expect = 0.0,   Method: Composition-based stats.
 Identities = 548/934 (58%), Positives = 692/934 (74%), Gaps = 23/934 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLAGGAQGAPALASQATY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQTVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A   +  ++P    + +  D+G + + +   L  ++  AC GL D VS +
Sbjct: 131 REKRHLERVHAGEAAAVESPTGGSINVT-DNGVMRALDLNALRALIVSACEGLGDAVSPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMTQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMSTRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+++K
Sbjct: 484 NTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLYKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGSYALDEEKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS EAVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASDEAVEFADRSMEAVCYYAYWASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPALRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           L GLKTTYYLR+ +AT VEKST+    G LNAVP
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVP 935


>gi|78065155|ref|YP_367924.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           sp. 383]
 gi|77965900|gb|ABB07280.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. 383]
          Length = 998

 Score =  979 bits (2530), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/997 (55%), Positives = 688/997 (69%), Gaps = 59/997 (5%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLGGTEQGAKALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV++ ++ LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVREQVEQLTHNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVRAAQSHSKSDAPIAPK--LKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSS 178
           RE+R   R       + A       + ++ D+G     +   L  +V  AC GL   V+ 
Sbjct: 131 REKRHLERQHAGEEAAAAGGEASTGINVV-DNGVTRPLDLNALRALVVSACDGLGAAVNP 189

Query: 179 KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYK 238
             +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VT+R LL  +RRE+L     
Sbjct: 190 DPIVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTSRILLHTIRREILG---- 245

Query: 239 KPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGL 298
             ++    EM   Y EYF ++++ GV A LL + ++ FDL  L   L   RD  F YLGL
Sbjct: 246 --EEVVQAEMSTRYAEYFPQFLKRGVDAGLLDDKLLQFDLKRLGEALDANRDLQFGYLGL 303

Query: 299 QILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTL 358
           Q LYDRYFLH+ G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTL
Sbjct: 304 QTLYDRYFLHVEGTRIEMPQAFFMRVAMGLSLNEIDRETRAIEFYNVLSSFDFMSSTPTL 363

Query: 359 FNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTN 418
           FNSGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTN
Sbjct: 364 FNSGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTN 423

Query: 419 GKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHD 478
           GKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHD
Sbjct: 424 GKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHD 483

Query: 479 MNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFR 538
           MNTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+
Sbjct: 484 MNTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYTAYEDKVARGEIKLFK 543

Query: 539 KISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA 598
           KI A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E A
Sbjct: 544 KIPAAQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDSEIA 603

Query: 599 VCNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTH 653
           VCNLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  H
Sbjct: 604 VCNLGSVNLVAHLVKQADGSFALDHDKLKRTISVAMRMLDNVIDINYYAVAKARNSNLKH 663

Query: 654 RAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKG 713
           R +G+G+MGFQ  LHLL  PYAS  AV  AD SME + ++A  AS ELA+ERG YSS++G
Sbjct: 664 RPVGMGIMGFQDCLHLLRTPYASEAAVAFADRSMEAVCYYAYHASTELAEERGRYSSYRG 723

Query: 714 SLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
           SLWD+G+ P D++ LLAE R   + ++ +  L W  L+ R+ T GMRNSNC+AIAPTATI
Sbjct: 724 SLWDRGILPQDTLKLLAEARGGYVEVDTSESLDWTSLRSRIATHGMRNSNCVAIAPTATI 783

Query: 773 ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
           +NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG + 
Sbjct: 784 SNIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLS 843

Query: 833 NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
            I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ A
Sbjct: 844 RIDRIPADLRAIYATAFEVDPTWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKLA 903

Query: 893 WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP------------------------- 927
           WL GLKTTYYLR+ +AT VEKST+    G LNAVP                         
Sbjct: 904 WLRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTSGGSSSGGAQGAAGGFGAAGGAAS 961

Query: 928 ----VTDPNSSTHSLGIPSSCTSDT------ECEVCQ 954
               V    +          CT         ECE CQ
Sbjct: 962 SSGAVDAAPALAPVEADGPVCTMRPGDPGFDECEACQ 998


>gi|167580511|ref|ZP_02373385.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           thailandensis TXDOH]
          Length = 950

 Score =  979 bits (2530), Expect = 0.0,   Method: Composition-based stats.
 Identities = 547/934 (58%), Positives = 692/934 (74%), Gaps = 23/934 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLAGGAQGAPALASQATY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQTVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A   +  ++P    + +  D+G + + +   L  ++  AC GL D VS +
Sbjct: 131 REKRHLERVHAGEAAAVESPTGGSINVT-DNGVMRALDLNALRALIVSACEGLGDAVSPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMTQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMSTRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+++K
Sbjct: 484 NTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLYKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGSYALDEEKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  P+AS EAVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPFASDEAVEFADRSMEAVCYYAYWASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPALRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           L GLKTTYYLR+ +AT VEKST+    G LNAVP
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVP 935


>gi|332526549|ref|ZP_08402661.1| ribonucleotide-diphosphate reductase subunit alpha [Rubrivivax
           benzoatilyticus JA2]
 gi|332110817|gb|EGJ10994.1| ribonucleotide-diphosphate reductase subunit alpha [Rubrivivax
           benzoatilyticus JA2]
          Length = 950

 Score =  978 bits (2529), Expect = 0.0,   Method: Composition-based stats.
 Identities = 546/935 (58%), Positives = 688/935 (73%), Gaps = 17/935 (1%)

Query: 26  IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQ 85
           + G Q+I+RNG V +F+P+KI+ A+MKAF+AV G   + S  V++ +  LTE  V  L++
Sbjct: 27  VSGYQIIRRNGSVVAFEPNKIAVALMKAFLAVHGAQGAASASVRETVDQLTEGVVRALVR 86

Query: 86  HNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKL 145
                   HIED+QD VE  LM+ GHH++ R YVLYRE R+  R+ Q+ +   A     L
Sbjct: 87  SRPGGGTFHIEDVQDHVELGLMRGGHHEVARAYVLYRERRAQERSRQAAAPQPAAPE--L 144

Query: 146 KIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIF 204
            ++ D G  +  +   L  +VE+AC+GL +DV ++ +L+ET +N+YDG+   ++  A I 
Sbjct: 145 HVV-DGGQRLPLDLDALRSLVEQACAGLGEDVRAEPILAETRRNLYDGVPLDEVYKAAIL 203

Query: 205 SSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGV 264
           +SRTLIEK+P Y + TAR LL  +RRE+L              M   Y EYF  Y+ +GV
Sbjct: 204 ASRTLIEKDPAYTRATARLLLHTIRREILGA------DVRPEAMAARYAEYFPAYVRQGV 257

Query: 265 KARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRV 324
           +A LL E +  FDL  L   LK ERD  F+YLGLQ LYDRYFLH++G RIE+PQAFFMRV
Sbjct: 258 QAELLDEELQRFDLARLGAALKPERDLQFDYLGLQTLYDRYFLHVDGRRIELPQAFFMRV 317

Query: 325 AMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AMGLAL E ++E RA+EFY++LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+
Sbjct: 318 AMGLALNEIDREARAIEFYDVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVSDDLEGIY 377

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
            AL+ENA+L+K++GGLGNDWTPVR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKR
Sbjct: 378 EALKENALLSKFAGGLGNDWTPVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKR 437

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP
Sbjct: 438 KGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSP 497

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
               DLHD +G  FE AY  YER+ADRGEI+ F+++ A  LWRKMLTMLFETGHPWITFK
Sbjct: 498 SSCPDLHDKFGAAFEQAYVAYERKADRGEIRPFKRLPARDLWRKMLTMLFETGHPWITFK 557

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAST 624
           D CN+RSPQQHVGVVHSSNLCTEITLN+S+ E AVCNLGSINL  H A    D  KL  T
Sbjct: 558 DACNLRSPQQHVGVVHSSNLCTEITLNTSAGEIAVCNLGSINLAQHVAGGGIDQAKLKRT 617

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           + TA+R+LDNVIDIN + ++KA+ +N  HR +GLGLMGFQ  L+ L +PYAS  AVE AD
Sbjct: 618 VSTAMRMLDNVIDINYYAVKKARDANLRHRPVGLGLMGFQDCLYQLRLPYASDAAVEFAD 677

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSR 743
            SME + +HA  AS ELA+ERG YSS++GSLWD+GV P D++ LLA  R   + ++R+  
Sbjct: 678 RSMEALCYHAYWASSELAEERGRYSSYRGSLWDRGVLPQDTLDLLAAERGGHVEVDRSET 737

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           L W  L+ R+   GMRNSNC+AIAPTATI+NI GV  SI+P + NL VKSN+SG+FTVVN
Sbjct: 738 LDWAALRARIAVHGMRNSNCVAIAPTATISNIIGVDASIEPCFGNLSVKSNLSGEFTVVN 797

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
            +LV +LK+  LWD+ M+ DLK+ DGS+  ++R+PD+LK+++ATAFE+D  WL+E+A+RR
Sbjct: 798 EYLVRDLKRLGLWDDVMVMDLKHFDGSLRAVDRVPDELKQLYATAFEVDARWLVEAAARR 857

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKL 923
           QKWIDQAQSLN+Y+   SGKKLD IY+ AW  GLKTTYYLR+ SAT  EKST+    G +
Sbjct: 858 QKWIDQAQSLNIYMAGASGKKLDEIYKLAWTRGLKTTYYLRTMSATHAEKSTV--APGAM 915

Query: 924 NAVP----VTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           NAVP    +    ++  +  +      + +CE CQ
Sbjct: 916 NAVPRHGGLEAAAAAEPASDVRFCSIDNPDCEACQ 950


>gi|74317994|ref|YP_315734.1| ribonucleotide-diphosphate reductase subunit alpha [Thiobacillus
           denitrificans ATCC 25259]
 gi|74057489|gb|AAZ97929.1| ribonucleoside-diphosphate reductase alpha chain [Thiobacillus
           denitrificans ATCC 25259]
          Length = 974

 Score =  978 bits (2528), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/968 (56%), Positives = 707/968 (73%), Gaps = 30/968 (3%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
             V      +  + A     +    ++I+RNG V  F P+KI+ A+ KAF+AV+G  A+ 
Sbjct: 19  SAVPVAIPPSDAADAPAIDARYADYKIIRRNGAVVGFAPNKIAVAVTKAFIAVQGGQAAA 78

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S R++++++ +T Q    LL+ N +    HIED+QDQVE +LM+SG H++ R YVLYRE+
Sbjct: 79  SARIRELVEAITSQVTAALLRRNPAGGTFHIEDVQDQVELALMRSGEHEVARAYVLYREK 138

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLS 183
           R+  RAAQ  +        +L ++ +DG     ++ RL  ++ +ACS L + V ++ ++ 
Sbjct: 139 RAQERAAQKAAGVPEV---QLHVI-EDGVRKPLDTARLAGLLADACSDLGESVKAEPIMH 194

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
              +++YDG+  +++E AL+ ++R++IE++P Y+ VTAR LL  +R EVL       +  
Sbjct: 195 TVLRDLYDGVPMAEVEKALVLAARSMIEQDPAYSLVTARLLLNSIRHEVLG------EAV 248

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           T  +M   Y EYF  +I++G+ A LL E +  FDL  LA  L   RD+ F YLGLQ LYD
Sbjct: 249 TQAQMSERYAEYFPAFIKKGIAAELLDEKLGQFDLARLARVLDAGRDYQFGYLGLQTLYD 308

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYFLHI  +RIE+PQAFFMRVAMGLA+ E ++E RA+EFY +LSSF FM STPTLFNSGT
Sbjct: 309 RYFLHIEENRIELPQAFFMRVAMGLAINEIDRESRAIEFYQVLSSFDFMSSTPTLFNSGT 368

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
           RH QLSSC+LTTV DDL GI+ A++ENAML KY+GGLGNDWTPVR +GA I GTNGKSQG
Sbjct: 369 RHSQLSSCYLTTVTDDLDGIYQAIKENAMLQKYAGGLGNDWTPVRAMGARIKGTNGKSQG 428

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTAN
Sbjct: 429 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLDLRKNTGDDRRRTHDMNTAN 488

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAV 543
           WIPDLFM+RV +   WTLFSP++V DLHDLYG++F  AY  YER+ADRGE+K++++I A+
Sbjct: 489 WIPDLFMQRVMEGGDWTLFSPNDVPDLHDLYGRKFAEAYTEYERKADRGELKLYKRIPAL 548

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLG 603
            LWRKML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLG
Sbjct: 549 QLWRKMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDHEVAVCNLG 608

Query: 604 SINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGF 663
           S+NL+ H  + + D DKL +TI TA+R+LDNV+D+N + + KA+ SN  HR +GLG+MGF
Sbjct: 609 SVNLVNHLKDGKLDLDKLKNTIHTAMRMLDNVVDVNYYAVGKARNSNLKHRPVGLGIMGF 668

Query: 664 QSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPI 723
           Q AL  L + YAS +AVE AD SME ++++A  AS ELAQERG YSS++GSLW +G+ P 
Sbjct: 669 QDALQELRVAYASNDAVEFADRSMEAVAYYAYWASTELAQERGRYSSYEGSLWSKGILPH 728

Query: 724 DSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSI 782
           DS  LL E R   L ++ ++ L WD L++R+   GMRNSNC+AIAPTATIANI GVS SI
Sbjct: 729 DSNRLLLEERGGYLEVDSSATLDWDSLRQRIAQYGMRNSNCLAIAPTATIANIVGVSASI 788

Query: 783 DPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLK 842
           +P+YQNLYVKSN+SG+FTV N +LV +LK+  +WDE M++D+KY DGS+  I+RIP +L+
Sbjct: 789 EPTYQNLYVKSNLSGEFTVANKYLVADLKKLGMWDEVMVADIKYFDGSLARIDRIPAELR 848

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYY 902
            ++ATAFE++P WL+E ASRRQKWIDQAQSLN+Y+   SGKKLD IY+ AWL GLKTTYY
Sbjct: 849 ALYATAFEMEPSWLVECASRRQKWIDQAQSLNIYMAGASGKKLDDIYKLAWLRGLKTTYY 908

Query: 903 LRSRSATSVEKSTLKGVDGKLNAVPV----------TDPNSSTHSLGIPSSCTSDT---- 948
           LR+  ATS EKST KG  G+LNAV                +          CT       
Sbjct: 909 LRTLGATSAEKSTGKG--GELNAVSAHVGGGMSAMDAAAANLPVPEIEGKVCTMRPGDPG 966

Query: 949 --ECEVCQ 954
             ECE CQ
Sbjct: 967 FEECEACQ 974


>gi|172059583|ref|YP_001807235.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           ambifaria MC40-6]
 gi|171992100|gb|ACB63019.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           ambifaria MC40-6]
          Length = 999

 Score =  978 bits (2528), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/998 (55%), Positives = 689/998 (69%), Gaps = 60/998 (6%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLGGTEQGAKALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV++ ++ LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVREQVEQLTHSVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVRA--AQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSS 178
           RE+R   R    +  + +    +  + ++ D+G     +   L  ++  AC+GL   V+ 
Sbjct: 131 REKRHLERQHAGEEAAAAGGEASAGINVV-DNGVTRPLDMNALRELIVSACAGLGAAVNP 189

Query: 179 KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYK 238
           + +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L     
Sbjct: 190 EPIVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG---- 245

Query: 239 KPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGL 298
             ++    EM   Y EYF ++++ GV A LL + ++ FDL  L   L   RD  F YLGL
Sbjct: 246 --EEVLQAEMATRYTEYFPQFLKRGVDAGLLDDKLLQFDLKRLGEALDANRDLQFGYLGL 303

Query: 299 QILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTL 358
           Q LYDRYFLH+ G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTL
Sbjct: 304 QTLYDRYFLHVEGTRIEMPQAFFMRVAMGLSLNEIDRETRAIEFYNVLSSFDFMSSTPTL 363

Query: 359 FNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTN 418
           FNSGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTN
Sbjct: 364 FNSGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTN 423

Query: 419 GKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHD 478
           GKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHD
Sbjct: 424 GKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHD 483

Query: 479 MNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFR 538
           MNTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+
Sbjct: 484 MNTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYTAYEDKVARGEIKLFK 543

Query: 539 KISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA 598
           KI A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E A
Sbjct: 544 KIPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIA 603

Query: 599 VCNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTH 653
           VCNLGS+NL+AH           D DKL  TI  A+R+LDNVIDIN + + KA+ SN  H
Sbjct: 604 VCNLGSVNLVAHLVKQADGSYALDQDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKH 663

Query: 654 RAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKG 713
           R +G+G+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++G
Sbjct: 664 RPVGMGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRG 723

Query: 714 SLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
           SLWD+G+ P D++ LL E R   + ++ +  L W  L+ R+   GMRNSNC+AIAPTATI
Sbjct: 724 SLWDRGILPQDTLKLLTEARGGYVEVDTSESLDWTTLRSRIAAHGMRNSNCVAIAPTATI 783

Query: 773 ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
           +NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG + 
Sbjct: 784 SNIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLS 843

Query: 833 NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
            I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ A
Sbjct: 844 RIDRIPADLRAIYATAFEVDPTWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKLA 903

Query: 893 WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPV------------------------ 928
           WL GLKTTYYLR+ +AT VEKST+    G LNAVP                         
Sbjct: 904 WLRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTGGAGGSSSGGAQGAAGGFGAAGGD 961

Query: 929 ------TDPNSSTHSLGIPSSCTSDT------ECEVCQ 954
                     +          CT         ECE CQ
Sbjct: 962 ASSGAVNAAAALAPVEADGPVCTMRPGDAGFDECEACQ 999


>gi|187925408|ref|YP_001897050.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           phytofirmans PsJN]
 gi|187716602|gb|ACD17826.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           phytofirmans PsJN]
          Length = 1001

 Score =  978 bits (2528), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/929 (59%), Positives = 687/929 (73%), Gaps = 25/929 (2%)

Query: 6   DVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRS 65
              +G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S
Sbjct: 21  GQAQGAQALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAAS 74

Query: 66  IRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREER 125
            RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLYRE+R
Sbjct: 75  ARVRELVEQLTQNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKR 134

Query: 126 SDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSE 184
           +  R    H        P L +  D+G     +   L  I+E ACS L D VS+  +++E
Sbjct: 135 TQAR---GHDDQIVANTPGLNVT-DNGVTRPLDMAALRGIIELACSNLGDAVSADPIIAE 190

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       ++ T
Sbjct: 191 TVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILK------EEVT 244

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
             EM   Y EYF ++I+ GV+A LL + ++ FDL  L   L   RD  F YLGLQ LYDR
Sbjct: 245 QTEMGERYAEYFPQFIKRGVQAELLDDKLLQFDLKRLGAALDNNRDLQFGYLGLQTLYDR 304

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YFLH +G RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFNSGTR
Sbjct: 305 YFLHHDGVRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTR 364

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
             QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV
Sbjct: 365 RSQLSSCYLTTVDDDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGV 424

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANW
Sbjct: 425 VPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANW 484

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV +   WTLFSP    DLHDL+G +FE AY  YE +  RGEIK+F+KI A  
Sbjct: 485 IPDLFMKRVMEGGDWTLFSPSTCPDLHDLFGADFEKAYTAYEDKVARGEIKLFKKIPAAQ 544

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS
Sbjct: 545 LWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGS 604

Query: 605 INLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLG 659
           +NL+AH           D+DKL  T+  A+R+LDNVIDIN + + KA+ SN  HR +G+G
Sbjct: 605 VNLVAHLKEQADGTLVLDHDKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMG 664

Query: 660 LMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQG 719
           +MGFQ  LHLL  PYAS EAV+ AD SME + ++A  AS ELAQERG YSS++GSLWD+G
Sbjct: 665 IMGFQDCLHLLRTPYASEEAVKFADTSMEAVCYYAYYASTELAQERGRYSSYRGSLWDRG 724

Query: 720 VFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
           + P DS+ LLA+ R   + ++ +  + W EL+ R+ T GMRNSNC+AIAPTATI+NI GV
Sbjct: 725 ILPQDSVKLLADARGGYVEVDSSESMDWTELRSRIATYGMRNSNCVAIAPTATISNIIGV 784

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           S  I+P++QNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DG++  I+RIP
Sbjct: 785 SACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIP 844

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD IY+ AW+ GLK
Sbjct: 845 ADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEIYKLAWVRGLK 904

Query: 899 TTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           TTYYLR+ +AT VEKST+    G LNAV 
Sbjct: 905 TTYYLRTMAATHVEKSTV--AHGALNAVS 931


>gi|115350551|ref|YP_772390.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           ambifaria AMMD]
 gi|115280539|gb|ABI86056.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           ambifaria AMMD]
          Length = 999

 Score =  978 bits (2527), Expect = 0.0,   Method: Composition-based stats.
 Identities = 549/998 (55%), Positives = 690/998 (69%), Gaps = 60/998 (6%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLGGTEQGAKALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV++ ++ LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVREQVEQLTHNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVRA--AQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSS 178
           RE+R   R    +  + +    +  + ++ D+G     +   L  ++  +C+GL   V+ 
Sbjct: 131 REKRHLERQHAGEEAAAAGGEASAGINVV-DNGVTRPLDMNALRELIVSSCAGLGAAVNP 189

Query: 179 KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYK 238
           + +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L     
Sbjct: 190 EPIVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG---- 245

Query: 239 KPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGL 298
             ++    EM   Y EYF ++++ GV A LL + ++ FDL  L   L   RD  F YLGL
Sbjct: 246 --EEVLQAEMTTRYTEYFPQFLKRGVDAGLLDDKLLQFDLKRLGEALDANRDLQFGYLGL 303

Query: 299 QILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTL 358
           Q LYDRYFLH+ G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTL
Sbjct: 304 QTLYDRYFLHVEGTRIEMPQAFFMRVAMGLSLNEIDRETRAIEFYNVLSSFDFMSSTPTL 363

Query: 359 FNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTN 418
           FNSGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTN
Sbjct: 364 FNSGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTN 423

Query: 419 GKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHD 478
           GKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHD
Sbjct: 424 GKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHD 483

Query: 479 MNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFR 538
           MNTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+
Sbjct: 484 MNTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYTAYEDKVARGEIKLFK 543

Query: 539 KISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA 598
           KI A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E A
Sbjct: 544 KIPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIA 603

Query: 599 VCNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTH 653
           VCNLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  H
Sbjct: 604 VCNLGSVNLVAHLVKQADGSYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKH 663

Query: 654 RAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKG 713
           R +G+G+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++G
Sbjct: 664 RPVGMGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRG 723

Query: 714 SLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
           SLWD+G+ P D++ LL E R   + ++ +  L W  L+ R+   GMRNSNC+AIAPTATI
Sbjct: 724 SLWDRGILPQDTLKLLTEARGGYVEVDTSESLDWTTLRSRIAAHGMRNSNCVAIAPTATI 783

Query: 773 ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
           +NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG + 
Sbjct: 784 SNIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLS 843

Query: 833 NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
            I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ A
Sbjct: 844 RIDRIPADLRAIYATAFEVDPTWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKLA 903

Query: 893 WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPV------------------------ 928
           WL GLKTTYYLR+ +AT VEKST+    G LNAVP                         
Sbjct: 904 WLRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTGGAGGSSSGGAQGAAGGFGAAGGD 961

Query: 929 ------TDPNSSTHSLGIPSSCTSDT------ECEVCQ 954
                     +          CT         ECE CQ
Sbjct: 962 ASSGAVNAAAALAPVEADGPVCTMRPGDAGFDECEACQ 999


>gi|330974388|gb|EGH74454.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 953

 Score =  978 bits (2527), Expect = 0.0,   Method: Composition-based stats.
 Identities = 547/956 (57%), Positives = 692/956 (72%), Gaps = 18/956 (1%)

Query: 3   PSKDVNKGDEDAFPS-------LAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFM 55
            +    +      P        L+   P +   ++VIKRNG V  +   KI+ AI KAF+
Sbjct: 2   QTDTTRENSPTGAPQPSQTQQDLSATAPGQ---LRVIKRNGTVVPYTDDKITVAITKAFL 58

Query: 56  AVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKIT 115
           AVEG  A+ S R+ D +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ 
Sbjct: 59  AVEGGNAAASSRIHDTVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVA 118

Query: 116 REYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD 175
           R+YV+YR+ R+  RA ++  +      P ++I   DG+    +  RL  IV EAC GL +
Sbjct: 119 RDYVIYRDSRAKERAVRTPEEQVQ-AHPSIRITRADGSFAPLDMGRLNTIVTEACEGLAE 177

Query: 176 VSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTT 235
           V + ++ +ET KN+YDG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  
Sbjct: 178 VDADLIQTETLKNLYDGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLG- 236

Query: 236 VYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEY 295
                  ATHHEM  LY +    Y+  G+K  LL+  + +FDL  L   + +ERD  F Y
Sbjct: 237 FLGVADSATHHEMADLYAKALPAYVAAGIKFELLNPVLAEFDLEKLGKAINHERDQQFTY 296

Query: 296 LGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCST 355
           LGLQ LYDRYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M ST
Sbjct: 297 LGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAIEFYNLLSSFDYMSST 356

Query: 356 PTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIH 415
           PTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I 
Sbjct: 357 PTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIK 416

Query: 416 GTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRR 475
           GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRR
Sbjct: 417 GTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRR 476

Query: 476 THDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQ-ADRGEI 534
           THDMNTANWIPDLFMKRV  +  WTLFSP EV DLHDL GK F+  YE YE      G+I
Sbjct: 477 THDMNTANWIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQERYEYYEALTEYPGKI 536

Query: 535 KVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSS 594
           K+F+ I A  LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ 
Sbjct: 537 KLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNK 596

Query: 595 EETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           +E AVCNLGSINL  H  + + D DKL  T+  AVR+LDNVIDIN +++ +AK SN  HR
Sbjct: 597 DEIAVCNLGSINLPNHIVDGKLDTDKLKRTVDVAVRMLDNVIDINYYSVPQAKNSNLRHR 656

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ AL+L HIPY S  AV+ AD SME +S++AI AS +LA ERGAY +F+GS
Sbjct: 657 PVGLGIMGFQDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASCDLADERGAYETFQGS 716

Query: 715 LWDQGVFPIDSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
           LW +G+ P+DS  +L E R    ++++    L W  ++ RV+  G+RNSN MAIAPTATI
Sbjct: 717 LWSKGILPLDSQQILIEQRGEKYISVDLKETLDWAPVRARVQK-GIRNSNIMAIAPTATI 775

Query: 773 ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
           ANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+ 
Sbjct: 776 ANITGVSQSIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQ 835

Query: 833 NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
            IERIP +LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR A
Sbjct: 836 QIERIPQELKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMA 895

Query: 893 WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDT 948
           W  GLKTTYYLR+ +ATS EKST+    GKLNAV          ++  P    +  
Sbjct: 896 WYRGLKTTYYLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSAITAPRPTEAAP 949


>gi|300690380|ref|YP_003751375.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           solanacearum PSI07]
 gi|299077440|emb|CBJ50066.1| Ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           solanacearum PSI07]
          Length = 987

 Score =  977 bits (2526), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/986 (55%), Positives = 687/986 (69%), Gaps = 44/986 (4%)

Query: 5   KDVNKGDEDAFPSLAYPFPEK--IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
                    + P+              ++I+RNG V  F+PSKI+ A+ KAF+AV G   
Sbjct: 10  SGTANPAAFSQPTGGTAVASGDGYADYKIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQG 69

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S RV+++++ LT+  V  LL+   +    HIED+QDQVE +LM+SG H + R YVLYR
Sbjct: 70  AASARVRELVEGLTQNVVRALLRSRPNGGTFHIEDVQDQVELALMRSGEHDVARAYVLYR 129

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIV 181
           E R+  RA    ++   P    L +  D G     +   L  ++  AC+GL + V  + +
Sbjct: 130 ERRAQERAQAGETQQP-PAFIGLNVT-DGGITRPLDMAALRNLIVSACAGLGEAVDPEPI 187

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           L ET KN+Y+G+  S +  + I ++RTLIEK+P Y++VTAR LL  +RRE+L       +
Sbjct: 188 LKETVKNLYEGVPMSQVYDSAILAARTLIEKDPAYSQVTARILLHTIRREILG------E 241

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           + T  EM   Y +YF ++I+ G+ A LL E +  FDL  L   L   RD  F YLGLQ L
Sbjct: 242 EVTQAEMAARYADYFPQFIKRGINAGLLDEKLAQFDLAKLGAALDASRDLQFNYLGLQTL 301

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           +DRYFLHI+  RIEMPQAFFMRVAMGL+L E ++E RA+EFY LLSSF FM STPTLFNS
Sbjct: 302 FDRYFLHISEKRIEMPQAFFMRVAMGLSLNEIDRESRAIEFYQLLSSFDFMSSTPTLFNS 361

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKS
Sbjct: 362 GTCRSQLSSCYLTTVSDDLDGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKS 421

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT
Sbjct: 422 QGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNT 481

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFMKRV +N  WTLFSP    DLHD  GK FE AY  YE +  RGEIK+F+K+ 
Sbjct: 482 ANWIPDLFMKRVMENGEWTLFSPSTCPDLHDKVGKAFETAYLGYEEKVARGEIKLFKKMP 541

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A+ LWRKML MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCN
Sbjct: 542 AMQLWRKMLGMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCN 601

Query: 602 LGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAI 656
           LGS+NL+AH           D+DKL  T+RTA+R+LDNVIDIN + ++KA+ SN  HR +
Sbjct: 602 LGSVNLVAHLVTQADGSVALDHDKLKKTVRTAMRMLDNVIDINYYAVKKARDSNLRHRPV 661

Query: 657 GLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLW 716
           GLG+MGFQ ALH+L IPYAS  AV+ AD SME + ++A  AS ELA+ERG YS++KGSLW
Sbjct: 662 GLGIMGFQDALHVLRIPYASDAAVQFADNSMEAVCYYAYWASTELAEERGRYSTYKGSLW 721

Query: 717 DQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANI 775
           D+G+ P DS+ LLA+ R   L  + +S + WD L+ R++  GMRNSNC+AIAPTATI+NI
Sbjct: 722 DRGILPQDSLKLLAQERGGYLEADLSSSMDWDSLRARIQQYGMRNSNCVAIAPTATISNI 781

Query: 776 CGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIE 835
            GVS  I+P+YQNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DGS+  I+
Sbjct: 782 IGVSACIEPTYQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGSLARID 841

Query: 836 RIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLM 895
           RIP DL+ ++ATAFE++P WL+E+ASRRQKWIDQAQSLN+Y+   SGK LD  Y+ AWL 
Sbjct: 842 RIPQDLRDLYATAFEVEPQWLVEAASRRQKWIDQAQSLNIYMAGASGKMLDDTYKLAWLR 901

Query: 896 GLKTTYYLRSRSATSVEKSTLKGVD---------------------GKLNAVPVTDPNSS 934
           GLKTTYYLR+  AT VEKST+                            +A+      + 
Sbjct: 902 GLKTTYYLRTIGATHVEKSTVSRGTLNAVSSGSDVGSVSAAGASPVAPASALDAVAATAP 961

Query: 935 THSLGIPSSCTSDT------ECEVCQ 954
                  + CT         ECE CQ
Sbjct: 962 AMPEAEGAVCTMRPGDPGFEECEACQ 987


>gi|238026166|ref|YP_002910397.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           glumae BGR1]
 gi|237875360|gb|ACR27693.1| Ribonucleotide-diphosphate reductase alpha subunit [Burkholderia
           glumae BGR1]
          Length = 999

 Score =  977 bits (2526), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/998 (55%), Positives = 695/998 (69%), Gaps = 60/998 (6%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P    ++G     P   +         +VI+RNG V +F+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLGTASQGAPALAPQATF------ADYKVIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQSVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKI 180
           RE+R   RA           A  + +    G     +   L  ++  AC GL   V+   
Sbjct: 131 REKRHLERAHSDAPADAPAGAAGINVTDA-GVTRPLDMGALRGLIASACEGLGSAVNPDP 189

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       
Sbjct: 190 IVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG------ 243

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           ++ +  EMQ  Y EYF ++++ GV+A LL + ++ FDLV L   L   RD  F YLGLQ 
Sbjct: 244 EEVSQGEMQARYAEYFPQFLKRGVEAELLDDKLLQFDLVRLGEALDAGRDLQFGYLGLQT 303

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFY++LSSF FM STPTLFN
Sbjct: 304 LYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYHVLSSFDFMSSTPTLFN 363

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGTR  QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGK
Sbjct: 364 SGTRRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGK 423

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 424 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMN 483

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGE+K+F+KI
Sbjct: 484 TANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYLGYEEKVARGELKLFKKI 543

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVC
Sbjct: 544 PAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDSEIAVC 603

Query: 601 NLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRA 655
           NLGS+NL+AH           D+DKL  T+  A+R+LDNVIDIN + + KA+ SN  HR 
Sbjct: 604 NLGSVNLVAHLVKQADGSYALDHDKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHRP 663

Query: 656 IGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSL 715
           +GLG+MGFQ  LHLL  P++S  AVE AD SME + ++A  AS EL++ERG YSS++GSL
Sbjct: 664 VGLGIMGFQDCLHLLRTPFSSDAAVEFADRSMEAVCYYAYWASTELSEERGRYSSYRGSL 723

Query: 716 WDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
           WD+G+ P D++ LL E R   + ++ +S L W  L++R+   GMRNSNC+AIAPTATI+N
Sbjct: 724 WDRGILPQDTLKLLEEARGGYVEVDMSSSLDWTSLRERISLHGMRNSNCIAIAPTATISN 783

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           I GVS  I+P++QNL+VKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  I
Sbjct: 784 IIGVSPCIEPTFQNLFVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSRI 843

Query: 835 ERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWL 894
           +RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+++   SGKKLD IY+ AW+
Sbjct: 844 DRIPSDLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIFMAGASGKKLDEIYKLAWV 903

Query: 895 MGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLG--------------- 939
            GLKTTYYLR+ +AT VEKST+    G LNAVP  D  +   + G               
Sbjct: 904 RGLKTTYYLRTMAATHVEKSTV--AHGALNAVPSGDGGAGGGAAGGAHGAAGGFGAAGGA 961

Query: 940 -----------------IPSSCTSDT------ECEVCQ 954
                                C          ECE CQ
Sbjct: 962 GSGVLNAAPAAEAEIAVDGPVCMMRPGDPGFEECEACQ 999


>gi|254253305|ref|ZP_04946623.1| Ribonucleotide reductase alpha subunit [Burkholderia dolosa AUO158]
 gi|124895914|gb|EAY69794.1| Ribonucleotide reductase alpha subunit [Burkholderia dolosa AUO158]
          Length = 997

 Score =  977 bits (2526), Expect = 0.0,   Method: Composition-based stats.
 Identities = 555/996 (55%), Positives = 691/996 (69%), Gaps = 58/996 (5%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P      G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLGGAEHGAQALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV++ ++ LT   V  LL+   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVREQVEQLTRNVVRALLRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVRAAQSHSKSDAPIAPK--LKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSS 178
           RE+R   R       + A       + ++ D+G     +   L  ++  AC GL   V+ 
Sbjct: 131 REKRHLERQHAGEEAAAAGGEASSGINVV-DNGVTRPLDLNALRALIVSACDGLGAAVNP 189

Query: 179 KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYK 238
           + +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L     
Sbjct: 190 EPIVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG---- 245

Query: 239 KPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGL 298
             ++    EM   Y EYF +++  GV+A LL + ++ FDL  L   L   RD  F YLGL
Sbjct: 246 --EEVVQSEMSTRYAEYFPQFLRRGVEAGLLDDKLLQFDLKRLGEALDANRDLQFGYLGL 303

Query: 299 QILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTL 358
           Q LYDRYFLH++G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTL
Sbjct: 304 QTLYDRYFLHVDGTRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTL 363

Query: 359 FNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTN 418
           FNSGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTN
Sbjct: 364 FNSGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTN 423

Query: 419 GKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHD 478
           GKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHD
Sbjct: 424 GKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHD 483

Query: 479 MNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFR 538
           MNTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+
Sbjct: 484 MNTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYTAYEEKVARGEIKLFK 543

Query: 539 KISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA 598
           KI A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E A
Sbjct: 544 KIPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIA 603

Query: 599 VCNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTH 653
           VCNLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  H
Sbjct: 604 VCNLGSVNLVAHLVKQPDGSYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKH 663

Query: 654 RAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKG 713
           R +G+G+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++G
Sbjct: 664 RPVGMGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRG 723

Query: 714 SLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
           SLWD+G+ P D++ LLAE R   + ++ +  L W  L+ R+ T GMRNSNC+AIAPTATI
Sbjct: 724 SLWDRGILPQDTLKLLAEARGGYVEVDMSETLDWAALRARIATHGMRNSNCVAIAPTATI 783

Query: 773 ANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIG 832
           +NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG + 
Sbjct: 784 SNIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLS 843

Query: 833 NIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQA 892
            I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ A
Sbjct: 844 RIDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLA 903

Query: 893 WLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHS--------------- 937
           WL G KTTYYLR+ +AT VEKST+    G LNAVP    +SS  +               
Sbjct: 904 WLRGKKTTYYLRTMAATHVEKSTV--AHGALNAVPTGGGSSSGGAQGAAGGFGAAGGEAS 961

Query: 938 -------------LGIPSSCTSDT------ECEVCQ 954
                              CT         ECE CQ
Sbjct: 962 SGALNAAPALAPVEADGPVCTMRPGDPGFDECEACQ 997


>gi|73542625|ref|YP_297145.1| ribonucleotide-diphosphate reductase subunit alpha [Ralstonia
           eutropha JMP134]
 gi|72120038|gb|AAZ62301.1| Ribonucleoside-diphosphate reductase [Ralstonia eutropha JMP134]
          Length = 979

 Score =  977 bits (2525), Expect = 0.0,   Method: Composition-based stats.
 Identities = 554/952 (58%), Positives = 695/952 (73%), Gaps = 32/952 (3%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
           +  ++I+RNG V +F+PSKI+ A+ KAF+AV G   + S RV++I++ LT+  V  L++ 
Sbjct: 36  QDYKIIRRNGAVVAFEPSKINVAMTKAFLAVNGGQGAASARVREIVEQLTQNVVRALVRS 95

Query: 87  NKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLK 146
             S   +HIED+QD VE +LM+SG H++ R YVLYRE+R+  RA+ S           ++
Sbjct: 96  RPSGGAIHIEDVQDHVELALMRSGEHEVARSYVLYREKRAQERASASAQAVARVQESGIQ 155

Query: 147 IMMDD-GTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIF 204
             + D G     +   L  +++ AC+GL + VS++ +L ET KN+Y+G+  + +  + I 
Sbjct: 156 FNVTDAGVTKPLDIVALHDLLDTACAGLGKAVSAEPILKETLKNLYEGVPMTQVYDSAIL 215

Query: 205 SSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGV 264
           ++RTLIEK+P+Y++VTAR LL  +R+E+L        + T  EM   Y EYF ++I  G+
Sbjct: 216 AARTLIEKDPDYSQVTARILLHTIRKEILGA------EVTQAEMTTRYAEYFPKFIARGI 269

Query: 265 KARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRV 324
            A LL E +  FDL  L   L   RDF F YLGLQ LYDRYFLHI+ +RIEMPQAFFMRV
Sbjct: 270 AAELLDEKLATFDLARLGAALDAGRDFQFNYLGLQTLYDRYFLHIDETRIEMPQAFFMRV 329

Query: 325 AMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AMGLAL E ++E RA+EFY LLSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+
Sbjct: 330 AMGLALNEADREARAIEFYQLLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVSDDLEGIY 389

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
            AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKR
Sbjct: 390 EALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKR 449

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +N  WTLFSP
Sbjct: 450 KGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMENGEWTLFSP 509

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
               DLHD  GK FE AY  YE +A  GE+K+F+K+ A+ LWRKML MLFETGHPWITFK
Sbjct: 510 STCPDLHDKVGKAFEQAYLGYEAKAASGELKLFKKVPAMQLWRKMLGMLFETGHPWITFK 569

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF-----DYD 619
           DPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D+ 
Sbjct: 570 DPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLTKQADGSYVLDHA 629

Query: 620 KLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEA 679
           KL  TIRTA+R+LDNVIDIN + +EKA+ SN  HR +G+G+MGFQ  LH+L  PYAS  A
Sbjct: 630 KLQKTIRTAMRMLDNVIDINYYAVEKARNSNLRHRPVGMGIMGFQDCLHVLRTPYASDAA 689

Query: 680 VEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAM 738
           V+ AD SME + ++A  AS ELA+ERG Y ++ GSLWD+G+ P DS+ LLAE R   L +
Sbjct: 690 VKFADTSMEAVCYYAYQASTELAEERGRYETYAGSLWDRGILPQDSLKLLAEERGGYLEV 749

Query: 739 NRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGD 798
           + +S + WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+
Sbjct: 750 DHSSSMDWDSLRGRIKQHGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGE 809

Query: 799 FTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIE 858
           FTVVN +LV +LK+R LWDE M++DLKY DGS+  I+RIP DL+ I+ATAFE++P WL+E
Sbjct: 810 FTVVNDYLVRDLKERGLWDEVMVADLKYFDGSLSRIDRIPQDLRDIYATAFEVEPTWLVE 869

Query: 859 SASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKG 918
           +ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+ +AT VEKST+  
Sbjct: 870 AASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTMAATHVEKSTVSR 929

Query: 919 VDGKLNAVPVTDP----------NSSTHSLGIPSSCTSDT------ECEVCQ 954
             G LNAV               ++        + CT         ECE CQ
Sbjct: 930 --GSLNAVSSGSDGGSAMDAAAASAPAMPEAEGAVCTMRPGDPGFEECEACQ 979


>gi|83649536|ref|YP_437971.1| ribonucleotide-diphosphate reductase subunit alpha [Hahella
           chejuensis KCTC 2396]
 gi|83637579|gb|ABC33546.1| Ribonucleotide reductase, alpha subunit [Hahella chejuensis KCTC
           2396]
          Length = 953

 Score =  977 bits (2524), Expect = 0.0,   Method: Composition-based stats.
 Identities = 536/932 (57%), Positives = 679/932 (72%), Gaps = 6/932 (0%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLL 84
               +QVIKR G    FD  KI+ A+ KAF+AVEG+ AS S RV+D ++ L +  V RL 
Sbjct: 26  HNALLQVIKRTGQAAPFDDRKIAMAVTKAFLAVEGQSASGSPRVRDSVEKLVKDIVARLR 85

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
           + +     VHIE+IQD VE  LM+ G HK+ R YVLYREE +  RA  + S+      P 
Sbjct: 86  RRSPEGGSVHIEEIQDLVELGLMRGGFHKVARAYVLYREEHARQRAP-APSEQSGETHPD 144

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIF 204
           + +   DG+    N  RL  ++ +AC+ L  VS + VL    KN+Y+G+   D+  AL+ 
Sbjct: 145 INVKFADGSEAPLNMGRLRTVISDACADLDGVSEEKVLQGALKNLYNGVKHKDVNAALVM 204

Query: 205 SSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGV 264
           ++R LIE+EPNY+ V AR LL+ LR E L+ +      AT  EM  LYP  F   +E  V
Sbjct: 205 AARPLIEEEPNYSYVCARLLLDGLREESLSYLNIAAS-ATEGEMAELYPTAFRAIVERCV 263

Query: 265 KARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRV 324
           +  LL   ++ FDL  L   LK ERD    YLGLQ LYDRYF+H   +R+E+PQAFFMRV
Sbjct: 264 EHELLSPELLKFDLERLGAALKPERDRQLTYLGLQTLYDRYFIHWRETRLELPQAFFMRV 323

Query: 325 AMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AMGL+++E +   RA+EFY+LLSSF +MCSTPTLFN+GT  PQLSSC+LTTVPDDL GI+
Sbjct: 324 AMGLSVQEDDPNARAIEFYDLLSSFDYMCSTPTLFNAGTNRPQLSSCYLTTVPDDLEGIY 383

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
           GA+++NA+L+K++GGLGNDWTPVR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKR
Sbjct: 384 GAIKDNALLSKWAGGLGNDWTPVRSLGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKR 443

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVCAYLE+WH+D+EEFL+LRKNTGD+RRRTHDMN+ANWIPDLFMKRV ++  WTLFSP
Sbjct: 444 KGAVCAYLESWHLDIEEFLELRKNTGDERRRTHDMNSANWIPDLFMKRVFEDKEWTLFSP 503

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
            +  DLHDLYG  FE  Y +YE   + G I +F+K+ A  LWRKML+MLFETGHPW+TFK
Sbjct: 504 SDAPDLHDLYGSAFEARYTHYESLVESGAITLFKKVPAQNLWRKMLSMLFETGHPWVTFK 563

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAST 624
           DPCN+RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGS+NL+ H  N + D+D+L +T
Sbjct: 564 DPCNLRSPQQHVGVVHSSNLCTEITLNTSQDEIAVCNLGSVNLVNHIRNGEIDHDRLRNT 623

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           + TAVR+LDNVIDIN + + +A+ +N  HR +G+GLMGFQ AL+ L +PY+S EAV  AD
Sbjct: 624 VYTAVRMLDNVIDINYYAVPQARNANLRHRPVGMGLMGFQDALYKLGLPYSSVEAVRFAD 683

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD--ELAMNRTS 742
           +SME IS+ AI+AS  LA+ERG Y +++GSLWDQGV PIDS+  L + R      ++R  
Sbjct: 684 QSMELISYFAITASSNLAKERGRYETYEGSLWDQGVLPIDSLDRLEQERGAEFCTLDRGH 743

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            L W  +++ VK  GMRNSN MAIAPTATI+NI GVSQSI+P+YQNL+VKSN+SG+FTV+
Sbjct: 744 SLDWAPVRELVKKQGMRNSNVMAIAPTATISNIVGVSQSIEPTYQNLFVKSNLSGEFTVI 803

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV ELK RDLWD  M++DLKY DGS+  I+RIP+D+K++  TAFEIDP WL+E+ASR
Sbjct: 804 NPWLVQELKARDLWDSVMVNDLKYFDGSVAQIDRIPEDVKQLFLTAFEIDPRWLVEAASR 863

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQ QSLNLY+ EPSGKKLD +Y+ AW  GLKTTYYLRS  AT +EK  +     +
Sbjct: 864 RQKWIDQGQSLNLYMAEPSGKKLDNLYKLAWSRGLKTTYYLRSLGATQMEK--ISSGASQ 921

Query: 923 LNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
            +       ++             D +CE CQ
Sbjct: 922 SDNAKPDVDDTENQEPQPKFCSILDPDCEACQ 953


>gi|170695323|ref|ZP_02886469.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           graminis C4D1M]
 gi|170139723|gb|EDT07905.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           graminis C4D1M]
          Length = 1001

 Score =  977 bits (2524), Expect = 0.0,   Method: Composition-based stats.
 Identities = 548/918 (59%), Positives = 685/918 (74%), Gaps = 23/918 (2%)

Query: 6   DVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRS 65
              +G +   P   Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S
Sbjct: 21  GQAQGAQALAPQATY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAAS 74

Query: 66  IRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREER 125
            RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLYRE+R
Sbjct: 75  ARVRELVEQLTQNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKR 134

Query: 126 SDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSE 184
           +  R    H +  A   P L +  D+G     +   L  I+E AC+ L D VS++ +++E
Sbjct: 135 TQAR---GHDEQVAGSTPGLTVT-DNGVSRPLDMAALRGIIESACANLGDAVSAEPIVAE 190

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       ++ T
Sbjct: 191 TVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREIL------EEEVT 244

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
             EM   Y EYF ++I+ GV+A LL + ++ FDL  L   L   RD  F YLGLQ LYDR
Sbjct: 245 QAEMGERYAEYFPQFIKRGVQAELLDDKLLQFDLKRLGAALDNNRDLQFGYLGLQTLYDR 304

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YFLH +G RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFNSGTR
Sbjct: 305 YFLHHDGVRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTR 364

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
             QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV
Sbjct: 365 RSQLSSCYLTTVDDDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGV 424

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW
Sbjct: 425 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANW 484

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+K+ A  
Sbjct: 485 IPDLFMKRVMEGGDWTLFSPSTCPDLHDKFGAEFEAAYTAYEDKVARGEIKLFKKVPAAQ 544

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS
Sbjct: 545 LWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGS 604

Query: 605 INLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLG 659
           +NL+AH           D+DKL  T+  A+R+LDNVIDIN + + KA+ SN  HR +G+G
Sbjct: 605 VNLVAHLKEQADGTLVLDHDKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMG 664

Query: 660 LMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQG 719
           +MGFQ  LHLL  PYAS EAV+ AD SME + ++A  AS ELAQERG YSS++GSLWD+G
Sbjct: 665 IMGFQDCLHLLRTPYASEEAVKFADTSMEAVCYYAYYASTELAQERGRYSSYRGSLWDRG 724

Query: 720 VFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
           + P DS+ LLA+ R   + ++ +  + W EL++R+ T GMRNSNC+AIAPTATI+NI GV
Sbjct: 725 ILPQDSVKLLADARGGYVEVDSSESMDWTELRQRIATYGMRNSNCIAIAPTATISNIIGV 784

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           S  I+P++QNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DG++  I+RIP
Sbjct: 785 SACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIP 844

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD IY+ AW+ GLK
Sbjct: 845 ADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEIYKLAWVRGLK 904

Query: 899 TTYYLRSRSATSVEKSTL 916
           TTYYLR+ +AT VEKST+
Sbjct: 905 TTYYLRTMAATHVEKSTV 922


>gi|222112112|ref|YP_002554376.1| ribonucleotide-diphosphate reductase subunit alpha [Acidovorax
           ebreus TPSY]
 gi|221731556|gb|ACM34376.1| ribonucleoside-diphosphate reductase, alpha subunit [Acidovorax
           ebreus TPSY]
          Length = 974

 Score =  976 bits (2523), Expect = 0.0,   Method: Composition-based stats.
 Identities = 539/968 (55%), Positives = 686/968 (70%), Gaps = 38/968 (3%)

Query: 14  AFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIK 73
           A PS        +   Q+I+RNG V  F+P KI+ A+MKAF+AV G   + S  V++++ 
Sbjct: 18  ATPSATPTGAHPLMHYQIIRRNGAVVPFEPQKIAVAMMKAFLAVHGAQGAASASVREVVD 77

Query: 74  NLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS 133
            LT+  V  L++   +    HIED+QDQVE  LM+  HH++ R YVLYRE R+  RA + 
Sbjct: 78  QLTQAVVRALMRSRPAGGTFHIEDVQDQVELGLMRGSHHEVARAYVLYRERRAQERAQKK 137

Query: 134 HSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDG 192
                 P  P L +  D G  +  +  RL+ +VE AC+GL  DV +  +++ET +N+YDG
Sbjct: 138 EQL--LPQMPALYV-QDQGQRVELDILRLQSLVEAACTGLGSDVQAAPIIAETMRNLYDG 194

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           +   ++  A I ++RTLIEK+P Y   TAR LL  + REVL       +      M   Y
Sbjct: 195 VPMDEVYKASILAARTLIEKDPGYTYATARLLLHTIVREVLG------RDVNPANMALAY 248

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            E F ++I +GV   LL   +M+FDL  L + LK ERD  F+YLGLQ LYDRYFLH+  +
Sbjct: 249 AENFPQFIRQGVDNELLDPRLMEFDLQRLGSALKAERDLQFDYLGLQTLYDRYFLHVRKT 308

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           RIE+PQ+FFMRVAMGLAL+E ++  RA+EFY LLSSF FM STPTLFNSGT   QLSSC+
Sbjct: 309 RIELPQSFFMRVAMGLALREDDRNARAIEFYELLSSFDFMSSTPTLFNSGTLRSQLSSCY 368

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPD+L GI+ +++ENA+L+K++GGLGNDWT VR LGA I GTNG+SQGV+PFLKV N
Sbjct: 369 LTTVPDELEGIYESIKENALLSKFAGGLGNDWTRVRALGARIKGTNGESQGVVPFLKVVN 428

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVC YLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 429 DTAVAVNQGGKRKGAVCTYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKR 488

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V +   WTLFSP +V DLHDLYG+ FE AY  YE +A+ GE+ +F+++ AV LWRKML+M
Sbjct: 489 VMEKGLWTLFSPSDVPDLHDLYGQAFEKAYIAYEAKAESGELPLFKRVPAVDLWRKMLSM 548

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  ETAVCNLGS+NL  H  
Sbjct: 549 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTSDAETAVCNLGSVNLARHLK 608

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           +   D+DKL  T+ TA+R+LDNVIDIN + ++KAK SN  HR +GLGLMGFQ AL+ L I
Sbjct: 609 DGGIDHDKLRKTVSTAMRMLDNVIDINYYAVQKAKDSNLRHRPVGLGLMGFQDALYELRI 668

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PYAS  AVE AD SME + ++A  AS +LAQERG YSS++GSLW QG+ P+DS+ LL + 
Sbjct: 669 PYASDAAVEFADTSMEALCYYAYWASTDLAQERGQYSSYQGSLWSQGILPLDSLQLLEQE 728

Query: 733 R-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYV 791
           R   + ++RT+RL WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL V
Sbjct: 729 RGGYVEVDRTTRLDWDMLRAKIAQDGMRNSNCIAIAPTATISNIVGVDASIEPSFGNLSV 788

Query: 792 KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEI 851
           KSN+SG+FTV+N +LV +LKQ  LWD+ M+ DLK+  GS+  I+R+P  +K ++ATAFE+
Sbjct: 789 KSNLSGEFTVINQYLVRDLKQLGLWDDVMLMDLKHFKGSLHAIDRVPLTVKALYATAFEV 848

Query: 852 DPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSV 911
            P WL+E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ GLKTTYYLR++SAT V
Sbjct: 849 APTWLVEAAARRQKWIDQAQSLNIYMAGASGKKLDETYKLAWIRGLKTTYYLRTQSATHV 908

Query: 912 EKSTLKGVDGKLNAVPVTDPNSST-------------------------HSLGIPSSCTS 946
           E ST+     +LNAV     ++                            +  +      
Sbjct: 909 EMSTVNTR--QLNAVASGASDTGEGTMAPSSALNAAVAAAQAQAQAAAIPATDVKFCAID 966

Query: 947 DTECEVCQ 954
           D  CE CQ
Sbjct: 967 DPGCEACQ 974


>gi|296160507|ref|ZP_06843323.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. Ch1-1]
 gi|295889256|gb|EFG69058.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. Ch1-1]
          Length = 1001

 Score =  976 bits (2523), Expect = 0.0,   Method: Composition-based stats.
 Identities = 548/918 (59%), Positives = 681/918 (74%), Gaps = 23/918 (2%)

Query: 6   DVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRS 65
              +G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S
Sbjct: 21  GQAQGAQALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAAS 74

Query: 66  IRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREER 125
            RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLYRE+R
Sbjct: 75  ARVRELVEQLTQNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKR 134

Query: 126 SDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSE 184
           +  R    H        P L +  D+G     +   L  I+E ACS L D VS+  +++E
Sbjct: 135 TQAR---GHDDQIVANTPGLNVT-DNGVTRPLDMAALRGIIELACSNLGDAVSADPIIAE 190

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       ++ T
Sbjct: 191 TVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREIL------EEEVT 244

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
             EM   Y EYF ++I+ GV+A LL + ++ FDL  L   L   RD  F YLGLQ LYDR
Sbjct: 245 QTEMGERYAEYFPQFIKRGVQAELLDDKLLQFDLKRLGAALDNNRDLQFGYLGLQTLYDR 304

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YFLH +G RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LS+F FM STPTLFNSGTR
Sbjct: 305 YFLHHDGVRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSTFDFMSSTPTLFNSGTR 364

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
             QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV
Sbjct: 365 RSQLSSCYLTTVDDDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGV 424

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW
Sbjct: 425 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANW 484

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+KI A  
Sbjct: 485 IPDLFMKRVMEGGDWTLFSPSTCPDLHDKFGAEFEKAYTAYEDKVARGEIKLFKKIPAAQ 544

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS
Sbjct: 545 LWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGS 604

Query: 605 INLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLG 659
           +NL+AH           D+DKL  T+  A+R+LDNVIDIN + + KA+ SN  HR +G+G
Sbjct: 605 VNLVAHLKEQADGTLVLDHDKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMG 664

Query: 660 LMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQG 719
           +MGFQ  LHLL  PYAS EAV+ AD SME + ++A  AS ELAQERG YSS++GSLWD+G
Sbjct: 665 IMGFQDCLHLLRTPYASEEAVKFADTSMEAVCYYAYYASTELAQERGRYSSYRGSLWDRG 724

Query: 720 VFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
           + P DS+ LLAE R   + ++ +  + W EL+ R+ T GMRNSNC+AIAPTATI+NI GV
Sbjct: 725 ILPQDSVKLLAEARGGYVEVDSSESMDWTELRSRIATYGMRNSNCVAIAPTATISNIIGV 784

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           S  I+P++QNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DG++  I+RIP
Sbjct: 785 SACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIP 844

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD IY+ AW+ GLK
Sbjct: 845 ADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEIYKLAWVRGLK 904

Query: 899 TTYYLRSRSATSVEKSTL 916
           TTYYLR+ +AT VEKST+
Sbjct: 905 TTYYLRTMAATHVEKSTV 922


>gi|317402621|gb|EFV83181.1| ribonucleoside-diphosphate reductase subunit alpha [Achromobacter
           xylosoxidans C54]
          Length = 976

 Score =  976 bits (2523), Expect = 0.0,   Method: Composition-based stats.
 Identities = 530/984 (53%), Positives = 684/984 (69%), Gaps = 41/984 (4%)

Query: 3   PSKDVNKGDEDAFPSLAYPFP-----EKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAV 57
            +   +     A P      P      +     +I+RNG V  F+P KI+ A+ KAF+AV
Sbjct: 2   QTTIASVTRPSAVPPSQTDSPADANGGQWASYNIIRRNGSVVGFEPGKIAIAMTKAFLAV 61

Query: 58  EGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITRE 117
            G   + S RV+++++ LT Q V  L+++       HIEDIQDQVE +LM+SG H + R 
Sbjct: 62  NGGQGAASARVRELVEQLTTQAVNALVRNRPGGGTFHIEDIQDQVELALMRSGQHDVARA 121

Query: 118 YVLYREERSDVRA-----AQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSG 172
           YVLYRE+R+  RA              P    L +    G     +   L   +  A  G
Sbjct: 122 YVLYREKRTQERAAAAAAEGQQKVDAVPQENVLHVTDA-GVRRPLDIAELRATIVAAGEG 180

Query: 173 LQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRRE 231
           L + + S+ +L ET KN+YDG+   ++  + I S+R L+EK+P Y++VTAR LL  +R+E
Sbjct: 181 LAEFIDSEAILKETVKNLYDGIPVDEVFKSAILSARALVEKDPAYSQVTARLLLHTIRKE 240

Query: 232 VLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDF 291
           VL       ++ +   M   Y EYF  +I  G++  LL   +  +DL  L   L  +RD 
Sbjct: 241 VLG------EEVSQDGMAARYAEYFPTFIARGIEGGLLSPDLASYDLTKLGKALNAKRDL 294

Query: 292 AFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHF 351
            F YLGLQ LYDRYFLHI G+RIE+PQ FFMRVAMGLAL+ET++E RA+EFY +LSSF F
Sbjct: 295 QFGYLGLQTLYDRYFLHIRGTRIELPQVFFMRVAMGLALRETDREARAIEFYEILSSFDF 354

Query: 352 MCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLG 411
           M STPTLFNSGT H QLSSC+LTTV DDL GI+ A++ENA+LAKY+GGLGNDWTPVR L 
Sbjct: 355 MSSTPTLFNSGTLHSQLSSCYLTTVSDDLEGIYDAIKENALLAKYAGGLGNDWTPVRALR 414

Query: 412 AHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGD 471
           +HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLE+WH+D+EEFL+LRKNTGD
Sbjct: 415 SHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLESWHLDIEEFLELRKNTGD 474

Query: 472 DRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADR 531
           +RRRTHDMNTANWIPDLFMKRV +   WTLFSP +  DLHD YGK FE AY  YE +   
Sbjct: 475 ERRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPSDCPDLHDKYGKAFEEAYVGYEARVAS 534

Query: 532 GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN 591
           G++K+F+K+ A+ LWRKML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN
Sbjct: 535 GDLKLFKKMPALTLWRKMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN 594

Query: 592 SSSEETAVCNLGSINLLAHFAN-----NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKA 646
           ++  E AVCNLGS+NL+AH         + D++K+  T+  A+R+LDNVIDIN + ++KA
Sbjct: 595 TNESEIAVCNLGSVNLVAHMKPAAGGGFELDHEKIKRTVSIAMRMLDNVIDINYYAVDKA 654

Query: 647 KKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERG 706
           + SN  HR +G+G+MGFQ  L ++ +PYAS  AVE AD SME + +HA  AS  LA+ERG
Sbjct: 655 RNSNARHRPVGMGIMGFQDCLQMMRVPYASQAAVEFADRSMEAVCYHAYWASSLLAEERG 714

Query: 707 AYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMA 765
            Y S++GSLW +G+ P D++ +L + R   + ++ +S L WD L+ R+K  GMRNSNC+A
Sbjct: 715 RYQSYEGSLWSRGILPQDTLKMLRDERGGHVEVDESSTLDWDALRARIKQHGMRNSNCIA 774

Query: 766 IAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLK 825
           IAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+  LWDE M++DLK
Sbjct: 775 IAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKKLGLWDEVMVADLK 834

Query: 826 YHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKL 885
           Y DGS+  I+R+P +L++++ATAFE++P WL+E ASRRQKWIDQAQSLN+Y+   SGKKL
Sbjct: 835 YFDGSLSRIDRVPSELRELYATAFEVEPSWLVECASRRQKWIDQAQSLNIYMAGASGKKL 894

Query: 886 DFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSS---------TH 936
           D  Y+ AW  GLKTTYYLR+  ATS EKST +G  G+LNAV     +++           
Sbjct: 895 DDTYKLAWKRGLKTTYYLRTLGATSAEKSTGRG--GELNAVSAGGTSAAAPVSAAPVLPE 952

Query: 937 SLGIPSSCTSDT------ECEVCQ 954
              + + CT         ECE CQ
Sbjct: 953 PEVLGAVCTMRPGDPGFEECEACQ 976


>gi|121595924|ref|YP_987820.1| ribonucleotide-diphosphate reductase subunit alpha [Acidovorax sp.
           JS42]
 gi|120608004|gb|ABM43744.1| ribonucleoside-diphosphate reductase, alpha subunit [Acidovorax sp.
           JS42]
          Length = 972

 Score =  976 bits (2522), Expect = 0.0,   Method: Composition-based stats.
 Identities = 539/966 (55%), Positives = 686/966 (71%), Gaps = 36/966 (3%)

Query: 14  AFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIK 73
           A PS        +   Q+I+RNG V  F+P KI+ A+MKAF+AV G   + S  V++++ 
Sbjct: 18  ATPSATPTGAHPLMHYQIIRRNGAVVPFEPQKIAVAMMKAFLAVHGAQGAASASVREVVD 77

Query: 74  NLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS 133
            LT+  V  L++   +    HIED+QDQVE  LM+  HH++ R YVLYRE R+  RA + 
Sbjct: 78  QLTQAVVRALMRSRPAGGTFHIEDVQDQVELGLMRGSHHEVARAYVLYRERRAQERAQKK 137

Query: 134 HSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDG 192
                 P  P L +  D G  +  +  RL+ +VE AC+GL  DV +  +++ET +N+YDG
Sbjct: 138 EQL--LPQMPALYV-QDQGQRVELDILRLQSLVEAACTGLGSDVQAAPIIAETMRNLYDG 194

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           +   ++  A I ++RTLIEK+P Y   TAR LL  + REVL       +     +M   Y
Sbjct: 195 VPMDEVYKASILAARTLIEKDPGYTYATARLLLHTIVREVLG------RDVNPADMALAY 248

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            E F ++I +GV   LL   +M+FDL  L + LK ERD  F+YLGLQ LYDRYFLH+  +
Sbjct: 249 AENFPQFIRQGVDNELLDPRLMEFDLQRLGSALKAERDLQFDYLGLQTLYDRYFLHVRKT 308

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           RIE+PQ FFMRVAMGLAL+E ++  RA+EFY LLSSF FM STPTLFNSGT   QLSSC+
Sbjct: 309 RIELPQTFFMRVAMGLALREDDRNARAIEFYELLSSFDFMSSTPTLFNSGTLRSQLSSCY 368

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPD+L GI+ +++ENA+L+K++GGLGNDWT VR LGA I GTNG+SQGV+PFLKV N
Sbjct: 369 LTTVPDELEGIYESIKENALLSKFAGGLGNDWTRVRALGARIKGTNGESQGVVPFLKVVN 428

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVC YLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 429 DTAVAVNQGGKRKGAVCTYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKR 488

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V +   WTLFSP +V DLHDLYG+ FE AY  YE +A+ GE+ +F+++ AV LWRKML+M
Sbjct: 489 VMEKGLWTLFSPSDVPDLHDLYGQAFEKAYIAYEAKAESGELPLFKRVPAVDLWRKMLSM 548

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  ETAVCNLGS+NL  H  
Sbjct: 549 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTSDAETAVCNLGSVNLARHLK 608

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           +   D+DKL  T+ TA+R+LDNVIDIN + ++KAK SN  HR +GLGLMGFQ AL+ L I
Sbjct: 609 DGGIDHDKLRKTVSTAMRMLDNVIDINYYAVQKAKDSNLRHRPVGLGLMGFQDALYELRI 668

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PYAS  AVE AD SME + ++A  AS +LAQERG YSS++GSLW QG+ P+DS+ LL + 
Sbjct: 669 PYASDAAVEFADTSMEALCYYAYWASTDLAQERGQYSSYQGSLWSQGILPLDSLQLLEQE 728

Query: 733 R-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYV 791
           R   + ++RT+RL WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL V
Sbjct: 729 RGGYVEVDRTTRLDWDMLRAKIAQDGMRNSNCIAIAPTATISNIVGVDASIEPSFGNLSV 788

Query: 792 KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEI 851
           KSN+SG+FTV+N +LV +LKQ  LWD+ M+ DLK+  GS+  I+R+P  +K ++ATAFE+
Sbjct: 789 KSNLSGEFTVINQYLVRDLKQLGLWDDVMLMDLKHFKGSLHAIDRVPLTVKALYATAFEV 848

Query: 852 DPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSV 911
            P WL+E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ GLKTTYYLR++SAT V
Sbjct: 849 APTWLVEAAARRQKWIDQAQSLNIYMAGASGKKLDETYKLAWIRGLKTTYYLRTQSATHV 908

Query: 912 EKSTLKGVDGKLNAVPVTDPNSST-----------------------HSLGIPSSCTSDT 948
           E ST+     +LNAV     ++                          +  +      D 
Sbjct: 909 EMSTVNTR--QLNAVASGASDTGEGTMAPSSALNAAVAAAQAQAAAIPATDVKFCAIDDP 966

Query: 949 ECEVCQ 954
            CE CQ
Sbjct: 967 GCEACQ 972


>gi|315122311|ref|YP_004062800.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495713|gb|ADR52312.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 934

 Score =  976 bits (2522), Expect = 0.0,   Method: Composition-based stats.
 Identities = 712/936 (76%), Positives = 811/936 (86%), Gaps = 3/936 (0%)

Query: 19  AYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQ 78
            YPFPEK+KG++VI+RNG  T FDPSKIS AIMKAF+AVEGK AS S RV++I+  LTE+
Sbjct: 2   TYPFPEKVKGIKVIRRNGKTTPFDPSKISWAIMKAFIAVEGKSASSSSRVRNIVNVLTEE 61

Query: 79  TVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSD 138
           TV +LL    S LI+HIE IQDQVE SLM++ HHK+ REYVLYREERS +R A++HSKSD
Sbjct: 62  TVLKLLHEYSSNLIIHIEAIQDQVEASLMRNDHHKVAREYVLYREERSGIRTAKAHSKSD 121

Query: 139 APIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDL 198
               P LKI MDD T +  +SKRL+MI+EE+C+GLQDVS +++LSET KNMYDG+SE +L
Sbjct: 122 ---TPHLKIRMDDDTFVPLDSKRLKMIIEESCAGLQDVSLELILSETIKNMYDGMSEVEL 178

Query: 199 ETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCR 258
           E AL+F+SR LIE+EPNYAKVT R LL+KLRREVLT +YK P+KATH EM  LY  YF +
Sbjct: 179 ELALVFASRALIEREPNYAKVTTRLLLDKLRREVLTAIYKTPKKATHQEMSNLYKNYFLQ 238

Query: 259 YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
           YIEEG+KA LL ESM +FDL YLAN LK +RD  FEYLGLQ LYDRYFLH++GSR EMPQ
Sbjct: 239 YIEEGIKAHLLAESMKEFDLSYLANALKPDRDLMFEYLGLQTLYDRYFLHVDGSRFEMPQ 298

Query: 319 AFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPD 378
           AFFMRVAMG+ALKE EKEKRAVEFYNL+SSFHFMCSTPTLFN+GTRHPQLSSCFLTTVPD
Sbjct: 299 AFFMRVAMGIALKEPEKEKRAVEFYNLISSFHFMCSTPTLFNAGTRHPQLSSCFLTTVPD 358

Query: 379 DLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
           DL  IF A+++NA+LAKYSGGLGNDWT VRGLG+HI GTNGKSQGVIPFLKVANDTAVAV
Sbjct: 359 DLGDIFEAIKDNALLAKYSGGLGNDWTSVRGLGSHIQGTNGKSQGVIPFLKVANDTAVAV 418

Query: 439 NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
           NQGGKRKGAVCAYLETWHID+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKRV +N  
Sbjct: 419 NQGGKRKGAVCAYLETWHIDIEEFLNLRKNTGDDRRRTHDMNTANWVPDLFMKRVEKNEQ 478

Query: 499 WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
           WTLFSPDEV DLH LYG +FE AY NYE++A+RGEIK+FRKI+AV+LWRKMLTM+FETGH
Sbjct: 479 WTLFSPDEVGDLHHLYGHDFEKAYSNYEKKAERGEIKLFRKIAAVSLWRKMLTMVFETGH 538

Query: 559 PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDY 618
           PWITFKDPCNIRSPQQHVG V  SNLCTEITLN S +E AVCNLGSINL AH   N  DY
Sbjct: 539 PWITFKDPCNIRSPQQHVGNVLCSNLCTEITLNISKDEVAVCNLGSINLAAHLTENGLDY 598

Query: 619 DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
           DKLA+TI TAVR+LDNVID+N + I+KA+ SN  HR IGLGLMGFQSALH L IPY S E
Sbjct: 599 DKLANTIHTAVRMLDNVIDVNRYAIKKAENSNRKHRPIGLGLMGFQSALHALRIPYESVE 658

Query: 679 AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAM 738
           AV+ AD+SMEFISFHAISAS  LA+ERG YS+FKGSLW +G+ PIDS+ LL EVRD+  +
Sbjct: 659 AVDFADQSMEFISFHAISASTNLAEERGPYSTFKGSLWSKGILPIDSLQLLEEVRDKCEI 718

Query: 739 NRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGD 798
           +++SRL WD L++RVK++GMRNSNCMAIAPTATI+NICGVSQSI+PSYQNL+VKSNMSGD
Sbjct: 719 DKSSRLGWDVLRERVKSVGMRNSNCMAIAPTATISNICGVSQSIEPSYQNLFVKSNMSGD 778

Query: 799 FTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIE 858
           FT+VNS LVN+LK R LWDE MISDLK++DGSIGNIERIP+DLKK+HATAFEIDP+WLI+
Sbjct: 779 FTIVNSCLVNDLKARGLWDEVMISDLKHYDGSIGNIERIPEDLKKLHATAFEIDPIWLIK 838

Query: 859 SASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKG 918
           +ASRRQKWIDQAQSLNLYL +PSGKKLDFIYRQ+WLMGLKTTYYLRSRSAT VEKSTLK 
Sbjct: 839 AASRRQKWIDQAQSLNLYLSDPSGKKLDFIYRQSWLMGLKTTYYLRSRSATHVEKSTLKE 898

Query: 919 VDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           VDGKLN+VP+ D NSS       SSC S  ECEVCQ
Sbjct: 899 VDGKLNSVPIMDHNSSELLSTPQSSCDSGVECEVCQ 934


>gi|299065647|emb|CBJ36819.1| Ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           solanacearum CMR15]
          Length = 987

 Score =  976 bits (2522), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/988 (55%), Positives = 685/988 (69%), Gaps = 48/988 (4%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKI--KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
                    + P+              ++I+RNG V  F+PSKI+ A+ KAF+AV G   
Sbjct: 10  SGTANPTAFSQPAEGTAVASGAGYADYKIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQG 69

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S RV+++++ LT+  V  LL+   +    HIED+QDQVE +LM+SG H + R YVLYR
Sbjct: 70  AASARVRELVEGLTQNVVRALLRSRPNGGTFHIEDVQDQVELALMRSGEHDVARAYVLYR 129

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIV 181
           E RS  RA    +    P    L +  D G     +   L  ++  AC+ L + V  + +
Sbjct: 130 ERRSQERAQAGET-QQQPAFIGLNVT-DGGITRPLDMAALRNLIVSACADLGESVDPEPI 187

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           L ET KN+Y+G+  S +  + I ++RTLIEK+P Y++ TAR LL  +RRE+L       +
Sbjct: 188 LKETVKNLYEGVPMSQVYDSAILAARTLIEKDPAYSQATARILLHTIRREILG------E 241

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           + T  EM   Y +YF ++I+ G+ A LL + +  FDL  L   L   RD  F YLGLQ L
Sbjct: 242 EVTQAEMAGRYADYFPQFIKRGINAGLLDDKLAQFDLAKLGAALDASRDLQFNYLGLQTL 301

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLHI+  RIEMPQAFFMRVAMGL+L E ++E RAVEFY LLSSF FM STPTLFNS
Sbjct: 302 YDRYFLHISEKRIEMPQAFFMRVAMGLSLNEIDREARAVEFYQLLSSFDFMSSTPTLFNS 361

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKS
Sbjct: 362 GTCRSQLSSCYLTTVSDDLDGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKS 421

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT
Sbjct: 422 QGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNT 481

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFMKRV +   WTLFSP    DLHD  G+ FE AY  YE +  RGEIK+F+K+ 
Sbjct: 482 ANWIPDLFMKRVMEGGEWTLFSPSTCPDLHDKVGRAFEAAYLGYEEKVARGEIKLFKKMP 541

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A+ LWRKML MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCN
Sbjct: 542 AMQLWRKMLGMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCN 601

Query: 602 LGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAI 656
           LGS+NL+AH           D+DKL  T+RTA+R+LDNVIDIN + ++KA+ SN  HR +
Sbjct: 602 LGSVNLVAHVVKQADGSYALDHDKLKKTVRTAMRMLDNVIDINYYAVKKARDSNLRHRPV 661

Query: 657 GLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLW 716
           GLG+MGFQ +LH+L IPYA+  AV+ AD SME + ++A  AS ELA+ERG YS++KGSLW
Sbjct: 662 GLGIMGFQDSLHVLRIPYATDAAVQFADTSMEAVCYYAYWASTELAEERGRYSTYKGSLW 721

Query: 717 DQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANI 775
           D+GV P DS+ LLA+ R   L  + +S + WD L+ R++  GMRNSNC+AIAPTATI+NI
Sbjct: 722 DRGVLPQDSLKLLAQERGGYLEADLSSTMDWDGLRARIQQHGMRNSNCVAIAPTATISNI 781

Query: 776 CGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIE 835
            GVS  I+P+YQNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DGS+  I+
Sbjct: 782 IGVSACIEPTYQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGSLARID 841

Query: 836 RIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLM 895
           RIP DL+ ++ATAFE++P WL+E+ASRRQKWIDQAQSLN+Y+   SGK LD  Y+ AWL 
Sbjct: 842 RIPQDLRDLYATAFEVEPQWLVEAASRRQKWIDQAQSLNIYMAGASGKMLDDTYKLAWLR 901

Query: 896 GLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDP-----------------------N 932
           GLKTTYYLR+  AT VEKST+    G LNAV                             
Sbjct: 902 GLKTTYYLRTIGATHVEKSTVSR--GTLNAVSSGSDVGSVAAAGAAPVASASALDSVAAT 959

Query: 933 SSTHSLGIPSSCTSDT------ECEVCQ 954
           +        + CT         ECE CQ
Sbjct: 960 APAMPEAEGAVCTMRPGDPGFEECEACQ 987


>gi|94312019|ref|YP_585229.1| ribonucleotide-diphosphate reductase subunit alpha [Cupriavidus
           metallidurans CH34]
 gi|93355871|gb|ABF09960.1| Ribonucleoside-diphosphate reductase alpha subunit [Cupriavidus
           metallidurans CH34]
          Length = 979

 Score =  976 bits (2522), Expect = 0.0,   Method: Composition-based stats.
 Identities = 554/953 (58%), Positives = 694/953 (72%), Gaps = 34/953 (3%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
           +  ++I+RNG V SF+P+KI+ A+ KAF+AV G   + S RV++I++ LT+  V  L++ 
Sbjct: 36  QDYKLIRRNGAVVSFEPNKIAVAMTKAFLAVNGGQGAGSARVREIVEQLTQNVVRALVRS 95

Query: 87  NKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAP--K 144
             +    HIED+QD VE +LM+SG H++ R YVLYRE+R+  RA  +             
Sbjct: 96  RPNGGTFHIEDVQDHVELALMRSGEHEVARAYVLYREKRTQERAQANAQAVARVQEAGVS 155

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALI 203
             +  D+G     +   L  +++ ACSGL + VS++ +L ET KN+YDG+  + +  + I
Sbjct: 156 FNVT-DNGVTYQLDLVALHALIDNACSGLGKAVSAEPILKETLKNLYDGVPMTQVYDSAI 214

Query: 204 FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
            ++RTLIEK+P Y++VTAR LL  +R+E+L        + T  EM   Y EYF ++I  G
Sbjct: 215 LAARTLIEKDPAYSQVTARILLHTIRKEILGA------EVTQTEMATKYAEYFPKFIARG 268

Query: 264 VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMR 323
           ++A LL E +  +DL  L   L   RDF F YLGLQ LYDRYFLH++  RIEMPQAFFMR
Sbjct: 269 IEAELLDEKLATYDLARLGAALDASRDFQFNYLGLQTLYDRYFLHVDEVRIEMPQAFFMR 328

Query: 324 VAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGI 383
           VAMGLAL+E ++E RA+EFY LLSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI
Sbjct: 329 VAMGLALEEKDREARAIEFYQLLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVSDDLEGI 388

Query: 384 FGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGK 443
           + AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGK
Sbjct: 389 YEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGK 448

Query: 444 RKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFS 503
           RKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +N  WTLFS
Sbjct: 449 RKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMENGEWTLFS 508

Query: 504 PDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITF 563
           P    DLHD  GK FE AY  YE +A  GE+K+F+K+ A+ LWRKML MLFETGHPWITF
Sbjct: 509 PASCPDLHDKVGKAFEQAYLGYEAKAANGELKLFKKVPAMQLWRKMLGMLFETGHPWITF 568

Query: 564 KDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF-----DY 618
           KDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D+
Sbjct: 569 KDPCNIRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLVAHLMQQADGTYVLDH 628

Query: 619 DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
            KL  TIRTA+R+LDNVIDIN + +EKA+ SN  HR +G+G+MGFQ  LH+L  PYAS  
Sbjct: 629 AKLQKTIRTAMRMLDNVIDINYYAVEKARNSNLRHRPVGMGIMGFQDCLHVLRTPYASDA 688

Query: 679 AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELA 737
           AV+ AD SME + ++A  AS ELA+ERG YS+++GSLWD+G+ P DS+ LLAE R   L 
Sbjct: 689 AVKFADTSMEAVCYYAYQASTELAEERGRYSTYEGSLWDRGILPQDSLKLLAEERGGYLD 748

Query: 738 MNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG 797
           ++ +S + WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG
Sbjct: 749 VDLSSTMDWDSLRGRIKQHGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSG 808

Query: 798 DFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLI 857
           +FTVVN +LV +LK+R LWDE M++DLKY DGS+  I+RIP DL+ I+ATAFE++P WL+
Sbjct: 809 EFTVVNDYLVRDLKERGLWDEVMVADLKYFDGSLARIDRIPQDLRDIYATAFEVEPTWLV 868

Query: 858 ESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+ +AT VEKST++
Sbjct: 869 EAASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTMAATHVEKSTVQ 928

Query: 918 GVDGKLNAVPVTDPNSST----------HSLGIPSSCTSDT------ECEVCQ 954
              G LNAV       S                 + CT         ECE CQ
Sbjct: 929 R--GSLNAVSSGADGQSGIDAAASAAPAMPEAEGAVCTMRPGDPGFEECEACQ 979


>gi|17547524|ref|NP_520926.1| ribonucleotide-diphosphate reductase subunit alpha [Ralstonia
           solanacearum GMI1000]
 gi|17429828|emb|CAD16512.1| putative ribonucleoside reductase 1 (large chain) oxidoreductase
           protein [Ralstonia solanacearum GMI1000]
          Length = 987

 Score =  976 bits (2522), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/988 (55%), Positives = 688/988 (69%), Gaps = 48/988 (4%)

Query: 5   KDVNKGDEDAFPSLAYPFPEKI--KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
                    + P+              ++I+RNG V  F+PSKI+ A+ KAF+AV G   
Sbjct: 10  SGTANPTAFSQPAEGTAVASGAGYADYKIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQG 69

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S RV+++++ LT+  V  LL+   +    HIED+QDQVE +LM+SG H + R YVLYR
Sbjct: 70  AASARVRELVEGLTQNVVRALLRSRPNGGTFHIEDVQDQVELALMRSGEHDVARAYVLYR 129

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIV 181
           E RS  RA    +    P    L +  D G     +   L  ++  AC+GL + V  + +
Sbjct: 130 ERRSQERAQAGET-QQQPAFIGLNVT-DGGITRPLDMAALRNLIVSACAGLGESVDPEPI 187

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           L ET KN+Y+G+  S +  + I ++RTLIEK+P Y++ TAR LL  +RRE+L       +
Sbjct: 188 LKETVKNLYEGVPMSQVYDSAILAARTLIEKDPAYSQATARILLHTIRREILG------E 241

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           + T  EM   Y +YF ++I+ G+ A LL +++  FDL  L   L   RD  F YLGLQ L
Sbjct: 242 EVTQAEMAGRYADYFPQFIKRGINAGLLDDTLAQFDLAKLGAALDASRDLQFNYLGLQTL 301

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLHI+  RIEMPQAFFMRVAMGL+L E ++E RA+EFY LLSSF FM STPTLFNS
Sbjct: 302 YDRYFLHISDKRIEMPQAFFMRVAMGLSLNEIDREARAIEFYQLLSSFDFMSSTPTLFNS 361

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKS
Sbjct: 362 GTCRSQLSSCYLTTVSDDLDGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKS 421

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT
Sbjct: 422 QGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNT 481

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFMKRV +   WTLFSP    DLHD  GK FE AY  YE +  RGEIK+F+K+ 
Sbjct: 482 ANWIPDLFMKRVMEGGEWTLFSPSTCPDLHDKVGKAFEAAYLGYEDKVARGEIKLFKKMP 541

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A+ LWRKML MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCN
Sbjct: 542 ALQLWRKMLGMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCN 601

Query: 602 LGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAI 656
           LGS+NL+AH           D+DKL  T+RTA+R+LDNVIDIN + ++KA+ SN  HR +
Sbjct: 602 LGSVNLVAHVVKQADGSYALDHDKLKKTVRTAMRMLDNVIDINYYAVKKARDSNLRHRPV 661

Query: 657 GLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLW 716
           GLG+MGFQ ALH+L IPYA+  AV+ AD SME + ++A  AS ELA+ERG YS++KGSLW
Sbjct: 662 GLGIMGFQDALHVLRIPYATDAAVQFADTSMEAVCYYAYWASTELAEERGRYSTYKGSLW 721

Query: 717 DQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANI 775
           D+GV P DS+ LLA+ R   L  + +S + WD L++R++  GMRNSNC+AIAPTATI+NI
Sbjct: 722 DRGVLPQDSLKLLAQERGGYLEADLSSTMDWDGLRERIQQHGMRNSNCVAIAPTATISNI 781

Query: 776 CGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIE 835
            GVS  I+P+YQNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DGS+  I+
Sbjct: 782 IGVSACIEPTYQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGSLARID 841

Query: 836 RIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLM 895
           RIP DL+ ++ATAFE++P WL+E+ASRRQKWIDQAQSLN+Y+   SGK LD  Y+ AWL 
Sbjct: 842 RIPQDLRDLYATAFEVEPQWLVEAASRRQKWIDQAQSLNIYMAGASGKMLDDTYKLAWLR 901

Query: 896 GLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDP-----------------------N 932
           GLKTTYYLR+  AT VEKST+    G LNAV                             
Sbjct: 902 GLKTTYYLRTIGATHVEKSTVSR--GTLNAVSSGSDAGSVAAAGAAPVAPASALDTVAAT 959

Query: 933 SSTHSLGIPSSCTSDT------ECEVCQ 954
           +        + CT         ECE CQ
Sbjct: 960 APAMPDAEGAVCTMRPGDPGFEECEACQ 987


>gi|255019899|ref|ZP_05291974.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [Acidithiobacillus caldus ATCC 51756]
 gi|254970679|gb|EET28166.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [Acidithiobacillus caldus ATCC 51756]
          Length = 945

 Score =  976 bits (2522), Expect = 0.0,   Method: Composition-based stats.
 Identities = 566/960 (58%), Positives = 701/960 (73%), Gaps = 40/960 (4%)

Query: 14  AFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIK 73
           +  S A      +   +VI+RNG V  FD SKI  A+ KAF+AV+G   + S RV+D++ 
Sbjct: 7   SAQSEALEVRADLGRYRVIRRNGSVVPFDASKIQVAMTKAFLAVDGGTGAASARVRDLVG 66

Query: 74  NLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS 133
            LT Q V  L +       +HIEDIQDQVE +LM++G H++ R YVLYREER+  RA + 
Sbjct: 67  RLTAQVVETLERRQPGGGTLHIEDIQDQVELALMRAGEHEVARAYVLYREERARERAQKR 126

Query: 134 HSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDG 192
            +      AP L++   DG+    + +RL  ++ EACSGL + VS   +L  T +N+YDG
Sbjct: 127 EASP--ASAPILRVRHADGSEQPLDLERLRQVIGEACSGLGEAVSVDAILQATQRNLYDG 184

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           +SE +L  A I + R LIE++P YA  TAR LL+++RREVL       + ATH EM   Y
Sbjct: 185 ISEEELFQAPILACRVLIEQDPAYAHATARLLLDRVRREVLG------EPATHAEMAQRY 238

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
           PEYF  Y+  G++  LL   +  FDL  +A  L+ ERD  F+YLGLQILYDRYFLH+   
Sbjct: 239 PEYFKDYLRTGIQHELLDPRLAQFDLDRIAAALRPERDLDFQYLGLQILYDRYFLHVRER 298

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           RIE+PQAF+MRVAMGLAL+E ++E++A+ FY +LS F F+ STPTLFN+GT  PQLSSCF
Sbjct: 299 RIELPQAFWMRVAMGLALEEIDREEQAIAFYEVLSRFEFVSSTPTLFNAGTLRPQLSSCF 358

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTV DDL GI+ A+++NA+L+KYSGGLGNDWTPVR LG++I GTNGKSQGV+PFLKV N
Sbjct: 359 LTTVADDLDGIYEAIKDNALLSKYSGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVN 418

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+R
Sbjct: 419 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMER 478

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V  N  WTLFSP+EV+DLHDL G+ F+  YE+YER AD GEI +F+++ A+ LWRKMLTM
Sbjct: 479 VEANGQWTLFSPNEVADLHDLTGQAFKERYEHYERLADAGEITLFKRLPALQLWRKMLTM 538

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGS+NL+AH  
Sbjct: 539 LFETGHPWITFKDPCNLRSPQQHVGVVHSSNLCTEITLNTSDKEIAVCNLGSVNLVAHLR 598

Query: 613 NNQF-----------------DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRA 655
                                D DKLA T+R A+R+LDNVID+N + + KA+ SN  HR 
Sbjct: 599 AGLPGQGLRTEASADELLALVDTDKLARTVRVAMRMLDNVIDMNYYAVAKARNSNLRHRP 658

Query: 656 IGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSL 715
           +GLGLMGF  AL  L IPYAS  AVE AD S E IS+HAI AS +LA+ERG+Y SF GSL
Sbjct: 659 VGLGLMGFSDALLALRIPYASQAAVEFADISQELISYHAIDASADLARERGSYRSFPGSL 718

Query: 716 WDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
           W QG+ P+DSI LLA  R   + ++R+ RL W+ L+ +V   GMRNSNC+AIAPTATI+N
Sbjct: 719 WSQGILPLDSIELLARSRVAGVDVDRSQRLDWESLRTKV-KGGMRNSNCLAIAPTATISN 777

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           I GVSQ I+P YQNLYVKSN+SG+FTVVN++LV +LK  DLWDE M++DLKY DGS+  I
Sbjct: 778 IVGVSQGIEPIYQNLYVKSNLSGEFTVVNAYLVRDLKAADLWDEVMVNDLKYFDGSVVPI 837

Query: 835 ERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWL 894
           +RIP+ LK ++A AFEIDP WL+E+A+RRQKW+DQ+QSLNLY  +PSGKK+D  YR AW 
Sbjct: 838 DRIPEALKPLYANAFEIDPQWLVEAAARRQKWLDQSQSLNLYFGQPSGKKIDETYRLAWR 897

Query: 895 MGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
            GLKTTYYLRS  AT+ EKST+    G LNAVP            + +    D  CE CQ
Sbjct: 898 RGLKTTYYLRSLGATAAEKSTV--SKGVLNAVPGQ----------VKACAIEDPGCEACQ 945


>gi|260220050|emb|CBA27200.1| Ribonucleoside-diphosphate reductase subunit alpha [Curvibacter
           putative symbiont of Hydra magnipapillata]
          Length = 1306

 Score =  975 bits (2521), Expect = 0.0,   Method: Composition-based stats.
 Identities = 533/928 (57%), Positives = 680/928 (73%), Gaps = 13/928 (1%)

Query: 16  PSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNL 75
           P             Q+I+RNG V  F+P+KI+ A+MKAF+AV G   + S  V++ +  L
Sbjct: 37  PGSESTVTNAFAQYQIIRRNGAVVPFEPNKIAVAMMKAFLAVHGTQGAASASVRETVDGL 96

Query: 76  TEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS 135
           T+Q +  L++        HIED+QDQVE  LM+ GHH+I R YVLYRE R+  RA     
Sbjct: 97  TQQVIRALVRSRPGGGTFHIEDVQDQVELGLMRGGHHEIARAYVLYRERRTQERA--KQV 154

Query: 136 KSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLS 194
            ++AP AP + ++ D+G  +  +  +L+  +E ACSGL  DV +  +L+ET +N+YDG+ 
Sbjct: 155 ATEAPAAPVIHVI-DNGQRVPLDLAQLQFRIETACSGLGADVKAAPILAETMRNLYDGVP 213

Query: 195 ESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPE 254
             ++  A I ++RTLIEK+P+Y   TAR L   + REVL       +     +MQ  Y +
Sbjct: 214 LDEVYKAAILAARTLIEKDPDYTYATARLLFHTISREVLG------RDVAQADMQEAYAD 267

Query: 255 YFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRI 314
           YF  +I+ G+ A LL E +  FDL  L + LK  RD  F+YLGLQ LYDRYFLH   +RI
Sbjct: 268 YFPGFIKRGIAAELLDEKLQQFDLKRLGSALKAGRDLQFDYLGLQTLYDRYFLHEGKTRI 327

Query: 315 EMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLT 374
           E+PQAFFMRVAMGL+L E ++E RA+EFY +LSSF FM STPTLFNSGT   QLSSC+LT
Sbjct: 328 ELPQAFFMRVAMGLSLNEIDREARAIEFYEVLSSFDFMSSTPTLFNSGTLRSQLSSCYLT 387

Query: 375 TVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDT 434
           TVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LG+HI GTNG+SQGV+PFLKV NDT
Sbjct: 388 TVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGSHIKGTNGESQGVVPFLKVVNDT 447

Query: 435 AVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVT 494
           AVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV 
Sbjct: 448 AVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMRRVM 507

Query: 495 QNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLF 554
           +   WTLFSP  V DLHDL+G EFE AY  YE +A RGEIK  R + A  LWRKMLTMLF
Sbjct: 508 EKGTWTLFSPSNVPDLHDLFGAEFEKAYVAYEEKAARGEIKPSRTVQASDLWRKMLTMLF 567

Query: 555 ETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN 614
           ETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+S  ETAVCNLGS+NLL H  + 
Sbjct: 568 ETGHPWITFKDACNVRSPQQHAGVVHSSNLCTEITLNTSDTETAVCNLGSVNLLQHLKDG 627

Query: 615 QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPY 674
             D++KL  TI TA+R+LDNVIDIN + ++KA+ SN  HR +GLGLM FQ +L+ L IPY
Sbjct: 628 ALDHNKLKRTISTAMRMLDNVIDINYYAVKKARDSNMRHRPVGLGLMAFQDSLYELRIPY 687

Query: 675 ASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD 734
           AS  AVE AD+SME IS++A  AS +LA+ERG Y S+KGSLWD+GV P D++ +LA  R 
Sbjct: 688 ASDAAVEFADQSMEAISYYAYWASTDLARERGKYHSYKGSLWDKGVLPPDTLDMLANARG 747

Query: 735 -ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS 793
             + ++R+S L W+ L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+P + NL VKS
Sbjct: 748 GYVEVDRSSTLDWNALRNKIAADGMRNSNCVAIAPTATISNIIGVDASIEPCFGNLSVKS 807

Query: 794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDP 853
           N+SG+FTV+NS+LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P ++K+++ATAFE++ 
Sbjct: 808 NLSGEFTVINSYLVRDLKRLGLWDDVMVMDLKHFDGSLSPIDRVPQEIKQLYATAFEVET 867

Query: 854 MWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK 913
            WL+E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+ SAT  EK
Sbjct: 868 RWLVEAAARRQKWIDQAQSLNIYMAGASGKKLDETYKLAWLRGLKTTYYLRTMSATHAEK 927

Query: 914 STLKGVDGKLNAVPVTDPNSSTHSLGIP 941
           ST+    G+LNAV   +    +  +   
Sbjct: 928 STV--TAGRLNAVSSGNDAQGSTKMSSA 953


>gi|291615086|ref|YP_003525243.1| ribonucleoside-diphosphate reductase, subunit alpha [Sideroxydans
           lithotrophicus ES-1]
 gi|291585198|gb|ADE12856.1| ribonucleoside-diphosphate reductase, alpha subunit [Sideroxydans
           lithotrophicus ES-1]
          Length = 946

 Score =  975 bits (2521), Expect = 0.0,   Method: Composition-based stats.
 Identities = 543/941 (57%), Positives = 682/941 (72%), Gaps = 24/941 (2%)

Query: 26  IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQ 85
           +   +VI+RNG V SF+PSKIS A+ KAF+AV G   + S RV+++++ LT   V+ L++
Sbjct: 18  LDQYKVIRRNGSVVSFEPSKISIAVTKAFIAVNGGQGAASARVRELVEQLTANVVSALIR 77

Query: 86  HNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKL 145
                  +HIEDIQDQVE SLM+SG H + R YVLYRE+R+  R+        AP     
Sbjct: 78  RQPHGGTLHIEDIQDQVELSLMRSGEHDVARSYVLYREQRTRERSKGKKEIDAAPALN-- 135

Query: 146 KIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIF 204
             + D       +  +L   ++ AC GL   V +  +L  T K++YDG++  ++    I 
Sbjct: 136 --IKDGDVTRPLDVVQLSAQIQSACVGLGGAVDADKILKLTLKDLYDGVAVEEVRKCAIL 193

Query: 205 SSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGV 264
           S+RTLIE++P Y+ VTAR LL  +  E+L        + +  +M   Y EYF ++I+ G+
Sbjct: 194 SARTLIEQDPAYSFVTARLLLNNICCEILG------GQVSQADMAERYAEYFPKFIKRGI 247

Query: 265 KARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRV 324
           +A LL+E +  FDL  LA  L   RD  F YLGLQ LYDRYFLH++G RIE+PQAFFMRV
Sbjct: 248 EAELLNEELGHFDLDRLAGALDSSRDLQFNYLGLQTLYDRYFLHVDGQRIELPQAFFMRV 307

Query: 325 AMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AMGL+L E  +E+RA+EFY LLSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+
Sbjct: 308 AMGLSLNEINREERAIEFYRLLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIY 367

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
            AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKR
Sbjct: 368 EALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKR 427

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT+NWIPDLFMKRV +   WTLFSP
Sbjct: 428 KGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTSNWIPDLFMKRVMEGGEWTLFSP 487

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
               DLHD +G EFE AY  YE +   GE+K+F+K+ A +LWRKMLTMLFETGHPWITFK
Sbjct: 488 STCPDLHDKFGAEFEKAYTAYEAKVASGELKLFKKVPAQSLWRKMLTMLFETGHPWITFK 547

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLA------HFANNQFDY 618
           DPCNIRSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL A      H    Q D+
Sbjct: 548 DPCNIRSPQQHVGVVHSSNLCTEITLNTSDSEIAVCNLGSVNLAAHLFPKGHAKAGQIDH 607

Query: 619 DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
           DKL  T+ TA+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LH L IPY+S  
Sbjct: 608 DKLKRTVSTAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHDLRIPYSSDA 667

Query: 679 AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELA 737
           A+E AD SME + ++A  AS +LA ERG Y+S++GSLWD+G+ P DS+ LL E R   + 
Sbjct: 668 AIEFADRSMEAVCYYAYWASTDLAAERGRYASYRGSLWDKGILPQDSLNLLLEQRGGYVE 727

Query: 738 MNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG 797
           ++ +S L WD L+ R++  GMRNSNC+AIAPTATI+NI GVS  I+P+YQN++VKSN+SG
Sbjct: 728 VDMSSNLDWDALRARIQQNGMRNSNCVAIAPTATISNIIGVSACIEPTYQNIFVKSNLSG 787

Query: 798 DFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLI 857
           +FTV+N  LVN+LK   LWDE MI+DLKY DGS+  I+RIP +L++++ATAFE++P WLI
Sbjct: 788 EFTVINDHLVNDLKALGLWDEVMIADLKYFDGSLAKIDRIPAELRELYATAFEVEPKWLI 847

Query: 858 ESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           E+ASRRQKWIDQAQSLN+Y+   SG+KLD  Y+ AWL GLKTTYYLR+  ATS EKST +
Sbjct: 848 EAASRRQKWIDQAQSLNIYMSGVSGRKLDETYKLAWLRGLKTTYYLRALGATSAEKSTSR 907

Query: 918 GVDGKLNAVPV----TDPNSSTHSLGIPSSCTSDTECEVCQ 954
              G LNAV       + ++S            + ECE CQ
Sbjct: 908 A--GSLNAVSSGGGAGEMSASPVVEEAKFCSIDNPECEACQ 946


>gi|91785258|ref|YP_560464.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           xenovorans LB400]
 gi|91689212|gb|ABE32412.1| Ribonucleoside-diphosphate reductase [Burkholderia xenovorans
           LB400]
          Length = 1001

 Score =  975 bits (2519), Expect = 0.0,   Method: Composition-based stats.
 Identities = 547/918 (59%), Positives = 679/918 (73%), Gaps = 23/918 (2%)

Query: 6   DVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRS 65
              +G +   P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S
Sbjct: 21  GQAQGAQALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAAS 74

Query: 66  IRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREER 125
            RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLYRE+R
Sbjct: 75  ARVRELVEQLTQNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKR 134

Query: 126 SDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSE 184
           +  R    H        P L +  D+G     +   L  I+E ACS L D VS+  +++E
Sbjct: 135 TQAR---GHDDQIVANTPGLNVT-DNGVTRPLDMAALRGIIELACSNLGDAVSADPIIAE 190

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       ++ T
Sbjct: 191 TVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREIL------EEEVT 244

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
             EM   Y EYF ++I+ GV+A LL + ++ FDL  L   L   RD  F YLGLQ LYDR
Sbjct: 245 QTEMGERYAEYFPQFIKRGVQAELLDDKLLQFDLKRLGAALDNNRDLQFGYLGLQTLYDR 304

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YFLH +G RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LS+F FM STPTLFNSGTR
Sbjct: 305 YFLHHDGVRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSTFDFMSSTPTLFNSGTR 364

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
             QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV
Sbjct: 365 RSQLSSCYLTTVDDDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGV 424

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW
Sbjct: 425 VPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANW 484

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+KI A  
Sbjct: 485 IPDLFMKRVMEGGDWTLFSPSTCPDLHDKFGAEFETAYTAYEDKVARGEIKLFKKIPAAQ 544

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS
Sbjct: 545 LWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGS 604

Query: 605 INLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLG 659
           +NL+AH           D+DKL  T+  A+R+LDNVIDIN + + KA+ SN  HR +G+G
Sbjct: 605 VNLVAHLKEQADGTLVLDHDKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMG 664

Query: 660 LMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQG 719
           +MGFQ  LHLL  PYAS EAV  AD SME + ++A  AS ELAQERG YSS++GSLWD+G
Sbjct: 665 IMGFQDCLHLLRTPYASEEAVRFADTSMEAVCYYAYYASTELAQERGRYSSYRGSLWDRG 724

Query: 720 VFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
           + P DS+ LLAE R   + ++ +  + W EL+ R+   GMRNSNC+AIAPTATI+NI GV
Sbjct: 725 ILPQDSVKLLAEARGGYVEVDSSESMDWTELRSRIAQYGMRNSNCVAIAPTATISNIIGV 784

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           S  I+P++QNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DG++  I+RIP
Sbjct: 785 SACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIP 844

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD IY+ AW+ GLK
Sbjct: 845 ADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEIYKLAWVRGLK 904

Query: 899 TTYYLRSRSATSVEKSTL 916
           TTYYLR+ +AT VEKST+
Sbjct: 905 TTYYLRTMAATHVEKSTV 922


>gi|307546479|ref|YP_003898958.1| ribonucleotide-diphosphate reductase subunit alpha [Halomonas
           elongata DSM 2581]
 gi|307218503|emb|CBV43773.1| ribonucleotide-diphosphate reductase subunit alpha [Halomonas
           elongata DSM 2581]
          Length = 968

 Score =  974 bits (2517), Expect = 0.0,   Method: Composition-based stats.
 Identities = 536/965 (55%), Positives = 681/965 (70%), Gaps = 32/965 (3%)

Query: 16  PSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNL 75
           PS++   P   + ++VIKR G V  FD  KI+ A+ KAF+AVEG  A+ S RV+D ++  
Sbjct: 10  PSVSVTAP---QTLRVIKRTGDVVPFDSGKIAVALSKAFIAVEGDNAATSSRVRDFVQRA 66

Query: 76  TEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS 135
           +E      L+       +HIEDIQDQVE +LM++G  K+ R YVLYREE +  RA     
Sbjct: 67  SENIEQAFLRRMPDGGTLHIEDIQDQVELALMRAGEQKVARAYVLYREEHARARAESGAD 126

Query: 136 KSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSE 195
            +     P L +   DG+    +  R+E +V +AC  L +V    ++ ++ KN+YDG++ 
Sbjct: 127 ITK--PHPTLNVTAPDGSTRPLDLGRVETLVFDACENLANVEPGKIVEDSLKNLYDGVTV 184

Query: 196 SDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEY 255
             +  AL+ ++RTL+EK+PNY  VTAR L + LRRE L +     ++AT+ EM   Y   
Sbjct: 185 DGVSQALMMTARTLVEKDPNYTYVTARLLQDNLRREAL-SFLGIAEEATYQEMADYYKPA 243

Query: 256 FCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIE 315
           F  YI +G++   L   + +FDL  L + L + RD  F YLGLQ LYDRYF+H +  R E
Sbjct: 244 FQAYIAKGIEFEQLDPRLAEFDLERLGDALDHTRDAQFTYLGLQTLYDRYFIHRDEVRYE 303

Query: 316 MPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTT 375
           +PQ  FMRVAMGLAL E ++E RA+EFY LLSSF +M STPTLFNSGT   QLSSC+LTT
Sbjct: 304 LPQVMFMRVAMGLALNEDDREARAIEFYELLSSFDYMASTPTLFNSGTVRSQLSSCYLTT 363

Query: 376 VPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTA 435
           VPDDL  I+ A+++NA+L+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTA
Sbjct: 364 VPDDLDNIYSAIRDNALLSKWAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTA 423

Query: 436 VAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ 495
           VAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKRV  
Sbjct: 424 VAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKRVFD 483

Query: 496 NAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFE 555
           +  WTLFSP    DLHDLYG  FE  Y+ YE     G++K+F+++ A  LWR+ML+MLFE
Sbjct: 484 DGEWTLFSPATCPDLHDLYGAAFEKRYQEYEEMTRNGQLKLFKRVRAKDLWRRMLSMLFE 543

Query: 556 TGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ 615
           TGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S +E AVCNLGSINL  H  + Q
Sbjct: 544 TGHPWITFKDPCNLRSPQQHAGVVHSSNLCTEITLNTSPDEIAVCNLGSINLAQHVTDGQ 603

Query: 616 FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA 675
           FD DKL  T++TAVR+LDNVIDIN + + +A++SN  HR +GLG+MGFQ AL+   I YA
Sbjct: 604 FDGDKLKKTVKTAVRMLDNVIDINYYAVPQAERSNFKHRPVGLGIMGFQDALYAQDIAYA 663

Query: 676 SPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD- 734
           S EAV  AD SME +S+HAI AS +LA ERG Y S++GSLW QG+ PIDSI  L + R  
Sbjct: 664 SDEAVAFADTSMELVSYHAIEASSDLAAERGHYESYEGSLWSQGILPIDSIEKLKQERGE 723

Query: 735 -ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS 793
             + ++ ++   WD +++++   GMRNSN MAIAPTATI+NICGVSQSI+P+YQNL+VKS
Sbjct: 724 KYIEVDTSTTQDWDRIREKIAVQGMRNSNVMAIAPTATISNICGVSQSIEPTYQNLFVKS 783

Query: 794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDP 853
           N+SG+FTVVN+++VN+LK+R LWDE MI+DLKY+DGS+  I+R+P+DLK  +ATAFE +P
Sbjct: 784 NLSGEFTVVNAYMVNDLKERGLWDEVMINDLKYYDGSVQAIDRVPEDLKAKYATAFETEP 843

Query: 854 MWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK 913
            WL+E+A+RRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+  ATSVEK
Sbjct: 844 KWLVEAAARRQKWIDQAQSLNLYIQGVSGKKLDVTYRMAWFRGLKTTYYLRALGATSVEK 903

Query: 914 STLKG-----------------------VDGKLNAVPVTDPNSSTHSLGIPSSCTSDT-E 949
           ST+                            +   V       S      PS+   D   
Sbjct: 904 STVDRGNLNAVSNASPSTAPAPAPEATPQAQEPRGVDDFLKGKSGSGSRAPSAGEIDELG 963

Query: 950 CEVCQ 954
           CE CQ
Sbjct: 964 CEACQ 968


>gi|119478321|ref|ZP_01618352.1| ribonucleotide-diphosphate reductase alpha subunit [marine gamma
           proteobacterium HTCC2143]
 gi|119448661|gb|EAW29906.1| ribonucleotide-diphosphate reductase alpha subunit [marine gamma
           proteobacterium HTCC2143]
          Length = 962

 Score =  974 bits (2517), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/941 (58%), Positives = 696/941 (73%), Gaps = 8/941 (0%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
            L    P +   V+VIKRNG V S+D SKI+ AI KAF+AVEG  A+ S R+ + ++ L+
Sbjct: 27  ELQATAPGQ---VRVIKRNGTVVSYDDSKIAVAITKAFLAVEGGSAAASSRIHETVEKLS 83

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
            Q      +   S   +HIEDIQDQVE +LM+SG HK+ R+YVLYREER      +  + 
Sbjct: 84  LQVSAIFKRRMPSGGTIHIEDIQDQVELALMRSGEHKVARDYVLYREERRLQ-REEKKAS 142

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
                 P +++ + DG+ +  +  R+E++V EAC GL DV +++++ E  KN+YDG+  +
Sbjct: 143 EPTKAHPTIRVTLSDGSQVPLDLGRMEVVVSEACDGLADVKAQVIIDEALKNLYDGVPIA 202

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           D+ T+L+ +SRTL+EKEPNY+ VTAR LL+ LR E L         AT  EM  LY +  
Sbjct: 203 DVNTSLVITSRTLVEKEPNYSYVTARLLLDNLRAEALP-FLGIANSATQSEMASLYAKAL 261

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             YI +G++  LL  +++D+DL  L   L   RD  F YLGLQ LYDRYF+H N  RIE+
Sbjct: 262 PAYINKGIELELLAPNLLDYDLDKLGQALDANRDQLFNYLGLQTLYDRYFIHSNDIRIEL 321

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRVAMGLA +E  +E RA+EFY LLSSF +M STPTLFN+GT  PQLSSC+LTTV
Sbjct: 322 PQIFFMRVAMGLAYREENREDRAIEFYRLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTV 381

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
           PDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LGA+I GTNGKSQGV+PFLKV NDTAV
Sbjct: 382 PDDLHGIYGAIQDNAMLSKWAGGLGNDWTPVRALGAYIKGTNGKSQGVVPFLKVVNDTAV 441

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW+PDLFMKRV  +
Sbjct: 442 AVNQGGKRKGAVCAYLETWHMDIEEFVELRKNTGDDRRRTHDMNTANWVPDLFMKRVFDD 501

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLFSP++V DLHDLYG+ FE  Y  YE Q   G++K+F+ + A  LWRKML MLFET
Sbjct: 502 GEWTLFSPNDVPDLHDLYGEAFETRYTEYEAQCKSGDMKLFKTVRAQELWRKMLGMLFET 561

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+S EE AVCNLGS+NL  H + N  
Sbjct: 562 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTSKEEIAVCNLGSVNLAQHVSENGL 621

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D  KL  TI TAVR+LDNVIDIN +++ +A+ SN  HR +GLGLMGFQ AL+  H+ Y S
Sbjct: 622 DLSKLEKTITTAVRMLDNVIDINYYSVGQAETSNMRHRPVGLGLMGFQDALYNQHMAYGS 681

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-- 734
            +AVE AD SME IS+ AI AS  LA+ERG+YS+F+GSLW QG+ PIDS+  L   R   
Sbjct: 682 DQAVEFADRSMEAISYFAIQASSALAEERGSYSTFEGSLWSQGILPIDSVKTLIAERGND 741

Query: 735 ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
            + ++++  L W  L+ RV+  GMRNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN
Sbjct: 742 YIDVDQSQTLDWSSLRTRVQQKGMRNSNVMAIAPTATIANITGVSQSIEPTYQNLYVKSN 801

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTVVN  LV +LK R LWD  M++DLKY++GS+ NI+R+P ++K+++ATAFE++P 
Sbjct: 802 LSGEFTVVNPHLVKDLKARGLWDNVMVNDLKYYEGSLQNIDRVPVEVKQLYATAFEVEPR 861

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +AT  EKS
Sbjct: 862 WIVDAASRRQKWIDQAQSLNLYISGASGKKLDITYRMAWYKGLKTTYYLRALAATGTEKS 921

Query: 915 TLKGVDGKLNAVPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           T+        +     P ++     +P +C+  D +CE CQ
Sbjct: 922 TIDTGSLNAVSSKTEAPVAAAGPAPVPEACSLDDPDCEACQ 962


>gi|167574514|ref|ZP_02367388.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           oklahomensis C6786]
          Length = 944

 Score =  974 bits (2517), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/943 (58%), Positives = 691/943 (73%), Gaps = 23/943 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLAGGAQGAPALASQTTY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  LL+   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQSVVRALLRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A   +  +   A  + +  D+G     +   L  ++  AC GL D VS +
Sbjct: 131 REKRHLERVHAGEAADVETSAAGGINVT-DNGVTRPLDMSALHALIVSACEGLGDAVSPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            ++SET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVSETVKNLYDGVPMTQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMSMRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGSYALDQEKLKRTVGVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPVLRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+R+P DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRVPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTH 936
           L GLKTTYYLR+ +AT VEKST+    G LNAVP +  +S   
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTSGGSSGGA 944


>gi|167721299|ref|ZP_02404535.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei DM98]
          Length = 942

 Score =  974 bits (2517), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/940 (58%), Positives = 693/940 (73%), Gaps = 23/940 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPFAGGAQGAPALASQTTY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQTVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A     ++A  A  + +  D+G   + +   L  ++  AC GL + VS +
Sbjct: 131 REKRHLERVHAGEAEAAEASPAGGINVT-DNGVTRALDLNALRALIVSACEGLGNAVSPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMTQVYDSSILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMTTRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGSYALDEEKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS EAVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASDEAVEFADRSMEAVCYYAYWASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPALRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNS 933
           L GLKTTYYLR+ +AT VEKST+    G LNAVP +   S
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTSGGTS 941


>gi|325528899|gb|EGD05935.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           sp. TJI49]
          Length = 963

 Score =  973 bits (2516), Expect = 0.0,   Method: Composition-based stats.
 Identities = 545/937 (58%), Positives = 678/937 (72%), Gaps = 25/937 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G     P   +         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLGGAAQGAPALAPQATF------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV++++  LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVDQLTHNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVRA---AQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VS 177
           RE+R   R     ++           + ++ D+G     +   L  +V  AC GL   V+
Sbjct: 131 REKRHLERQHAGEEAAVAGGEAAGGVINVV-DNGVTRPLDLNALRALVVSACDGLGAAVN 189

Query: 178 SKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVY 237
              +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L    
Sbjct: 190 PDPIVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG--- 246

Query: 238 KKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLG 297
              ++    EM   Y EYF ++++ GV A LL + ++ FDL  L + L   RD  F YLG
Sbjct: 247 ---EEVVQAEMSTRYAEYFPQFLKRGVDAGLLDDKLLQFDLKRLGDALDASRDLQFGYLG 303

Query: 298 LQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPT 357
           LQ LYDRYFLH+ G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPT
Sbjct: 304 LQTLYDRYFLHVGGTRIEMPQAFFMRVAMGLSLNEIDRETRAIEFYNVLSSFDFMSSTPT 363

Query: 358 LFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGT 417
           LFNSGT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GT
Sbjct: 364 LFNSGTHRSQLSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGT 423

Query: 418 NGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTH 477
           NGKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTH
Sbjct: 424 NGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTH 483

Query: 478 DMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVF 537
           DMNTANWIPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F
Sbjct: 484 DMNTANWIPDLFMKRVMEGGEWTLFSPSTCPDLHDKFGAEFEAAYTAYEEKVARGEIKLF 543

Query: 538 RKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEET 597
           +KI A  LWRKML MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  E 
Sbjct: 544 KKIPAQQLWRKMLGMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTSDTEI 603

Query: 598 AVCNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHT 652
           AVCNLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  
Sbjct: 604 AVCNLGSVNLVAHLVKQADGSYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLK 663

Query: 653 HRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFK 712
           HR +G+G+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++
Sbjct: 664 HRPVGMGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYR 723

Query: 713 GSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTAT 771
           GSLWD+G+ P D++ LLAE R   + ++ +  L W  L+ R+   GMRNSNC+AIAPTAT
Sbjct: 724 GSLWDRGILPQDTLKLLAEARGGYVEVDSSESLDWTALRARIAAHGMRNSNCVAIAPTAT 783

Query: 772 IANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSI 831
           I+NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +
Sbjct: 784 ISNIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGML 843

Query: 832 GNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQ 891
             I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ 
Sbjct: 844 SRIDRIPADLRAIYATAFEVDPTWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKL 903

Query: 892 AWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPV 928
           AWL GLKTTYYLR+ +AT VEKST+    G LNAVP 
Sbjct: 904 AWLRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPT 938


>gi|83746811|ref|ZP_00943859.1| Ribonucleoside-diphosphate reductase alpha chain [Ralstonia
           solanacearum UW551]
 gi|207744362|ref|YP_002260754.1| ribonucleoside reductase 1 (large chain) (partial sequence n
           terminus) protein [Ralstonia solanacearum IPO1609]
 gi|83726580|gb|EAP73710.1| Ribonucleoside-diphosphate reductase alpha chain [Ralstonia
           solanacearum UW551]
 gi|206595767|emb|CAQ62694.1| ribonucleoside reductase 1 (large chain) (partial sequence n
           terminus) protein [Ralstonia solanacearum IPO1609]
          Length = 987

 Score =  973 bits (2516), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/988 (55%), Positives = 688/988 (69%), Gaps = 48/988 (4%)

Query: 5   KDVNKGDEDAFPSLAYPFPEK--IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
                    + P+              ++I+RNG V  F+PSKI+ A+ KAF+AV G   
Sbjct: 10  SGTANPTAFSQPTGGTAVASGDGYADYKIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQG 69

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S RV+++++ LT+  V  LL+   +    HIED+QDQVE +LM+SG H + R YVLYR
Sbjct: 70  AASARVRELVEGLTQNVVRALLRSRPNGGTFHIEDVQDQVELALMRSGEHDVARAYVLYR 129

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIV 181
           E RS  RA    ++   P    L +  D G     +   L  ++  AC+GL D V  + +
Sbjct: 130 ERRSQERAQAGETQQP-PAFIGLNVT-DGGITRPLDMVALRNLIVSACAGLGDAVDPEPI 187

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           L ET KN+Y+G+  S +  + I ++RTLIEK+P Y++ TAR LL  +RRE+L       +
Sbjct: 188 LKETVKNLYEGVPMSQVYDSAILAARTLIEKDPAYSQATARILLHTIRREILG------E 241

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           + T  EM   Y +YF ++I+ G+ A LL +++  FDL  L   L   RD  F YLGLQ L
Sbjct: 242 EVTQAEMAARYVDYFPQFIKRGINAGLLDDTLAQFDLAKLGAALDASRDLQFNYLGLQTL 301

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLHI+  RIEMPQAFFMRVAMGL+L E ++E RA+EFY+LLSSF FM STPTLFNS
Sbjct: 302 YDRYFLHISDKRIEMPQAFFMRVAMGLSLNEIDREARAIEFYHLLSSFDFMSSTPTLFNS 361

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKS
Sbjct: 362 GTCRSQLSSCYLTTVSDDLDGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKS 421

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT
Sbjct: 422 QGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNT 481

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFMKRV +N  WTLFSP    DLHD  G+ FE AY  YE +  RGEI +F+K+ 
Sbjct: 482 ANWIPDLFMKRVMENGEWTLFSPSTCPDLHDKVGRAFEQAYLGYEEKVARGEITLFKKMP 541

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A+ LWRKML MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCN
Sbjct: 542 AMQLWRKMLGMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCN 601

Query: 602 LGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAI 656
           LGS+NL+AH           D+DKL  T+R A+R+LDNVIDIN + ++KA+ SN  HR +
Sbjct: 602 LGSVNLVAHLVQQADGSYALDHDKLKKTVRIAMRMLDNVIDINYYAVKKARDSNLRHRPV 661

Query: 657 GLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLW 716
           GLG+MGFQ ALH+L IPYA+  AV+ AD SME + ++A  AS ELA+ERG YS++KGSLW
Sbjct: 662 GLGVMGFQDALHVLRIPYANEAAVQFADTSMEAVCYYAYWASTELAEERGRYSTYKGSLW 721

Query: 717 DQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANI 775
           D+G+ P DS+ LLA+ R   L  + +S + WD L+ R++  GMRNSNC+AIAPTATI+NI
Sbjct: 722 DRGILPQDSLKLLAQERGGYLEADLSSTMDWDSLRGRIQQYGMRNSNCVAIAPTATISNI 781

Query: 776 CGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIE 835
            GVS  I+P+YQNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DGS+  I+
Sbjct: 782 IGVSACIEPTYQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGSLARID 841

Query: 836 RIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLM 895
           RIP DL+ ++ATAFE++P WL+E+ASRRQKWIDQAQSLN+Y+   SGK LD  Y+ AWL 
Sbjct: 842 RIPQDLRDLYATAFEVEPQWLVEAASRRQKWIDQAQSLNIYMAGASGKMLDDTYKLAWLR 901

Query: 896 GLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDP-----------------------N 932
           GLKTTYYLR+  AT VEKST+    G LNAV                             
Sbjct: 902 GLKTTYYLRTIGATHVEKSTVSR--GTLNAVSSGSDAGSVSAAGAAPVAPASALDAVAAT 959

Query: 933 SSTHSLGIPSSCTSDT------ECEVCQ 954
           +        + CT         ECE CQ
Sbjct: 960 APAMPEAEGAVCTMRPGDPGFEECEACQ 987


>gi|167920555|ref|ZP_02507646.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei BCC215]
          Length = 952

 Score =  973 bits (2516), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/934 (58%), Positives = 691/934 (73%), Gaps = 23/934 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPFAGGAQGAPALASQTTY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQTVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A     ++A  A  + +  D+G   + +   L  ++  AC GL D VS +
Sbjct: 131 REKRHLERVHAGEAEAAEASPAGGINVT-DNGVTRALDLNALRALIVSACEGLGDAVSPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMTQVYDSSILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMTTRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGSYALDEEKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS EAVE AD SME + +HA  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASDEAVEFADRSMEAVCYHAYWASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPALRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           L GLKTTYYLR+ +AT VEKST+    G LNAVP
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVP 935


>gi|167904348|ref|ZP_02491553.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei NCTC 13177]
          Length = 956

 Score =  973 bits (2516), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/936 (58%), Positives = 692/936 (73%), Gaps = 23/936 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPFAGGAQGAPALASQTTY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQTVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A     ++A  A  + +  D+G   + +   L  ++  AC GL D VS +
Sbjct: 131 REKRHLERVHAGEAEAAEASPAGGINVT-DNGVTRTLDLNALRALIVSACEGLGDAVSPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMTQVYDSSILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMTTRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGSYALDEEKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS EAVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASDEAVEFADRSMEAVCYYAYWASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPALRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVT 929
           L GLKTTYYLR+ +AT VEKST+    G LNAVP +
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTS 937


>gi|167912608|ref|ZP_02499699.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 112]
          Length = 953

 Score =  973 bits (2516), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/934 (58%), Positives = 691/934 (73%), Gaps = 23/934 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPFAGGAQGAPALASQTTY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQTVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A     ++A  A  + +  D+G   + +   L  ++  AC GL D VS +
Sbjct: 131 REKRHLERVHAGEAEAAEASPAGGINVT-DNGVTRALDLNALRALIVSACEGLGDAVSPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMTQVYDSSILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMTTRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGSYALDEEKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS EAVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASDEAVEFADRSMEAVCYYAYWASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPALRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           L GLKTTYYLR+ +AT VEKST+    G LNAVP
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVP 935


>gi|167740268|ref|ZP_02413042.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 14]
 gi|167817488|ref|ZP_02449168.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 91]
 gi|167847375|ref|ZP_02472883.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei B7210]
          Length = 954

 Score =  973 bits (2516), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/934 (58%), Positives = 691/934 (73%), Gaps = 23/934 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPFAGGAQGAPALASQTTY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQTVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A     ++A  A  + +  D+G   + +   L  ++  AC GL D VS +
Sbjct: 131 REKRHLERVHAGEAEAAEASPAGGINVT-DNGVTRALDLNALRALIVSACEGLGDAVSPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMTQVYDSSILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMTTRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGSYALDEEKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS EAVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASDEAVEFADRSMEAVCYYAYWASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPALRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           L GLKTTYYLR+ +AT VEKST+    G LNAVP
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVP 935


>gi|89902116|ref|YP_524587.1| ribonucleotide-diphosphate reductase subunit alpha [Rhodoferax
           ferrireducens T118]
 gi|89346853|gb|ABD71056.1| Ribonucleoside-diphosphate reductase [Rhodoferax ferrireducens
           T118]
          Length = 981

 Score =  973 bits (2515), Expect = 0.0,   Method: Composition-based stats.
 Identities = 534/984 (54%), Positives = 690/984 (70%), Gaps = 43/984 (4%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P++  +         +       +   Q+I+RNG V  F+P+KI+ A+MKAF+AV G   
Sbjct: 9   PARHSDVPAVHRMDGIDDTAAHSLSQYQIIRRNGAVVPFEPNKIAVAMMKAFLAVHGTQG 68

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S  V++ +  LT+  +  L++   +    HIED+QDQVE  LM+ GHH++ R YVLYR
Sbjct: 69  AASASVRESVDGLTQGVIHALMRSRPAGGTFHIEDVQDQVELGLMRGGHHEVARAYVLYR 128

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIV 181
           E+R+  RA Q    + A  AP L ++   G ++  +  RL+ I+E AC+GL  D+  + +
Sbjct: 129 EKRTQERAQQ--LIATAATAPLLHVVDKGGRIV-LDLARLKGIIESACAGLGADIKPEPI 185

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           L+ET +N+YDG+   ++  A I ++RTLIEK+P+Y   TAR L   +  EVL       +
Sbjct: 186 LAETMRNLYDGVPMEEVYKASILAARTLIEKDPDYTYATARLLFHTIANEVLG------R 239

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
                +M   Y +YF ++I++G+   LL E +  FDL  L   LK ERD  F+YLGLQ L
Sbjct: 240 DVVQADMAQAYVDYFPQFIKKGIDHELLDERLQQFDLQRLGAALKAERDLKFDYLGLQTL 299

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLH+  +RIE+PQAFFMRVAMGL+L E ++E RA+EFY +LSSF FM STPTLFNS
Sbjct: 300 YDRYFLHVGKARIELPQAFFMRVAMGLSLGEIDREARAIEFYEVLSSFDFMSSTPTLFNS 359

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT   QLSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LGAHI GTNG+S
Sbjct: 360 GTLRSQLSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGAHIKGTNGES 419

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRTHDMNT
Sbjct: 420 QGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRTHDMNT 479

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANW+PDLFM+RV +   WTLFSP+ V DLHD +G +FE AY  YE +A RGEI+  R + 
Sbjct: 480 ANWVPDLFMRRVMEKGQWTLFSPNNVPDLHDKFGADFEKAYVAYEEKAARGEIRPARTVQ 539

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A  LWRKMLTMLFETGHPWITFKD CNIRSPQQHVGVVHSSNLCTEITLN+S  ETAVCN
Sbjct: 540 AADLWRKMLTMLFETGHPWITFKDACNIRSPQQHVGVVHSSNLCTEITLNTSDTETAVCN 599

Query: 602 LGSINLLAHFANNQF---------DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHT 652
           LGS+NLL H  N            D+ KL  TI TA+R+LDNVIDIN + ++KA+ +N  
Sbjct: 600 LGSVNLLQHLKNAPAGSADGAKVLDHAKLQKTITTAMRMLDNVIDINFYAVKKARDANMR 659

Query: 653 HRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFK 712
           HR +GLG+M FQ +L+ L IPYAS  AV  AD SME I ++A  AS ELA+ERG Y+S+K
Sbjct: 660 HRPVGLGVMAFQDSLYELRIPYASDAAVAFADTSMEAICYYAYWASTELARERGQYTSYK 719

Query: 713 GSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTAT 771
           GSLWDQG+ PID++ +LA  R   + ++R+S L W+ L+K++   GMRNSNC AIAPTAT
Sbjct: 720 GSLWDQGILPIDTLDMLARERGGYVEVDRSSTLDWEALRKKIAKDGMRNSNCTAIAPTAT 779

Query: 772 IANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSI 831
           I+NI GV  SI+P + NL VKSN+SG+FT++NS+LV +LK+  LWD+ M+ DLK+ DGS+
Sbjct: 780 ISNIIGVDASIEPCFGNLSVKSNLSGEFTIINSYLVQDLKRLGLWDDVMVMDLKHFDGSL 839

Query: 832 GNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQ 891
             I+R+P D+K ++ATAFEI+  WL+E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ 
Sbjct: 840 NPIDRVPADVKALYATAFEIETRWLVEAAARRQKWIDQAQSLNIYMGGASGKKLDDTYKL 899

Query: 892 AWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPN------------------- 932
           AW+ GLKTTYYLR+ SAT  EKST+    G++NAV     +                   
Sbjct: 900 AWIRGLKTTYYLRTMSATHAEKSTV--TAGRMNAVSSGSESAHGGASMSALDAAAATARM 957

Query: 933 --SSTHSLGIPSSCTSDTECEVCQ 954
             +S  +  I      D  CE CQ
Sbjct: 958 QMASGPATDIKFCGVDDPTCESCQ 981


>gi|332286775|ref|YP_004418686.1| ribonucleotide-diphosphate reductase subunit alpha [Pusillimonas
           sp. T7-7]
 gi|330430728|gb|AEC22062.1| ribonucleotide-diphosphate reductase subunit alpha [Pusillimonas
           sp. T7-7]
          Length = 973

 Score =  973 bits (2515), Expect = 0.0,   Method: Composition-based stats.
 Identities = 545/977 (55%), Positives = 695/977 (71%), Gaps = 35/977 (3%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKI-KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
           P            P+ A    +K      +I+RNG V  F+P KI+ A+ KAF+AV G  
Sbjct: 7   PESGTAALRHPTTPAPAENSSDKPWNNFHIIRRNGVVVGFEPGKIAIAMTKAFLAVNGGQ 66

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT Q V  L+++  S    HIE+IQDQVE +LM+SG H + R YVLY
Sbjct: 67  GAASARVRELVETLTAQVVNALVRNRPSGGTFHIEEIQDQVELTLMRSGEHDVARAYVLY 126

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKI 180
           RE+RS  RA QS     A     + +  D+G     +  RL   + EA   L  ++ ++ 
Sbjct: 127 REKRSQERA-QSTPAPAATDQTIIHVT-DNGVQCPLDLARLRATITEAGLNLPHNIDAEA 184

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +L ET KN+YDG+   ++  + I S+R ++E +P+Y++VTAR LL  +R+EVL       
Sbjct: 185 ILKETVKNIYDGIPVDEVFKSAILSARAMVENDPSYSQVTARLLLHTIRKEVLG------ 238

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           ++ +  +M   Y EYF ++++ G++  LL E +  FDL  LA  LK ERD  F YLGLQ 
Sbjct: 239 EEVSQSDMATRYAEYFPQFLKAGIEGGLLDEKLAQFDLPKLAAALKAERDLQFNYLGLQT 298

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLH+ G RIE+PQ FFMRVAMGLAL E  +E+RA+EFY +LSSF FM STPTLFN
Sbjct: 299 LYDRYFLHLRGRRIELPQVFFMRVAMGLALNEINREERAIEFYEILSSFDFMSSTPTLFN 358

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGT H QLSSC+LTTV DDL GI+ A++ENA+LAKY+GGLGNDWTPVR L +HI GTNG+
Sbjct: 359 SGTLHSQLSSCYLTTVSDDLAGIYDAIKENALLAKYAGGLGNDWTPVRALRSHIKGTNGE 418

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGD+RRRTHDMN
Sbjct: 419 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDERRRTHDMN 478

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRV +N  WTLFSP +  DLHD YGK+FE AY  YE +  RGE+ +F+K+
Sbjct: 479 TANWIPDLFMKRVMENGEWTLFSPSDAPDLHDKYGKDFEEAYLGYEDKVARGELPLFKKV 538

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVC
Sbjct: 539 PANMLWRKMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVC 598

Query: 601 NLGSINLLAHFA-----NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRA 655
           NLGS+NL AH           D++KL  TI  A+R+LDNVIDIN + + KA+ SN  HR 
Sbjct: 599 NLGSVNLAAHLKQDANGQYVLDHEKLERTIGIAMRMLDNVIDINYYAVPKARNSNVRHRP 658

Query: 656 IGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSL 715
           +G+G+MGFQ  LH++ +P+AS +AVE +D SME   ++A  AS +LA ERG Y+SFKGSL
Sbjct: 659 VGMGVMGFQDCLHMMRVPFASDDAVEFSDRSMEAACYYAYWASSKLAAERGHYASFKGSL 718

Query: 716 WDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
           WD+G+ P D++ LL E R   + ++ +S L WD L+  +K  GMRNSNC+AIAPTATI+N
Sbjct: 719 WDRGILPQDTLALLREERGGYVEVDDSSTLDWDSLRAHIKQHGMRNSNCVAIAPTATISN 778

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           I GVS  I+P+Y+NLYVKSN+SG+FTVVN +LV +LK+R LWDE M+SDLKY DGS+  I
Sbjct: 779 IIGVSPCIEPNYRNLYVKSNLSGEFTVVNDYLVRDLKERKLWDEVMVSDLKYFDGSLARI 838

Query: 835 ERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWL 894
           +RIP DL+K++ATAFE+DP W++E A+RR KWIDQAQSLN+++   SGKKLD IY+ AW+
Sbjct: 839 DRIPADLRKLYATAFEVDPTWVVECAARRSKWIDQAQSLNIFMAGVSGKKLDDIYKLAWV 898

Query: 895 MGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSS-----------THSLGIPSS 943
            GLKTTYYLRS  AT+ EKST +G  G+LNAV     +               +  + + 
Sbjct: 899 RGLKTTYYLRSIGATNAEKSTGRG--GELNAVASGSTSPVAAAAAPAVAALPEAEVLGAV 956

Query: 944 CTSDT------ECEVCQ 954
           CT         ECE CQ
Sbjct: 957 CTMRPGDEGFEECEACQ 973


>gi|300703001|ref|YP_003744603.1| ribonucleoside-diphosphate reductase subunit alpha [Ralstonia
           solanacearum CFBP2957]
 gi|299070664|emb|CBJ41959.1| Ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           solanacearum CFBP2957]
          Length = 987

 Score =  973 bits (2514), Expect = 0.0,   Method: Composition-based stats.
 Identities = 548/962 (56%), Positives = 683/962 (70%), Gaps = 42/962 (4%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
              ++I+RNG V  F+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+ 
Sbjct: 34  ADYKIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQGAASARVRELVEGLTQNVVRALLRS 93

Query: 87  NKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLK 146
             +    HIED+QDQVE +LM+SG H + R YVLYRE RS  RA    +    P    L 
Sbjct: 94  RPNGGTFHIEDVQDQVELALMRSGEHDVARAYVLYRERRSQERAQAGET-QQQPAFIGLN 152

Query: 147 IMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFS 205
           +  D G     +   L  ++  AC+GL D V  + +L ET KN+Y+G+  S +  + I +
Sbjct: 153 VT-DGGITRPLDMAALRNLIVSACAGLGDTVDPEPILKETVKNLYEGVPMSQVYDSAILA 211

Query: 206 SRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVK 265
           +RTLIEK+P Y++ TAR LL  +RRE+L       ++ T  EM   Y +YF ++I+ G+ 
Sbjct: 212 ARTLIEKDPAYSQATARILLHTIRREILG------EEVTQAEMAARYVDYFPQFIKRGIN 265

Query: 266 ARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVA 325
           A LL +++  FDL  L   L   RD  F YLGLQ LYDRYFLHI+  RIEMPQAFFMRVA
Sbjct: 266 AGLLDDTLAQFDLAKLGAALDASRDLQFNYLGLQTLYDRYFLHISDKRIEMPQAFFMRVA 325

Query: 326 MGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFG 385
           MGL+L E ++E RA+EFY LLSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ 
Sbjct: 326 MGLSLNEIDREARAIEFYQLLSSFDFMSSTPTLFNSGTCRSQLSSCYLTTVSDDLDGIYE 385

Query: 386 ALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRK 445
           AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRK
Sbjct: 386 ALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRK 445

Query: 446 GAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPD 505
           GAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +N  WTLFSP 
Sbjct: 446 GAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMENGEWTLFSPS 505

Query: 506 EVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKD 565
              DLHD  G+ FE AY  YE +  RGEIK+F+K+ A+ LWRKML MLFETGHPWITFKD
Sbjct: 506 TCPDLHDKVGRAFEQAYLGYEEKVARGEIKLFKKMPAMQLWRKMLGMLFETGHPWITFKD 565

Query: 566 PCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF-----DYDK 620
           PCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D+DK
Sbjct: 566 PCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLVQQADGSYALDHDK 625

Query: 621 LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
           L  T+RTA+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ ALH+L IPYA+  AV
Sbjct: 626 LKKTVRTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGVMGFQDALHVLRIPYANDAAV 685

Query: 681 EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMN 739
           + AD SME + ++A  AS ELA+ERG YS++KGSLWD+G+ P DS+ LLA+ R   L  +
Sbjct: 686 QFADTSMEAVCYYAYWASTELAEERGRYSTYKGSLWDRGILPQDSLKLLAQERGGYLETD 745

Query: 740 RTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDF 799
            +S + WD L+ R++  GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+F
Sbjct: 746 LSSTMDWDSLRGRIQQYGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEF 805

Query: 800 TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
           TVVN +LV +LK R LWDE M++DLKY DGS+  I+RIP DL+ ++ATAFE++P WL+E+
Sbjct: 806 TVVNDYLVRDLKARGLWDEVMVADLKYFDGSLARIDRIPQDLRDLYATAFEVEPQWLVEA 865

Query: 860 ASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKG- 918
           ASRRQKWIDQAQSLN+Y+   SGK LD  Y+ AWL GLKTTYYLR+  AT VEKST+   
Sbjct: 866 ASRRQKWIDQAQSLNIYMAGASGKMLDDTYKLAWLRGLKTTYYLRTIGATHVEKSTVSRG 925

Query: 919 --------------------VDGKLNAVPVTDPNSSTHSLGIPSSCTSDT------ECEV 952
                                    +A+      +        + CT         ECE 
Sbjct: 926 TLNAVSSGSDVGSVSAAGAAPVAPASALDAVAATAPAMPEAEGAVCTMRPGDPGFEECEA 985

Query: 953 CQ 954
           CQ
Sbjct: 986 CQ 987


>gi|167564162|ref|ZP_02357078.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           oklahomensis EO147]
          Length = 953

 Score =  973 bits (2514), Expect = 0.0,   Method: Composition-based stats.
 Identities = 549/935 (58%), Positives = 688/935 (73%), Gaps = 23/935 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLAGGAQGAPALASQTTY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  LL+   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQSVVRALLRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A   +  +   A  + +  D+G     +   L  ++  AC GL D VS +
Sbjct: 131 REKRHLERVHAGEAADVETSAAGGINVT-DNGVTRPLDMSALHALIVSACEGLGDAVSPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            ++SET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVSETVKNLYDGVPMTQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMSMRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV + A WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAV 603

Query: 600 CNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH A         D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGSYALDQEKLKRTVGVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPVLRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+R+P DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRVPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPV 928
           L GLKTTYYLR+ +AT VEKST+    G LNAVP 
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPT 936


>gi|295677727|ref|YP_003606251.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. CCGE1002]
 gi|295437570|gb|ADG16740.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. CCGE1002]
          Length = 1003

 Score =  973 bits (2514), Expect = 0.0,   Method: Composition-based stats.
 Identities = 560/928 (60%), Positives = 691/928 (74%), Gaps = 24/928 (2%)

Query: 6   DVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRS 65
              +G +   P   Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S
Sbjct: 21  GQTQGAQSLAPQANY------ADYKVIRRNGTVVSFEPSKIAIAVTKAFLAVNGGQGAAS 74

Query: 66  IRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREER 125
            RV+++++ LT+  V  LL+   +    HIEDIQDQVE +LM+ G H + R YVLYRE+R
Sbjct: 75  ARVRELVEQLTQNVVRSLLRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKR 134

Query: 126 SDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSE 184
           +  RA   H  +DA   P L +  D+G     +   L  I+E AC+ L D VS++ +++E
Sbjct: 135 NQARAHDDH--ADAASTPGLNVT-DNGITRPLDMAALRGIIESACANLGDAVSAEPIVAE 191

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       ++ T
Sbjct: 192 TVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREIL------EEEVT 245

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
             EM   Y EYF ++I+ GV+A LL + ++ FDL  L   L   RD  F YLGLQ LYDR
Sbjct: 246 QAEMGERYAEYFPQFIKRGVQAELLDDKLLQFDLKRLGAALDANRDLQFGYLGLQTLYDR 305

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YFLH +  RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFNSGTR
Sbjct: 306 YFLHHDNVRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTR 365

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
             QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV
Sbjct: 366 RSQLSSCYLTTVDDDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGV 425

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANW
Sbjct: 426 VPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANW 485

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+KI A  
Sbjct: 486 IPDLFMKRVMEGGDWTLFSPSTCPDLHDKFGAEFETAYTAYEDKVARGEIKLFKKIPAAQ 545

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS
Sbjct: 546 LWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGS 605

Query: 605 INLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLG 659
           +NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  HR +GLG
Sbjct: 606 VNLVAHLKEQADGTVALDHDKLKRTISVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLG 665

Query: 660 LMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQG 719
           +MGFQ  LH+L  PYASPEAVE AD SME + ++A  AS ELA+ERG YSS++GSLWD+G
Sbjct: 666 IMGFQDCLHVLRTPYASPEAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRG 725

Query: 720 VFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
           + P DS+ LLAE R   + ++ +  + W  L+ R+ T GMRNSNC+AIAPTATI+NI GV
Sbjct: 726 ILPQDSVALLAEARGGYVEVDSSESMDWPALRSRIATYGMRNSNCVAIAPTATISNIIGV 785

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           S  I+P+YQNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DG++  I+RIP
Sbjct: 786 SACIEPTYQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIP 845

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            DL+ I+ATAFE+DP+WL+ESASRRQKWIDQAQSLN+Y+   SGKKLD IY+ AWL GLK
Sbjct: 846 ADLRAIYATAFEVDPVWLVESASRRQKWIDQAQSLNIYMAGASGKKLDEIYKLAWLRGLK 905

Query: 899 TTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           TTYYLR+ +AT VEKST+    G LNAV
Sbjct: 906 TTYYLRTMAATHVEKSTV--AHGALNAV 931


>gi|207721466|ref|YP_002251906.1| ribonucleoside reductase 1 (large chain) protein [Ralstonia
           solanacearum MolK2]
 gi|206586626|emb|CAQ17212.1| ribonucleoside reductase 1 (large chain) protein [Ralstonia
           solanacearum MolK2]
          Length = 987

 Score =  973 bits (2514), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/988 (55%), Positives = 687/988 (69%), Gaps = 48/988 (4%)

Query: 5   KDVNKGDEDAFPSLAYPFPEK--IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
                    + P+              ++I+RNG V  F+PSKI+ A+ KAF+AV G   
Sbjct: 10  SGTANPTAFSQPTGGTAVASGDGYADYKIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQG 69

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S RV+++++ LT+  V  LL+   +    HIED+QDQVE +LM+SG H + R YVLYR
Sbjct: 70  AASARVRELVEGLTQNVVRALLRSRPNGGTFHIEDVQDQVELALMRSGEHDVARAYVLYR 129

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIV 181
           E RS  RA    ++   P    L +  D G     +   L  ++  AC+GL D V  + +
Sbjct: 130 ERRSQERAQAGETQQP-PAFIGLNVT-DGGITRPLDMVALRNLIVSACAGLGDAVDPEPI 187

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           L ET KN+Y+G+  S +  + I ++RTLIEK+P Y++ TAR LL  +RRE+L       +
Sbjct: 188 LKETVKNLYEGVPMSQVYDSAILAARTLIEKDPAYSQATARILLHTIRREILG------E 241

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           + T  EM   Y +YF ++I+ G+ A LL +++  FDL  L   L   RD  F YLGLQ L
Sbjct: 242 EVTQAEMAARYVDYFPQFIKRGINAGLLDDTLAQFDLAKLGAALDASRDLQFNYLGLQTL 301

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLHI+  RIEMPQAFFMRVAMGL+L E ++E RA+EFY LLSSF FM STPTLFNS
Sbjct: 302 YDRYFLHISDKRIEMPQAFFMRVAMGLSLNEIDREARAIEFYQLLSSFDFMSSTPTLFNS 361

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT   QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKS
Sbjct: 362 GTCRSQLSSCYLTTVSDDLDGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKS 421

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT
Sbjct: 422 QGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNT 481

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFMKRV +N  WTLFSP    DLHD  G+ FE AY  YE +  RGEI +F+K+ 
Sbjct: 482 ANWIPDLFMKRVMENGEWTLFSPSTCPDLHDKVGRAFEQAYLGYEEKVARGEITLFKKMP 541

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A+ LWRKML MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCN
Sbjct: 542 AMQLWRKMLGMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCN 601

Query: 602 LGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAI 656
           LGS+NL+AH           D+DKL  T+R A+R+LDNVIDIN + ++KA+ SN  HR +
Sbjct: 602 LGSVNLVAHLVQQADGSYALDHDKLKKTVRIAMRMLDNVIDINYYAVKKARDSNLRHRPV 661

Query: 657 GLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLW 716
           GLG+MGFQ ALH+L IPYA+  AV+ AD SME + ++A  AS ELA+ERG YS++KGSLW
Sbjct: 662 GLGVMGFQDALHVLRIPYANEAAVQFADTSMEAVCYYAYWASTELAEERGRYSTYKGSLW 721

Query: 717 DQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANI 775
           D+G+ P DS+ LLA+ R   L  + +S + WD L+ R++  GMRNSNC+AIAPTATI+NI
Sbjct: 722 DRGILPQDSLKLLAQERGGYLEADLSSTMDWDSLRGRIQQYGMRNSNCVAIAPTATISNI 781

Query: 776 CGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIE 835
            GVS  I+P+YQNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DGS+  I+
Sbjct: 782 IGVSACIEPTYQNLYVKSNLSGEFTVVNDYLVRDLKARGLWDEVMVADLKYFDGSLARID 841

Query: 836 RIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLM 895
           RIP DL+ ++ATAFE++P WL+E+ASRRQKWIDQAQSLN+Y+   SGK LD  Y+ AWL 
Sbjct: 842 RIPQDLRDLYATAFEVEPQWLVEAASRRQKWIDQAQSLNIYMAGASGKMLDDTYKLAWLR 901

Query: 896 GLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDP-----------------------N 932
           GLKTTYYLR+  AT VEKST+    G LNAV                             
Sbjct: 902 GLKTTYYLRTIGATHVEKSTVSR--GTLNAVSSGSDAGSVSAAGAAPVAPASALDAVAAT 959

Query: 933 SSTHSLGIPSSCTSDT------ECEVCQ 954
           +        + CT         ECE CQ
Sbjct: 960 APAMPEAEGAVCTMRPGDPGFEECEACQ 987


>gi|163854888|ref|YP_001629186.1| ribonucleotide-diphosphate reductase subunit alpha [Bordetella
           petrii DSM 12804]
 gi|163258616|emb|CAP40915.1| ribonucleoside-diphosphate reductase alpha chain [Bordetella
           petrii]
          Length = 974

 Score =  972 bits (2513), Expect = 0.0,   Method: Composition-based stats.
 Identities = 537/982 (54%), Positives = 693/982 (70%), Gaps = 39/982 (3%)

Query: 3   PSKDVNKGDEDAFPSLAYPFP-----EKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAV 57
            +   +     A P      P      +     VI+RNG V  F+PSKI+ A+ KAF+AV
Sbjct: 2   QTTIASVTRPSAVPPSQTDVPADANGGQWASYNVIRRNGSVVGFEPSKIAIAMTKAFLAV 61

Query: 58  EGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITRE 117
            G   + S RV+++++ L  Q V  L+++  +    HIEDIQDQVE +LM+SG H + R 
Sbjct: 62  NGGQGAASARVRELVETLASQAVNALVRNRPAGGTFHIEDIQDQVELALMRSGEHDVARA 121

Query: 118 YVLYREERSDVRAAQ----SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL 173
           YVLYRE+R+  RAA       +         L ++ D+G     +   L   +E A  GL
Sbjct: 122 YVLYREKRAQERAAAAEVLEKTAPAVAQESHLNVV-DNGVRRPLDLAALRATIEAAGEGL 180

Query: 174 QD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREV 232
            + + ++ +L ET KN+YDG+   ++  + I S+R L+EK+P Y++VTAR LL  +R+EV
Sbjct: 181 SEFIDTEAILKETVKNLYDGIPVDEVFKSAILSARALVEKDPAYSQVTARLLLHTIRKEV 240

Query: 233 LTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFA 292
           L       ++ +   M   Y EYF  +I+ G++  LL   + ++DL  +   L   RD  
Sbjct: 241 LG------EEVSQAGMATRYAEYFPTFIQRGIEGGLLDAKLAEYDLARVGAALDARRDLQ 294

Query: 293 FEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFM 352
           F YLGLQ LYDRYFLHI G+RIE+PQ FFMRVAMGLAL+E+++E RA+EFY +LSSF FM
Sbjct: 295 FGYLGLQTLYDRYFLHIRGTRIELPQVFFMRVAMGLALRESDREARAIEFYEILSSFDFM 354

Query: 353 CSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGA 412
            STPTLFNSGT H QLSSC+LTTV DDL GI+ A++ENA+LAKY+GGLGNDWTPVR L +
Sbjct: 355 SSTPTLFNSGTLHSQLSSCYLTTVSDDLEGIYDAIKENALLAKYAGGLGNDWTPVRALRS 414

Query: 413 HIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDD 472
           HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGD+
Sbjct: 415 HIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDE 474

Query: 473 RRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRG 532
           RRRTHDMNTANWIPDLFMKRV +N  WTLFSP +  DLHD YGK FE AY  YE +   G
Sbjct: 475 RRRTHDMNTANWIPDLFMKRVMENGEWTLFSPSDCPDLHDKYGKAFEQAYLGYEAKVASG 534

Query: 533 EIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNS 592
           E+K+F+K+ A++LWRKML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+
Sbjct: 535 ELKLFKKMPAISLWRKMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNT 594

Query: 593 SSEETAVCNLGSINLLAHFAN-----NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAK 647
           +  E AVCNLGS+NL+AH         + D+DKL  T+  A+R+LDNVIDIN + ++KAK
Sbjct: 595 NDSEIAVCNLGSVNLVAHMKPAAAGGFELDHDKLKRTVGIAMRMLDNVIDINYYAVKKAK 654

Query: 648 KSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGA 707
            SN  HR +G+G+MGFQ  L ++ +PYAS  AVE AD SME + +HA  AS ELAQERG 
Sbjct: 655 DSNERHRPVGMGIMGFQDCLQMMRVPYASQAAVEFADRSMEAVCYHAYWASSELAQERGR 714

Query: 708 YSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAI 766
           Y S++GSLW +G+ P D++ +L + R   + ++ +S L W+ L+ R+K  GMRNSNC+AI
Sbjct: 715 YPSYEGSLWSRGILPQDTLAMLRDERGGHVEVDESSTLDWNALRARIKEHGMRNSNCIAI 774

Query: 767 APTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKY 826
           APTATI+NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+  LWDE M++DLKY
Sbjct: 775 APTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKKLGLWDEVMVADLKY 834

Query: 827 HDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLD 886
            DGS+  I+R+P +L++++ATAFE++P WL+E ASRRQKWIDQAQSLN+Y+   SGKKLD
Sbjct: 835 FDGSLSRIDRVPSELRELYATAFEVEPRWLVECASRRQKWIDQAQSLNIYMAGASGKKLD 894

Query: 887 FIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSS--------THSL 938
             Y+ AW  GLKTTYYLR+  ATS EKST +G  G+LNAV      ++            
Sbjct: 895 DTYKLAWQRGLKTTYYLRTLGATSAEKSTGRG--GELNAVSAGQAATAVTAAAPNLPEPE 952

Query: 939 GIPSSCTSDT------ECEVCQ 954
            + + CT         ECE CQ
Sbjct: 953 VLGAVCTMRPGDPGFEECEACQ 974


>gi|221065169|ref|ZP_03541274.1| ribonucleoside-diphosphate reductase, alpha subunit [Comamonas
           testosteroni KF-1]
 gi|220710192|gb|EED65560.1| ribonucleoside-diphosphate reductase, alpha subunit [Comamonas
           testosteroni KF-1]
          Length = 969

 Score =  971 bits (2510), Expect = 0.0,   Method: Composition-based stats.
 Identities = 530/968 (54%), Positives = 684/968 (70%), Gaps = 32/968 (3%)

Query: 12  EDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDI 71
             A P+ A          Q+I+R+G V +F P KI+ A+ KAF+AV G   + S  V+D 
Sbjct: 9   PSAAPAGAANSSSPNDSYQIIRRSGDVVAFAPQKIAVALTKAFLAVRGAQGAASASVRDT 68

Query: 72  IKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA 131
           +  LT+  V  L++        HIED+QDQVE  LM++GH  + R YVLYRE R+  RA 
Sbjct: 69  VNELTDGVVRALVRSRPDGGTFHIEDVQDQVELGLMRAGHQDVARAYVLYRERRNQERAE 128

Query: 132 QSHSKSDAP---IAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYK 187
           Q      A      P L +  D+G  +  N +RLE ++  +C  L  D+ S  +++ET +
Sbjct: 129 QKKVAEVAAAAATKPVLHVT-DNGQRVPLNQERLEALIVASCGNLNADIQSAPIVAETLR 187

Query: 188 NMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHE 247
           N+YDG+  +++  A I ++RTLIEK+P+Y  VTAR LL  + REV+       +     E
Sbjct: 188 NLYDGVPLAEVYKASILAARTLIEKDPDYTYVTARLLLHTIVREVMG------RDVQPAE 241

Query: 248 MQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFL 307
           MQ  Y +YF  ++++GV   LL+  ++++DL  LA  LK ERD  F+YLGLQ LYDRYFL
Sbjct: 242 MQAAYADYFPGFVQKGVDNELLNPELLNYDLPRLAKALKAERDEQFDYLGLQTLYDRYFL 301

Query: 308 HINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQ 367
           H+  +RIE+PQ+FFMRVAMGLAL E ++  RA+EFY LLSSF FM STPTLFNSGT   Q
Sbjct: 302 HVRKTRIELPQSFFMRVAMGLALNEPDRNARAIEFYELLSSFDFMSSTPTLFNSGTLRSQ 361

Query: 368 LSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPF 427
           LSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LG+ I GTNG+SQGV+PF
Sbjct: 362 LSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGSRIKGTNGESQGVVPF 421

Query: 428 LKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPD 487
           LKV NDTAVAVNQGGKRKGAVC YLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPD
Sbjct: 422 LKVVNDTAVAVNQGGKRKGAVCTYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPD 481

Query: 488 LFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWR 547
           LFMKRV +   WTLFSP +  DLHDLYG+ FE AY  YE + D GE+K+F+++ AV LWR
Sbjct: 482 LFMKRVMEAGQWTLFSPADAPDLHDLYGEAFEKAYTAYEAKTDSGELKLFKRVPAVDLWR 541

Query: 548 KMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINL 607
           KML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  ETAVCNLGS+NL
Sbjct: 542 KMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTSDTETAVCNLGSVNL 601

Query: 608 LAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSAL 667
           + H  + + D+DKL  T+ TA+R+LDNVIDIN + ++KAK SN  HR +G+GLMGFQ AL
Sbjct: 602 VQHIKDGKIDHDKLRKTVNTAMRMLDNVIDINYYAVQKAKDSNLRHRPVGMGLMGFQDAL 661

Query: 668 HLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIG 727
           + +   YAS  AVE ADE+ME I ++A  AS EL++ERG YS+FKGSLWDQG+ P D++ 
Sbjct: 662 YEMRTAYASQGAVEFADEAMEAICYYAYWASTELSKERGTYSTFKGSLWDQGILPPDTLK 721

Query: 728 LLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSY 786
           LL + R   + ++R+++L WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+PS+
Sbjct: 722 LLEKARGGYVEVDRSAKLDWDALRAKIAKDGMRNSNCVAIAPTATISNIVGVDASIEPSF 781

Query: 787 QNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHA 846
            NL VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P ++K ++A
Sbjct: 782 GNLSVKSNLSGEFTVINQYLVRDLKRLGLWDDVMVMDLKHFDGSLRAIDRVPQEIKNLYA 841

Query: 847 TAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSR 906
           TAFE+ P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKL   Y  AWL GLKTTYYLR+ 
Sbjct: 842 TAFEVSPEWLVEAASRRQKWIDQAQSLNIYMAGASGKKLHDTYMLAWLRGLKTTYYLRTT 901

Query: 907 SATSVEKSTLKG--------------------VDGKLNAVPVTDPNSSTHSLGIPSSCTS 946
           SAT++EKST++                                   +   +  I      
Sbjct: 902 SATNIEKSTVQSRVLNAVSSGAPAASAAPAAKPAVSALEAAAAAARAQAPATDIKFCAID 961

Query: 947 DTECEVCQ 954
           D  CE CQ
Sbjct: 962 DPGCEACQ 969


>gi|299533978|ref|ZP_07047330.1| ribonucleotide-diphosphate reductase subunit alpha [Comamonas
           testosteroni S44]
 gi|298717887|gb|EFI58892.1| ribonucleotide-diphosphate reductase subunit alpha [Comamonas
           testosteroni S44]
          Length = 969

 Score =  971 bits (2510), Expect = 0.0,   Method: Composition-based stats.
 Identities = 531/968 (54%), Positives = 686/968 (70%), Gaps = 32/968 (3%)

Query: 12  EDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDI 71
             A P+ A          Q+I+R+G V +F P KI+ A+ KAF+AV G   + S  V+D 
Sbjct: 9   PSAAPAGAANSSSPNDSYQIIRRSGDVVAFAPQKIAVALTKAFLAVRGAQGAASASVRDT 68

Query: 72  IKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA 131
           +  LTE  V  L++        HIED+QDQVE  LM++GH  + R YVLYRE R+  RA 
Sbjct: 69  VNELTEGVVRALVRSRPDGGTFHIEDVQDQVELGLMRAGHQDVARAYVLYRERRNQERAE 128

Query: 132 QSHSKSDAPIA---PKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYK 187
           Q  +   A  A   P L +  D+G  +  + +RLE ++  +C  L  D+ S  +++ET +
Sbjct: 129 QKKAAEVAAAAAAKPVLHVT-DNGQRVPLDQERLEALIVASCRNLNADIQSAPIVAETLR 187

Query: 188 NMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHE 247
           N+YDG+  +++  A I ++RTLIEK+P+Y  VTAR LL  + REV+       +     E
Sbjct: 188 NLYDGVPLAEVYKASILAARTLIEKDPDYTYVTARLLLHTIVREVMG------RDVQPAE 241

Query: 248 MQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFL 307
           MQ  Y +YF  ++++GV   LL+  ++++DL  LA  LK ERD  F+YLGLQ LYDRYFL
Sbjct: 242 MQTAYADYFPGFVQKGVDNELLNPELLNYDLPRLAKALKAERDEQFDYLGLQTLYDRYFL 301

Query: 308 HINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQ 367
           H+  +RIE+PQ+FFMRVAMGLAL E ++  RA+EFY LLSSF FM STPTLFNSGT   Q
Sbjct: 302 HVRKTRIELPQSFFMRVAMGLALNEPDRNARAIEFYELLSSFDFMSSTPTLFNSGTLRSQ 361

Query: 368 LSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPF 427
           LSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LG+ I GTNG+SQGV+PF
Sbjct: 362 LSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGSRIKGTNGESQGVVPF 421

Query: 428 LKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPD 487
           LKV NDTAVAVNQGGKRKGAVC YLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPD
Sbjct: 422 LKVVNDTAVAVNQGGKRKGAVCTYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPD 481

Query: 488 LFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWR 547
           LFMKRV +   WTLFSP +  DLHDLYG+ FE AY  YE + D GE+K+F+++ AV LWR
Sbjct: 482 LFMKRVMEKGQWTLFSPADAPDLHDLYGEAFEKAYTAYEAKTDSGELKLFKRVPAVDLWR 541

Query: 548 KMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINL 607
           KML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  ETAVCNLGS+NL
Sbjct: 542 KMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTSDTETAVCNLGSVNL 601

Query: 608 LAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSAL 667
           + H  + + D+DKL  T+ TA+R+LDNVIDIN + ++KAK SN  HR +G+GLMGFQ AL
Sbjct: 602 VQHIKDGKIDHDKLRKTVNTAMRMLDNVIDINYYAVQKAKDSNLRHRPVGMGLMGFQDAL 661

Query: 668 HLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIG 727
           + +   YAS  AVE ADE+ME I ++A  AS EL++ERG YS+FKGSLWDQG+ P D++ 
Sbjct: 662 YEMRTAYASQGAVEFADEAMEAICYYAYWASTELSKERGTYSTFKGSLWDQGILPPDTLK 721

Query: 728 LLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSY 786
           LL + R   + ++R+++L WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+PS+
Sbjct: 722 LLEKARGGYVEVDRSAKLDWDALRAKIAQDGMRNSNCVAIAPTATISNIVGVDASIEPSF 781

Query: 787 QNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHA 846
            NL VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P ++K ++A
Sbjct: 782 GNLSVKSNLSGEFTVINQYLVRDLKRLGLWDDVMVMDLKHFDGSLRAIDRVPQEIKNLYA 841

Query: 847 TAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSR 906
           TAFE+ P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKL   Y  AWL GLKTTYYLR+ 
Sbjct: 842 TAFEVSPEWLVEAASRRQKWIDQAQSLNIYMAGASGKKLHDTYMLAWLRGLKTTYYLRTT 901

Query: 907 SATSVEKSTLKG--------------------VDGKLNAVPVTDPNSSTHSLGIPSSCTS 946
           SAT++EKST++                                   +   +  I      
Sbjct: 902 SATNIEKSTVQSRVLNAVSSGAPAASAAPAAKPAVSALEAAAAAARAQAPATDIKFCAID 961

Query: 947 DTECEVCQ 954
           D  CE CQ
Sbjct: 962 DPGCEACQ 969


>gi|264680214|ref|YP_003280124.1| ribonucleoside-diphosphate reductase, alpha [Comamonas testosteroni
           CNB-2]
 gi|262210730|gb|ACY34828.1| ribonucleoside-diphosphate reductase, alpha [Comamonas testosteroni
           CNB-2]
          Length = 969

 Score =  970 bits (2508), Expect = 0.0,   Method: Composition-based stats.
 Identities = 531/968 (54%), Positives = 686/968 (70%), Gaps = 32/968 (3%)

Query: 12  EDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDI 71
             A P+ A          Q+I+R+G V +F P KI+ A+ KAF+AV G   + S  V+D 
Sbjct: 9   PSAAPAGAANSSSPNDSYQIIRRSGDVVAFAPQKIAVALTKAFLAVRGAQGAASASVRDT 68

Query: 72  IKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA 131
           +  LTE  V  L++        HIED+QDQVE  LM++GH  + R YVLYRE R+  RA 
Sbjct: 69  VNELTEGVVRALVRSRPDGGTFHIEDVQDQVELGLMRAGHQDVARAYVLYRERRNQERAE 128

Query: 132 QSHSKSDAPIA---PKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYK 187
           Q  +   A  A   P L +  D+G  +  + +RLE ++  +C  L  D+ S  +++ET +
Sbjct: 129 QKKAAEVAAAAAAKPVLHVT-DNGQRVPLDQERLEALIVASCRNLNADIQSAPIVAETLR 187

Query: 188 NMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHE 247
           N+YDG+  +++  A I ++RTLIEK+P+Y  VTAR LL  + REV+       +     E
Sbjct: 188 NLYDGVPLAEVYKASILAARTLIEKDPDYTYVTARLLLHTIVREVMG------RDVQPAE 241

Query: 248 MQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFL 307
           MQ  Y +YF  ++++GV   LL+  ++++DL  LA  LK ERD  F+YLGLQ LYDRYFL
Sbjct: 242 MQAAYADYFPGFVQKGVDNELLNPELLNYDLPRLAKALKAERDEQFDYLGLQTLYDRYFL 301

Query: 308 HINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQ 367
           H+  +RIE+PQ+FFMRVAMGLAL E ++  RA+EFY LLSSF FM STPTLFNSGT   Q
Sbjct: 302 HVRKTRIELPQSFFMRVAMGLALNEPDRNARAIEFYELLSSFDFMSSTPTLFNSGTLRSQ 361

Query: 368 LSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPF 427
           LSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LG+ I GTNG+SQGV+PF
Sbjct: 362 LSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGSRIKGTNGESQGVVPF 421

Query: 428 LKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPD 487
           LKV NDTAVAVNQGGKRKGAVC YLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPD
Sbjct: 422 LKVVNDTAVAVNQGGKRKGAVCTYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPD 481

Query: 488 LFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWR 547
           LFMKRV +   WTLFSP +  DLHDLYG+ FE AY  YE + D GE+K+F+++ AV LWR
Sbjct: 482 LFMKRVMEAGQWTLFSPADAPDLHDLYGEAFEKAYTAYEAKTDSGELKLFKRVPAVDLWR 541

Query: 548 KMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINL 607
           KML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  ETAVCNLGS+NL
Sbjct: 542 KMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTSDTETAVCNLGSVNL 601

Query: 608 LAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSAL 667
           + H  + + D+DKL  T+ TA+R+LDNVIDIN + ++KAK SN  HR +G+GLMGFQ AL
Sbjct: 602 VQHIKDGKIDHDKLRKTVNTAMRMLDNVIDINYYAVQKAKDSNLRHRPVGMGLMGFQDAL 661

Query: 668 HLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIG 727
           + +   YAS  AVE ADE+ME I ++A  AS EL++ERG YS+FKGSLWDQG+ P D++ 
Sbjct: 662 YEMRTAYASQGAVEFADEAMEAICYYAYWASTELSKERGTYSTFKGSLWDQGILPPDTLK 721

Query: 728 LLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSY 786
           LL + R   + ++R+++L WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+PS+
Sbjct: 722 LLEKARGGYVEVDRSAKLDWDALRAKIAQDGMRNSNCVAIAPTATISNIVGVDASIEPSF 781

Query: 787 QNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHA 846
            NL VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P ++K ++A
Sbjct: 782 GNLSVKSNLSGEFTVINQYLVRDLKRLGLWDDVMVMDLKHFDGSLRAIDRVPQEIKNLYA 841

Query: 847 TAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSR 906
           TAFE+ P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKL   Y  AWL GLKTTYYLR+ 
Sbjct: 842 TAFEVSPEWLVEAASRRQKWIDQAQSLNIYMAGASGKKLHDTYMLAWLRGLKTTYYLRTT 901

Query: 907 SATSVEKSTLKG--------------------VDGKLNAVPVTDPNSSTHSLGIPSSCTS 946
           SAT++EKST++                                   +   +  I      
Sbjct: 902 SATNIEKSTVQSRVLNAVSSGAPAASAAPAAKPAVSALEAAAAAARAQAPATDIKFCAID 961

Query: 947 DTECEVCQ 954
           D  CE CQ
Sbjct: 962 DPGCEACQ 969


>gi|167837967|ref|ZP_02464826.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           thailandensis MSMB43]
          Length = 956

 Score =  970 bits (2508), Expect = 0.0,   Method: Composition-based stats.
 Identities = 546/936 (58%), Positives = 690/936 (73%), Gaps = 23/936 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P     +G         Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 17  RPLAGGAQGAPALALQTTY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 70

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM+ G H + R YVLY
Sbjct: 71  GAASARVRELVEQLTQTVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLY 130

Query: 122 REERSDVR-AAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSK 179
           RE+R   R  A   +  ++  A  + +  D+G   + +   L  ++  AC GL D V+ +
Sbjct: 131 REKRHLERVHAGEAAAVESSAAGGINVT-DNGVTRALDLNALRALIVSACEGLGDAVNPE 189

Query: 180 IVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKK 239
            +++ET KN+YDG+  + +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L      
Sbjct: 190 PIVAETVKNLYDGVPMTQVYDSSILAARTMIEKDPAYSQVTARVLLHTIRREILG----- 244

Query: 240 PQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQ 299
            ++ T  EM   Y EYF ++++ GV+A LL + ++ FDL  L + L   RD  F YLGLQ
Sbjct: 245 -EEVTQAEMATRYAEYFPQFLKRGVEAELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQ 303

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLF 359
            LYDRYFLH++G+RIEMPQAFFMRVAMGLAL E ++E RA+EFYN+LSSF FM STPTLF
Sbjct: 304 TLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREARAIEFYNVLSSFDFMSSTPTLF 363

Query: 360 NSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNG 419
           NSGTR  QLSSC+LTTV DDL GI+ AL++NA+L+K++GGLGNDWT VR LG+HI GTNG
Sbjct: 364 NSGTRRSQLSSCYLTTVADDLDGIYEALKDNALLSKFAGGLGNDWTRVRALGSHIKGTNG 423

Query: 420 KSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDM 479
           KSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDM
Sbjct: 424 KSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDM 483

Query: 480 NTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK 539
           NTANWIPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+K
Sbjct: 484 NTANWIPDLFMKRVMEGGDWTLFSPSTCPDLHDKFGAEFEAAYVGYEEKVARGEIKLFKK 543

Query: 540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAV 599
           I A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AV
Sbjct: 544 IPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDAEIAV 603

Query: 600 CNLGSINLLAH-----FANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
           CNLGS+NL+AH           D +KL  T+  A+R+LDNVIDIN + + KA+ SN  HR
Sbjct: 604 CNLGSVNLVAHLAKQADGTYALDEEKLKRTVSVAMRMLDNVIDINYYAVAKARNSNLKHR 663

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +GLG+MGFQ  LHLL  PYAS EAVE AD SME + ++A  AS ELA+ERG YSS++GS
Sbjct: 664 PVGLGIMGFQDCLHLLRTPYASGEAVEFADRSMEAVCYYAYWASTELAEERGRYSSYRGS 723

Query: 715 LWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIA 773
           LWD+G+ P D++ LL E R   + ++ ++ L W  L+ R+ + GMRNSNC+AIAPTATI+
Sbjct: 724 LWDRGILPQDTLKLLTEARGGYVEVDTSATLDWPALRARIDSFGMRNSNCVAIAPTATIS 783

Query: 774 NICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGN 833
           NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  
Sbjct: 784 NIIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSR 843

Query: 834 IERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAW 893
           I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AW
Sbjct: 844 IDRIPADLRAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDEVYKLAW 903

Query: 894 LMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVT 929
           L GLKTTYYLR+ +AT VEKST+    G LNAVP +
Sbjct: 904 LRGLKTTYYLRTMAATHVEKSTV--AHGALNAVPTS 937


>gi|54294661|ref|YP_127076.1| ribonucleotide-diphosphate reductase subunit alpha [Legionella
           pneumophila str. Lens]
 gi|53754493|emb|CAH15977.1| hypothetical protein lpl1738 [Legionella pneumophila str. Lens]
          Length = 942

 Score =  969 bits (2504), Expect = 0.0,   Method: Composition-based stats.
 Identities = 558/928 (60%), Positives = 692/928 (74%), Gaps = 14/928 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++ IKRNG V  +D +KI  AI KAF+A EG  A  S R+   I+ LT Q      +   
Sbjct: 27  LKTIKRNGKVVIYDDTKIKIAITKAFIADEGGTAPTSDRIHQQIEELTRQITQVFKRRLP 86

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM+SGH+K+ R YVLYREER   R ++S  K        L I 
Sbjct: 87  SGGAIHIEEIQDQVELALMRSGHYKVARSYVLYREERRKARESESKQKQTKDSKHLL-IT 145

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           M +G +   +  R+  IV+E+C  L +V ++ V+ +  +N+Y+     D+  ALI S+R 
Sbjct: 146 MPNGEVQPLDMDRVNTIVKESCRDLSNVKAEPVIKDALRNLYNQAKYEDVHKALIMSARA 205

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+EKEPNY  V+AR LL+ LR E LT +  K  +AT  EM  +YP YF  YIE+G+   +
Sbjct: 206 LVEKEPNYTYVSARLLLDSLRSEALTKLNIK-SEATFDEMAQIYPVYFKSYIEQGIAQGM 264

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   M DFDL  L+  L  ERD  F YL LQ LYDRYF+H  G R E+PQAFFMRVAMGL
Sbjct: 265 LDPKMTDFDLDKLSQALLPERDMKFTYLSLQTLYDRYFIHERGVRYELPQAFFMRVAMGL 324

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL+E  KE++A+EFY LLSSF +M STPTLFNSGT  PQLSSC+LTTVPD L GI+ A++
Sbjct: 325 ALREQHKEEKAIEFYQLLSSFDYMSSTPTLFNSGTVRPQLSSCYLTTVPDHLDGIYSAIK 384

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+KY+GGLGNDWTPVR +GAHI GTNGKSQGV+PFL VA+ TAVAVNQGGKRKGAV
Sbjct: 385 DNALLSKYAGGLGNDWTPVRAMGAHIKGTNGKSQGVVPFLNVADATAVAVNQGGKRKGAV 444

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE WH DVEEFL+LRKNTGDDRRRTHDMNTA W+PDLFMKRV ++  WTLFSPDEV 
Sbjct: 445 CAYLECWHRDVEEFLELRKNTGDDRRRTHDMNTALWVPDLFMKRVREDGNWTLFSPDEVP 504

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD YGK FE  Y  YE +A +G I+  + I AV LWR+ML+MLFETGHPW+TFKDPCN
Sbjct: 505 DLHDQYGKAFEALYVEYEEKARQGIIRNTKTIPAVKLWRRMLSMLFETGHPWLTFKDPCN 564

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GV+HSSNLCTEITLN+S EE AVCNLGSINL AH  N + D  KL  TI TA
Sbjct: 565 LRSPQQHAGVIHSSNLCTEITLNTSEEEIAVCNLGSINLPAHIKNGKLDEQKLKRTISTA 624

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVIDIN +++ +A+ SN  HR IGLG+MGFQ AL+ L + YAS EA+E AD SME
Sbjct: 625 IRMLDNVIDINYYSVPQARNSNLQHRPIGLGIMGFQDALYELKMDYASKEAIEFADSSME 684

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWD 747
            IS++AI AS +LA+ERG+YS+++GSLW +G+ PIDSI LL + R   L  +R+ +L W+
Sbjct: 685 LISYYAIEASCDLAKERGSYSTYEGSLWSKGILPIDSINLLQQSRNKYLEQDRSQKLDWE 744

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+ +V+T GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYVKSN+SG+FTVVN +LV
Sbjct: 745 PLRVKVRTQGMRNSNVMAIAPTATISNICGVSQSIEPTYQNLYVKSNLSGEFTVVNPYLV 804

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK  +LWDE M++DLKY +GS+  I RIP++LK  +AT+FEIDPMWL+E+ASRRQKWI
Sbjct: 805 ADLKTLNLWDEVMVNDLKYFNGSVQPISRIPEELKSRYATSFEIDPMWLVEAASRRQKWI 864

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLN+Y+ +PSGKKLD +Y  AW+ GLKTTYYLRS  A++ EKST+   DG LNAV 
Sbjct: 865 DQAQSLNIYMAQPSGKKLDQLYMHAWIRGLKTTYYLRSLGASNAEKSTV--TDGALNAVK 922

Query: 928 VTDPNSSTHSLGIPSSCTS-DTECEVCQ 954
           + D          P +C+  D +CE CQ
Sbjct: 923 LIDTE--------PKACSITDPDCEACQ 942


>gi|294339030|emb|CAZ87377.1| putative Ribonucleoside-diphosphate reductase (ribonucleoside
           diphosphate reductase, alpha subunit) (Ribonucleotide
           reductase large subunit) [Thiomonas sp. 3As]
          Length = 974

 Score =  968 bits (2503), Expect = 0.0,   Method: Composition-based stats.
 Identities = 548/955 (57%), Positives = 686/955 (71%), Gaps = 31/955 (3%)

Query: 22  FPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVT 81
                   ++I+RNG V  F+PSKI+ A+ KAF+AV+G   + S  +++ +  LTE  V 
Sbjct: 29  ALGDFSDYKIIRRNGAVVGFEPSKIAVAMTKAFLAVQGGQGAASASMRETVNALTENVVR 88

Query: 82  RLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPI 141
            LL+   S    HIEDIQDQVE SLM++G H++ R YVLYRE R+  RA Q  +      
Sbjct: 89  ALLRSRPSGGTFHIEDIQDQVELSLMRTGQHEVARAYVLYRERRTQERAKQKAAAEQQES 148

Query: 142 APKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLET 200
           AP L ++ D G     +   L  ++E AC  L  DV +  +++ET +N+YDG+   ++  
Sbjct: 149 APVLHVL-DGGLRKPLDQAALVSLIESACVNLSADVKAAPIVAETLRNLYDGVPMLEVYK 207

Query: 201 ALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYI 260
           A I +SRTLIE++P+Y+KVTAR LL  +RRE L       +     +M   Y EYF R I
Sbjct: 208 AAILASRTLIERDPDYSKVTARLLLHTMRRETLN------EDIPQEQMTQRYAEYFPRCI 261

Query: 261 EEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYF--------LHINGS 312
           +EGV+  LL E +  FDL  L   LK ERD  F+YLGLQ LYDRYF        ++ +G 
Sbjct: 262 KEGVELELLDERLGQFDLARLGAALKAERDLQFDYLGLQTLYDRYFLANRADTRVNKDGR 321

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           RIE+PQAFFMRVAMGL+L E ++E RA+EFY LLSSF FM STPTLFN+GTR  QLSSC+
Sbjct: 322 RIELPQAFFMRVAMGLSLNEIDREARAIEFYELLSSFDFMSSTPTLFNAGTRRSQLSSCY 381

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTV DDL GI+ A++ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV N
Sbjct: 382 LTTVADDLDGIYEAIKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVN 441

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKR
Sbjct: 442 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKR 501

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V +   WTLFSP +V DLHD +GK+FE AY  YE++A  GEIK+F+ + AV LWRKML+M
Sbjct: 502 VMEGGDWTLFSPADVPDLHDKFGKDFEQAYTRYEQKAALGEIKLFKTLPAVQLWRKMLSM 561

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH  
Sbjct: 562 LFETGHPWITFKDACNVRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLVAHLK 621

Query: 613 N-----NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSAL 667
           +        D  KL  TI+TA+R+LDNVIDIN + + KA+ +N  HR +GLG+MGFQ  L
Sbjct: 622 DAADGAKVIDQAKLKRTIQTAMRMLDNVIDINYYAVAKARNANMKHRPVGLGIMGFQDCL 681

Query: 668 HLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIG 727
           + L IPY S +AVE AD SME + + A  AS ELA+ERG YSS+ GSLWDQGV P+DS+ 
Sbjct: 682 YQLRIPYGSQQAVEFADRSMEAVCYEAYWASSELARERGRYSSYGGSLWDQGVLPMDSLK 741

Query: 728 LLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSY 786
           LLAE R   +  + +S L W+ L+ ++   GMRNSNC+AIAPTATI+NI GV   I+P++
Sbjct: 742 LLAEQRGGYVEADTSSTLDWNALRAQIAQHGMRNSNCVAIAPTATISNIVGVDACIEPTF 801

Query: 787 QNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHA 846
           QNLYVKSN+SG+FTV+N +LV +LK R LWD  M++DLKY DGS   I+RIP DLK +++
Sbjct: 802 QNLYVKSNLSGEFTVINQYLVRDLKARGLWDAVMVADLKYFDGSTQRIDRIPADLKALYS 861

Query: 847 TAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSR 906
           TAFE D  W+IE+A+RRQKWIDQAQSLN+Y+   SGK LD  Y+ AWL GLKTTYYLR+ 
Sbjct: 862 TAFETDTQWIIEAAARRQKWIDQAQSLNIYMANASGKLLDDTYKLAWLRGLKTTYYLRTI 921

Query: 907 SATSVEKSTLKGVDGKLNAVPVTDPNSSTHSL-------GIPSSCTSDTECEVCQ 954
            AT  EKST+K   G+LNAVP +   S++ S         I      + ECE CQ
Sbjct: 922 GATHAEKSTVKA--GQLNAVPQSPSESASASAQAVVQSGDIRYCAIDNPECEACQ 974


>gi|52842001|ref|YP_095800.1| ribonucleotide-diphosphate reductase subunit alpha [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|296107365|ref|YP_003619065.1| ribonucleoside-diphosphate reductase alpha chain [Legionella
           pneumophila 2300/99 Alcoy]
 gi|52629112|gb|AAU27853.1| ribonucleoside-diphosphate reductase, alpha subunit [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|295649266|gb|ADG25113.1| ribonucleoside-diphosphate reductase alpha chain [Legionella
           pneumophila 2300/99 Alcoy]
 gi|307610474|emb|CBX00046.1| hypothetical protein LPW_18011 [Legionella pneumophila 130b]
          Length = 942

 Score =  968 bits (2502), Expect = 0.0,   Method: Composition-based stats.
 Identities = 561/928 (60%), Positives = 694/928 (74%), Gaps = 14/928 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++ IKRNG V  +D +KI  AI KAF+A EG  A  S R+   I+ LT Q      +   
Sbjct: 27  LKTIKRNGKVVIYDDTKIKIAITKAFIADEGGTAPTSDRIHQQIEELTRQITQVFKRRLP 86

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM+SGH+K+ R YVLYREER   R ++S  K        L I 
Sbjct: 87  SGGAIHIEEIQDQVELALMRSGHYKVARSYVLYREERRKARESESKQKQTKDSKHLL-IT 145

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           M +G +   +  R+  IV+E+C  L +V ++ V+ +  +N+Y+     D+  ALI S+R 
Sbjct: 146 MPNGEVQPLDMDRVNTIVKESCRDLSNVKAEPVIKDALRNLYNQAKYEDVHKALIMSARA 205

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+EKEPNY  V+AR LL+ LR E LT +  K  +AT  EM  +YP YF  YIE+G+   +
Sbjct: 206 LVEKEPNYTYVSARLLLDSLRSEALTKLNIK-SEATFDEMAQIYPVYFKSYIEQGIAQGM 264

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   M DFDL  L+  L  ERD  F YL LQ LYDRYF+H  G R E+PQAFFMRVAMGL
Sbjct: 265 LDPKMADFDLDKLSQALLPERDMKFTYLSLQTLYDRYFIHERGVRYELPQAFFMRVAMGL 324

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL+E  KE++A+EFY LLSSF +M STPTLFNSGT  PQLSSC+LTTVPD L GI+ A++
Sbjct: 325 ALREQHKEEKAIEFYQLLSSFDYMSSTPTLFNSGTVRPQLSSCYLTTVPDHLDGIYSAIK 384

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+KY+GGLGNDWTPVR +GAHI GTNGKSQGV+PFL VA+ TAVAVNQGGKRKGAV
Sbjct: 385 DNALLSKYAGGLGNDWTPVRAMGAHIKGTNGKSQGVVPFLNVADATAVAVNQGGKRKGAV 444

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE WH DVEEFL+LRKNTGDDRRRTHDMNTA W+PDLFMKRV ++  WTLFSPDEV 
Sbjct: 445 CAYLECWHRDVEEFLELRKNTGDDRRRTHDMNTALWVPDLFMKRVREDGNWTLFSPDEVP 504

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD YGK FE  Y  YE +A +G I+  + ISAV LWR+ML+MLFETGHPW+TFKDPCN
Sbjct: 505 DLHDQYGKAFEALYVEYEEKARQGIIRNTKTISAVKLWRRMLSMLFETGHPWLTFKDPCN 564

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GV+HSSNLCTEITLN+S EE AVCNLGSINL AH  N + D  KL  TI TA
Sbjct: 565 LRSPQQHAGVIHSSNLCTEITLNTSEEEIAVCNLGSINLPAHIKNGKLDEQKLKRTISTA 624

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN +++ +A+ SN  HR IGLG+MGFQ AL+ L + YAS EA+E AD SME
Sbjct: 625 VRMLDNVIDINYYSVPQARNSNLQHRPIGLGIMGFQDALYELKMDYASKEAIEFADSSME 684

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWD 747
            IS++AI AS +LA+ERG+YS+++GSLW +G+ PIDSI LL + R   L  +R+ +L W+
Sbjct: 685 LISYYAIEASCDLAKERGSYSTYEGSLWSKGILPIDSINLLQQSRNKYLEQDRSQKLDWE 744

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+ +V+T GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYVKSN+SG+FTVVN +LV
Sbjct: 745 PLRVKVRTQGMRNSNVMAIAPTATISNICGVSQSIEPTYQNLYVKSNLSGEFTVVNPYLV 804

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK  +LWDE M++DLKY +GS+  I RIPD+LK+ +AT+FEIDPMWL+E+ASRRQKWI
Sbjct: 805 ADLKALNLWDEVMVNDLKYFNGSVQPISRIPDELKRRYATSFEIDPMWLVEAASRRQKWI 864

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLN+Y+ +PSGKKLD +Y  AW+ GLKTTYYLRS  A++ EKST+   DG LNAV 
Sbjct: 865 DQAQSLNIYMAQPSGKKLDQLYMHAWIRGLKTTYYLRSLGASNAEKSTV--TDGALNAVK 922

Query: 928 VTDPNSSTHSLGIPSSCTS-DTECEVCQ 954
           + D          P +C+  D +CE CQ
Sbjct: 923 LIDTE--------PKACSITDPDCEACQ 942


>gi|300784784|ref|YP_003765075.1| ribonucleoside-diphosphate reductase alpha chain [Amycolatopsis
           mediterranei U32]
 gi|299794298|gb|ADJ44673.1| ribonucleoside-diphosphate reductase alpha chain [Amycolatopsis
           mediterranei U32]
          Length = 972

 Score =  968 bits (2502), Expect = 0.0,   Method: Composition-based stats.
 Identities = 570/975 (58%), Positives = 707/975 (72%), Gaps = 37/975 (3%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
                      +    ++VI+R+G V+ FD  KIS A+ KAF+AVEG  A+ S RV  ++
Sbjct: 2   SVETGQRPSAADTPTAIRVIRRDGSVSPFDAGKISVALTKAFLAVEGGDAAASSRVHHVV 61

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LT+Q  T LL+H      +HIE IQD VE +LM+  HHK+ R YVLYR+ER+  R A 
Sbjct: 62  AELTQQVETTLLRHAGPETALHIEQIQDIVELALMRGEHHKVARAYVLYRDERAKAREAV 121

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
             + ++A     L +   DG L   +  R+  +V EA +GL+DV+++ VL+E  +N+YDG
Sbjct: 122 KPATTEA----TLNVKGTDGVLRPLDWARVSHVVGEAVAGLEDVTAEPVLAEAKRNLYDG 177

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           +S  +L  A I ++R L+E+EPNY+ V+AR LL+KLR E L+ +   P+ A+  EM   Y
Sbjct: 178 ISADELALAQIMAARVLVEQEPNYSYVSARLLLDKLRGEALSYLAGTPRLASQDEMAAEY 237

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
           P YF  Y+   ++  L+   +  FDL  +   ++ ERD  F +LGLQ LYDRYF H +G+
Sbjct: 238 PAYFRAYLRRAIELELVDAELQRFDLDKITAAIRPERDLDFGFLGLQTLYDRYFQHHDGT 297

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQAFFMRVAMGLA++E ++E RA+EFY LLSSFHFM STPTLFNSGT  PQLSSCF
Sbjct: 298 RFELPQAFFMRVAMGLAIREGDREARAIEFYELLSSFHFMASTPTLFNSGTTRPQLSSCF 357

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTV DDL  IF A + NA+LAKYSGGLGNDWTPVRGLGAHI GTNG+SQGV+PFLK+AN
Sbjct: 358 LTTVDDDLDSIFQAYKNNALLAKYSGGLGNDWTPVRGLGAHIKGTNGQSQGVVPFLKIAN 417

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGA CAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANW+PD F++R
Sbjct: 418 DTAVAVNQGGKRKGAACAYLETWHVDIEEFLDLRKNTGDDRRRTHDMNTANWVPDEFLRR 477

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V  +A WTLFSP+E  DLHDLYG EF   Y  YE  ADRGEIKVFR+  AV LWR+MLTM
Sbjct: 478 VEADAQWTLFSPNETPDLHDLYGNEFATRYREYEAAADRGEIKVFRRARAVDLWRRMLTM 537

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN++SEE AVCNLGS+NLL H  
Sbjct: 538 LFETGHPWITFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNSEEVAVCNLGSVNLLKHVT 597

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
               D  +L  T+RTAVR+LDNVIDIN +TI +A++SN  HR +GLG+MGFQ AL  + +
Sbjct: 598 PEGLDTKRLEKTVRTAVRMLDNVIDINFYTIPEARRSNLRHRPVGLGIMGFQDALFEIGV 657

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           P+AS EAV+ AD SME +S++AISAS +LA+ERG Y SF+GSLW +G+ PIDS+ LL + 
Sbjct: 658 PFASEEAVKFADVSMEHLSYYAISASTDLAEERGQYQSFEGSLWSKGILPIDSLQLLIDA 717

Query: 733 R--DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
           R  D L ++ +S L W  L++RVKT+GMRNSN MAIAPTATI+NI GV QSI+P +QNL+
Sbjct: 718 RQGDGLDVDTSSTLDWAPLRERVKTVGMRNSNVMAIAPTATISNISGVGQSIEPLFQNLF 777

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSNMSGDFTVVN  LV  LK R LWDE M+SDLKY DGS+G I+R+PDDLK ++ATAFE
Sbjct: 778 VKSNMSGDFTVVNPHLVRSLKARGLWDEVMVSDLKYFDGSLGQIDRVPDDLKALYATAFE 837

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           I+  W++++ S RQKWIDQAQSLNLY+  PSG+KLD +YR AW  GLKTTYYLR++SAT 
Sbjct: 838 IESKWIVDAGSVRQKWIDQAQSLNLYIAAPSGRKLDQLYRYAWHKGLKTTYYLRAQSATH 897

Query: 911 VEKSTLKGVDGKLNAVP-------------------------------VTDPNSSTHSLG 939
           VEKSTL+G DGKLNAV                                  +P+    +  
Sbjct: 898 VEKSTLRGTDGKLNAVSATPAPAAPAAAAPAPAPTPTPAPAPAPSPSPKPEPDVDFVATE 957

Query: 940 IPSSCTSDTECEVCQ 954
             +    D +CE CQ
Sbjct: 958 GAACRIDDPDCEACQ 972


>gi|187479452|ref|YP_787477.1| ribonucleotide-diphosphate reductase subunit alpha [Bordetella
           avium 197N]
 gi|115424039|emb|CAJ50592.1| ribonucleoside-diphosphate reductase alpha chain [Bordetella avium
           197N]
          Length = 970

 Score =  968 bits (2502), Expect = 0.0,   Method: Composition-based stats.
 Identities = 538/971 (55%), Positives = 699/971 (71%), Gaps = 29/971 (2%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           ++      E      +     +     +I+RNG V  F+P KI+ A+ KAF+AV G   +
Sbjct: 9   TRSTAVPPESNEGQASISHAGQWASYNLIRRNGSVVGFEPGKIAIAMTKAFLAVNGGQGA 68

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S RV++++  LTEQ V  L+++  S    HIED+QDQVE SLM+SG H + R YVLYRE
Sbjct: 69  ASARVRELVGQLTEQVVNALVRNRPSGGTFHIEDVQDQVELSLMRSGQHDVARAYVLYRE 128

Query: 124 ERSDVRAAQS--HSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKI 180
            R+  RAA +    K+  P  P L +  D+G     +  +L   +E A  GL + + ++ 
Sbjct: 129 RRAQERAAAAEVQDKAAVPAEPTLNV-NDNGVRRPLDMAQLRATIEAAGVGLTEFIDTET 187

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +L ET KN+YDG+   ++  + I ++R L+EK+P Y++VTAR LL  +R+EVL       
Sbjct: 188 ILKETVKNLYDGVPVDEVFKSAILAARALVEKDPAYSQVTARLLLHTIRKEVLG------ 241

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           ++ +   M   Y  YF  +I+ G++A LL   + +FDL  +A  L   RD  F YLGLQ 
Sbjct: 242 EEVSQASMAERYATYFPTFIQRGIEAGLLDAKLAEFDLERIARALNANRDLQFGYLGLQT 301

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLH+ G+RIE+PQ FFMRVAMGLAL+E+++E RA+EFY +LSSF FM STPTLFN
Sbjct: 302 LYDRYFLHVRGTRIELPQVFFMRVAMGLALRESDREARAIEFYEILSSFDFMSSTPTLFN 361

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGT H QLSSC+LTTV DDL GI+ A++ENA+LAKY+GGLGNDWTPVR L +HI GTNG+
Sbjct: 362 SGTLHSQLSSCYLTTVSDDLEGIYDAIKENALLAKYAGGLGNDWTPVRALRSHIKGTNGE 421

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGD+RRRTHDMN
Sbjct: 422 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDERRRTHDMN 481

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRV +N  WTLFSP +  DLHD YG+ FE AY  YE +A  GE+K+F+K+
Sbjct: 482 TANWIPDLFMKRVVENGDWTLFSPSDCPDLHDKYGRAFEQAYLGYEAKAASGELKLFKKM 541

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A++LWRKML+MLFETGHPWITFKDPCNIRSPQQH+GVVHSSNLCTEITLN++  E AVC
Sbjct: 542 PAISLWRKMLSMLFETGHPWITFKDPCNIRSPQQHIGVVHSSNLCTEITLNTNESEIAVC 601

Query: 601 NLGSINLLAHFAN-----NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRA 655
           NLGS+NL+AH         + D+DK+  T+  A+R+LDNVIDIN + +EKA+ SN  HR 
Sbjct: 602 NLGSVNLVAHMKPSANGGYELDHDKIKHTVGIAMRMLDNVIDINYYAVEKARNSNLRHRP 661

Query: 656 IGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSL 715
           +GLG+MGFQ  LH++ +PYAS  A+E AD SME + + A  AS  LA+ERG Y S++GSL
Sbjct: 662 VGLGIMGFQDCLHMMRVPYASQAAIEFADRSMEAVCYQAYWASSTLAEERGRYPSYEGSL 721

Query: 716 WDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
           W +G+ P DSI +L + R   + ++ +S L WD L+ R+K  GMRNSNC+AIAPTATI+N
Sbjct: 722 WSRGILPQDSIAMLRDERGGNVDVDESSSLDWDTLRARIKAHGMRNSNCVAIAPTATISN 781

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           I GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+  LWDE M++DLKY DGS+  I
Sbjct: 782 IIGVSACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKKLGLWDEVMVADLKYFDGSLSRI 841

Query: 835 ERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWL 894
           +R+P +L++++ATAFE++P WL+E A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW 
Sbjct: 842 DRVPTELRELYATAFEVEPSWLVECAARRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWQ 901

Query: 895 MGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSS-----THSLGIPSSCTSDT- 948
            GLKTTYYLR+  ATS EKST +G  G+LNAV   + ++S          + ++CT    
Sbjct: 902 RGLKTTYYLRTMGATSAEKSTGRG--GELNAVSAGNHSASAAPVLPEPEVVGAACTMRPG 959

Query: 949 -----ECEVCQ 954
                ECE CQ
Sbjct: 960 DPGFEECEACQ 970


>gi|54297687|ref|YP_124056.1| ribonucleotide-diphosphate reductase subunit alpha [Legionella
           pneumophila str. Paris]
 gi|53751472|emb|CAH12890.1| hypothetical protein lpp1738 [Legionella pneumophila str. Paris]
          Length = 942

 Score =  967 bits (2499), Expect = 0.0,   Method: Composition-based stats.
 Identities = 559/928 (60%), Positives = 694/928 (74%), Gaps = 14/928 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++ IKRNG V  +D +KI  AI KAF+A EG  A  S R+   I+ LT Q      +   
Sbjct: 27  LKTIKRNGKVVIYDDTKIKIAITKAFIADEGGTAPTSDRIHQQIEELTRQITQVFKRRLP 86

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM+SGH+K+ R YVLYREER   R ++S  K        L I 
Sbjct: 87  SGGAIHIEEIQDQVELALMRSGHYKVARSYVLYREERRKARESESKQKQTKDSKHLL-IT 145

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           M +G +   +  R+  IV+E+C  L +V ++ V+ +  +N+Y+     D+  ALI S+R 
Sbjct: 146 MPNGEVQPLDMDRVNTIVKESCRDLSNVKAEPVIKDALRNLYNQAKYEDVHKALIMSARA 205

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+EKEPNY  V+AR LL+ LR E LT +  K  +AT  EM  +YP YF  YIE+G+   +
Sbjct: 206 LVEKEPNYTYVSARLLLDSLRSEALTKLNIK-SEATFDEMAQIYPVYFKSYIEQGIAQGM 264

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   M DFDL  L+  L  ERD  F YL LQ LYDRYF+H  G R E+PQAFFMRVAMGL
Sbjct: 265 LDPKMADFDLDKLSQALLPERDMKFTYLSLQTLYDRYFIHERGVRYELPQAFFMRVAMGL 324

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL+E  KE++A+EFY LLSSF +M STPTLFNSGT  PQLSSC+LTTVPD L GI+ A++
Sbjct: 325 ALREQHKEEKAIEFYQLLSSFDYMSSTPTLFNSGTVRPQLSSCYLTTVPDHLDGIYSAIK 384

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+KY+GGLGNDWTPVR +GAHI GTNGKSQGV+PFL VA+ TAVAVNQGGKRKGAV
Sbjct: 385 DNALLSKYAGGLGNDWTPVRAMGAHIKGTNGKSQGVVPFLNVADATAVAVNQGGKRKGAV 444

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE WH DVEEFL+LRKNTGDDRRRTHDMNTA W+PDLFMKRV ++  WTLFSPDEV 
Sbjct: 445 CAYLECWHRDVEEFLELRKNTGDDRRRTHDMNTALWVPDLFMKRVREDGNWTLFSPDEVP 504

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD YGK FE  Y  YE +A +G I+  + ISAV LWR+ML+MLFETGHPW+TFKDPCN
Sbjct: 505 DLHDQYGKAFEALYVEYEEKARQGIIRNTKTISAVKLWRRMLSMLFETGHPWLTFKDPCN 564

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GV+HSSNLCTEITLN+S EE AVCNLGS+NL AH  N + D  KL  TI TA
Sbjct: 565 LRSPQQHAGVIHSSNLCTEITLNTSEEEIAVCNLGSVNLPAHIKNGKLDEQKLKRTISTA 624

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN +++ +A+ SN  HR IGLG+MGFQ AL+ L + YAS EA+E AD SME
Sbjct: 625 VRMLDNVIDINYYSVPQARNSNLQHRPIGLGIMGFQDALYELKMDYASKEAIEFADSSME 684

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWD 747
            IS++AI AS +LA+ERG+YS+++GSLW +G+ PIDSI LL + R   L  +R+ +L W+
Sbjct: 685 LISYYAIEASCDLAKERGSYSTYEGSLWSKGILPIDSINLLQQSRNKYLEQDRSQKLDWE 744

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+ +V+T GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYVKSN+SG+FTVVN +LV
Sbjct: 745 PLRVKVRTQGMRNSNVMAIAPTATISNICGVSQSIEPTYQNLYVKSNLSGEFTVVNPYLV 804

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK  +LWDE M++DLKY +GS+  I RIP++LK+ +AT+FEIDPMWL+E+ASRRQKWI
Sbjct: 805 ADLKTLNLWDEVMVNDLKYFNGSVQPISRIPEELKRRYATSFEIDPMWLVEAASRRQKWI 864

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLN+Y+ +PSGKKLD +Y  AW+ GLKTTYYLRS  A++ EKST+   DG LNAV 
Sbjct: 865 DQAQSLNIYMAQPSGKKLDQLYMHAWIRGLKTTYYLRSLGASNAEKSTV--TDGALNAVK 922

Query: 928 VTDPNSSTHSLGIPSSCTS-DTECEVCQ 954
           + D          P +C+  D +CE CQ
Sbjct: 923 LIDTE--------PKACSITDPDCEACQ 942


>gi|148359318|ref|YP_001250525.1| ribonucleoside-diphosphate reductase subunit alpha [Legionella
           pneumophila str. Corby]
 gi|148281091|gb|ABQ55179.1| ribonucleoside-diphosphate reductase, alpha subunit [Legionella
           pneumophila str. Corby]
          Length = 917

 Score =  967 bits (2498), Expect = 0.0,   Method: Composition-based stats.
 Identities = 561/928 (60%), Positives = 694/928 (74%), Gaps = 14/928 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++ IKRNG V  +D +KI  AI KAF+A EG  A  S R+   I+ LT Q      +   
Sbjct: 2   LKTIKRNGKVVIYDDTKIKIAITKAFIADEGGTAPTSDRIHQQIEELTRQITQVFKRRLP 61

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM+SGH+K+ R YVLYREER   R ++S  K        L I 
Sbjct: 62  SGGAIHIEEIQDQVELALMRSGHYKVARSYVLYREERRKARESESKQKQTKDSKHLL-IT 120

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           M +G +   +  R+  IV+E+C  L +V ++ V+ +  +N+Y+     D+  ALI S+R 
Sbjct: 121 MPNGEVQPLDMDRVNTIVKESCRDLSNVKAEPVIKDALRNLYNQAKYEDVHKALIMSARA 180

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+EKEPNY  V+AR LL+ LR E LT +  K  +AT  EM  +YP YF  YIE+G+   +
Sbjct: 181 LVEKEPNYTYVSARLLLDSLRSEALTKLNIK-SEATFDEMAQIYPVYFKSYIEQGIAQGM 239

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   M DFDL  L+  L  ERD  F YL LQ LYDRYF+H  G R E+PQAFFMRVAMGL
Sbjct: 240 LDPKMADFDLDKLSQALLPERDMKFTYLSLQTLYDRYFIHERGVRYELPQAFFMRVAMGL 299

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL+E  KE++A+EFY LLSSF +M STPTLFNSGT  PQLSSC+LTTVPD L GI+ A++
Sbjct: 300 ALREQHKEEKAIEFYQLLSSFDYMSSTPTLFNSGTVRPQLSSCYLTTVPDHLDGIYSAIK 359

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+KY+GGLGNDWTPVR +GAHI GTNGKSQGV+PFL VA+ TAVAVNQGGKRKGAV
Sbjct: 360 DNALLSKYAGGLGNDWTPVRAMGAHIKGTNGKSQGVVPFLNVADATAVAVNQGGKRKGAV 419

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE WH DVEEFL+LRKNTGDDRRRTHDMNTA W+PDLFMKRV ++  WTLFSPDEV 
Sbjct: 420 CAYLECWHRDVEEFLELRKNTGDDRRRTHDMNTALWVPDLFMKRVREDGNWTLFSPDEVP 479

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD YGK FE  Y  YE +A +G I+  + ISAV LWR+ML+MLFETGHPW+TFKDPCN
Sbjct: 480 DLHDQYGKAFEALYVEYEEKARQGIIRNTKTISAVKLWRRMLSMLFETGHPWLTFKDPCN 539

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GV+HSSNLCTEITLN+S EE AVCNLGSINL AH  N + D  KL  TI TA
Sbjct: 540 LRSPQQHAGVIHSSNLCTEITLNTSEEEIAVCNLGSINLPAHIKNGKLDEQKLKRTISTA 599

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN +++ +A+ SN  HR IGLG+MGFQ AL+ L + YAS EA+E AD SME
Sbjct: 600 VRMLDNVIDINYYSVPQARNSNLQHRPIGLGIMGFQDALYELKMDYASKEAIEFADSSME 659

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWD 747
            IS++AI AS +LA+ERG+YS+++GSLW +G+ PIDSI LL + R   L  +R+ +L W+
Sbjct: 660 LISYYAIEASCDLAKERGSYSTYEGSLWSKGILPIDSINLLQQSRNKYLEQDRSQKLDWE 719

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+ +V+T GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYVKSN+SG+FTVVN +LV
Sbjct: 720 PLRVKVRTQGMRNSNVMAIAPTATISNICGVSQSIEPTYQNLYVKSNLSGEFTVVNPYLV 779

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK  +LWDE M++DLKY +GS+  I RIPD+LK+ +AT+FEIDPMWL+E+ASRRQKWI
Sbjct: 780 ADLKALNLWDEVMVNDLKYFNGSVQPISRIPDELKRRYATSFEIDPMWLVEAASRRQKWI 839

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLN+Y+ +PSGKKLD +Y  AW+ GLKTTYYLRS  A++ EKST+   DG LNAV 
Sbjct: 840 DQAQSLNIYMAQPSGKKLDQLYMHAWIRGLKTTYYLRSLGASNAEKSTV--TDGALNAVK 897

Query: 928 VTDPNSSTHSLGIPSSCTS-DTECEVCQ 954
           + D          P +C+  D +CE CQ
Sbjct: 898 LIDTE--------PKACSITDPDCEACQ 917


>gi|253997286|ref|YP_003049350.1| ribonucleoside-diphosphate reductase subunit alpha [Methylotenera
           mobilis JLW8]
 gi|253983965|gb|ACT48823.1| ribonucleoside-diphosphate reductase, alpha subunit [Methylotenera
           mobilis JLW8]
          Length = 938

 Score =  964 bits (2492), Expect = 0.0,   Method: Composition-based stats.
 Identities = 561/947 (59%), Positives = 698/947 (73%), Gaps = 22/947 (2%)

Query: 15  FPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKN 74
             S        +  +QVI+RNG   +F+  KIS AI KAF+AVEG  ++ S RV+D + +
Sbjct: 7   SSSTDSVQATMLPMLQVIRRNGAAVTFNLDKISIAITKAFLAVEGNHSAASQRVRDQVTS 66

Query: 75  LTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSH 134
           L++     L++   +   +HIEDIQDQVE +LM++G+H + R YVLYRE+R+  RAA+  
Sbjct: 67  LSQIVNHALIRRLPTGGSIHIEDIQDQVELALMRNGNHDVARAYVLYREKRNAERAAEKA 126

Query: 135 SKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGL 193
           + S+   A  + I   DG L+  N K+L  +V EAC  L  +V   +V+ +  +++YDG+
Sbjct: 127 TTSEPSHALNVNI---DGKLVPLNIKQLNEMVAEACLNLGNEVDVNLVVEQAVRDLYDGI 183

Query: 194 SESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYP 253
             +++  ALI S+R+LIE EP Y  VTAR  L+ +R EVL       ++ +H EM   Y 
Sbjct: 184 PFTEVYKALILSARSLIETEPAYNYVTARLQLDLVRAEVLG------ERVSHAEMDAHYA 237

Query: 254 EYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSR 313
           EYF RYI+ G+ A LL   +  FDL  LAN L  ERDF F YLG+Q LYDRYFLHI   R
Sbjct: 238 EYFPRYIKIGIDADLLDPRLAQFDLDKLANALVKERDFQFGYLGIQTLYDRYFLHIEERR 297

Query: 314 IEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFL 373
           IE+PQ FFMRVAMGLA+ E ++E RA+EFYN+LS+F FM STPTLFN+GT H QLSSC+L
Sbjct: 298 IELPQIFFMRVAMGLAINEIDREARAIEFYNVLSTFDFMSSTPTLFNAGTLHSQLSSCYL 357

Query: 374 TTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAND 433
           TTV DDL GI+  ++ENA+L KY+GGLGNDWTPVR LGA I GTNGKSQGVIPFLKV ND
Sbjct: 358 TTVSDDLDGIYQGIKENALLQKYAGGLGNDWTPVRSLGARIKGTNGKSQGVIPFLKVVND 417

Query: 434 TAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV 493
           TAVAVNQGGKRKGAVC YLETWH+D+EEFLDLRKNTGDDRRRTHDMNTA+WIPDLFM+RV
Sbjct: 418 TAVAVNQGGKRKGAVCGYLETWHLDIEEFLDLRKNTGDDRRRTHDMNTAHWIPDLFMRRV 477

Query: 494 TQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTML 553
           T+   WTLFSP +V DLHD YGK FE AY  YER+AD GEIK+F+++ A+ +WRKML+ML
Sbjct: 478 TEQGEWTLFSPSDVPDLHDKYGKAFEKAYVEYERRADTGEIKLFKRVPAIQMWRKMLSML 537

Query: 554 FETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFAN 613
           FETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NLL H   
Sbjct: 538 FETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLLQHLKE 597

Query: 614 NQF----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHL 669
                  D DKL +TI+  +R+LDNV+DIN + + KA+ SN  HR +G+G+MGFQ+ LH 
Sbjct: 598 VNGNLELDNDKLQATIKVGMRMLDNVVDINFYPVGKARNSNTRHRPVGMGIMGFQNCLHA 657

Query: 670 LHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLL 729
           + IPYAS +AVE AD +ME + ++A  AS  LA+ERG YSSFKGSLWDQG+ P+D++ LL
Sbjct: 658 MRIPYASMDAVEFADRAMEMVCYNAYWASTVLAEERGPYSSFKGSLWDQGILPLDTLNLL 717

Query: 730 AEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQN 788
              R   + ++R+  L WD L+ R++ +GMRNSNC+AIAPTATI+NI GVS SI+P YQN
Sbjct: 718 EAERGGNVEVDRSKTLDWDALRNRIQKVGMRNSNCVAIAPTATISNIVGVSASIEPEYQN 777

Query: 789 LYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATA 848
           LYVKSN+SG+FT+VN  LVN+LK R LWD  M+SDLKY DGS+  IER+P DLK+++ATA
Sbjct: 778 LYVKSNLSGEFTIVNEQLVNDLKARGLWDTVMVSDLKYFDGSLAPIERVPADLKQLYATA 837

Query: 849 FEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSA 908
           F++DP WLIE+A+RRQKWIDQAQSLNLY   PSGKKL+  Y  AW  GLKTTYYLRS  A
Sbjct: 838 FDVDPSWLIEAAARRQKWIDQAQSLNLYFAVPSGKKLNDTYLLAWQRGLKTTYYLRSLGA 897

Query: 909 TSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
           T+ EKST  G  G+LNAV       +T     P  C+ D  +CE CQ
Sbjct: 898 TAAEKST--GSGGELNAVSA----HTTAPEPAPKMCSIDNPDCESCQ 938


>gi|241764093|ref|ZP_04762130.1| ribonucleoside-diphosphate reductase, alpha subunit [Acidovorax
           delafieldii 2AN]
 gi|241366557|gb|EER61045.1| ribonucleoside-diphosphate reductase, alpha subunit [Acidovorax
           delafieldii 2AN]
          Length = 975

 Score =  964 bits (2492), Expect = 0.0,   Method: Composition-based stats.
 Identities = 540/984 (54%), Positives = 693/984 (70%), Gaps = 39/984 (3%)

Query: 1   MHPSKDVNKGDEDAFPSLAYPFPEK---IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAV 57
           M  + +       A  +LA   PE    +   Q+I+RNG V  F+P KI+ A+MKAF+AV
Sbjct: 1   MQAALNTPPSHTAASQALAPNAPEASHVLNHYQIIRRNGAVVPFEPQKIAVAMMKAFLAV 60

Query: 58  EGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITRE 117
            G   + S  V++++  LT      L++        HIED+QDQVE  LM+SGHH+I R 
Sbjct: 61  HGTQGAASASVREVVDTLTHNVTRALMRSRPGGGTFHIEDVQDQVELGLMRSGHHEIARA 120

Query: 118 YVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DV 176
           YVLY       +    H++   P AP+L ++ D G  +  +  RL+ ++E AC+GL  DV
Sbjct: 121 YVLY--RERRTQERTRHNEEQLPQAPQLHVL-DGGERVVLDQGRLQSLIESACTGLGADV 177

Query: 177 SSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTV 236
           S++ +++ET +N+YDG+   ++  A I ++RTLIEK+P+Y   TAR LL  + REVL   
Sbjct: 178 SAQPIVAETMRNLYDGVPMEEVYKASILAARTLIEKDPDYTYATARLLLHTIVREVLG-- 235

Query: 237 YKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYL 296
               ++    +M   Y +YF ++I++GV+  LL E ++ +DL  L   LK ERD  F+YL
Sbjct: 236 ----REVAPADMAQSYVDYFPQFIKKGVENDLLDERLLQYDLQRLGAALKAERDLQFDYL 291

Query: 297 GLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTP 356
           GLQ LYDRYFLH+  +RIE+PQAFFMRVAMGL+L E ++E RA+EFY +LSSF FM STP
Sbjct: 292 GLQTLYDRYFLHVKKNRIELPQAFFMRVAMGLSLNEIDREARAIEFYEILSSFDFMSSTP 351

Query: 357 TLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHG 416
           TLFNSGT   QLSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LG+HI G
Sbjct: 352 TLFNSGTLRSQLSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGSHIKG 411

Query: 417 TNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRT 476
           TNG+SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRT
Sbjct: 412 TNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRT 471

Query: 477 HDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKV 536
           HDMNTANWIPDLFM+RV +   WTLFSP  V DLHDL+G +FE AY  YE +A RGEIK 
Sbjct: 472 HDMNTANWIPDLFMRRVMEKGTWTLFSPSNVPDLHDLFGTDFEKAYVAYEEKAARGEIKP 531

Query: 537 FRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEE 596
            R + A  LWRK+LTMLFETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+S  E
Sbjct: 532 ARTVQATDLWRKILTMLFETGHPWITFKDACNVRSPQQHAGVVHSSNLCTEITLNTSDTE 591

Query: 597 TAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAI 656
           TAVCNLGS+NLL H  N Q D+DKL  TI  A+R+LDNVIDIN + ++KA+ SN  HR +
Sbjct: 592 TAVCNLGSVNLLQHLKNGQIDHDKLKKTITVAMRMLDNVIDINYYAVKKARDSNLRHRPV 651

Query: 657 GLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLW 716
           GLG+M FQ +L+ L IPYAS EAVE AD+SME I ++A  AS ELA+ERG YSS+KGSLW
Sbjct: 652 GLGVMAFQDSLYELRIPYASQEAVEFADQSMEAICYYAYWASTELARERGRYSSYKGSLW 711

Query: 717 DQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANI 775
           D+G+ P+D++ +LA+ R   + ++R++ L WD L+K++   GMRNSNC+AIAPTATI+NI
Sbjct: 712 DRGILPLDTLDMLAQARGGYVEVDRSATLDWDALRKKIAQDGMRNSNCVAIAPTATISNI 771

Query: 776 CGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIE 835
            GV  SI+PS+ NL VKSN+SG+FTV+N  LV +LK+  LWD+ MI DLK+  GS+  I+
Sbjct: 772 IGVDASIEPSFGNLSVKSNLSGEFTVINGGLVRDLKRLGLWDDVMIMDLKHFKGSLHPID 831

Query: 836 RIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLM 895
           R+P D+K +++TAFE++P WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ 
Sbjct: 832 RVPQDIKALYSTAFEVEPRWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWVR 891

Query: 896 GLKTTYYLRSRSATSVEKSTLKG------VDGKLNAVPVTDPNSSTHSL----------- 938
           GLKTTYYLR++SAT VE ST+          G  N         S               
Sbjct: 892 GLKTTYYLRTQSATHVEMSTVNTRQLNAVSSGHDNGGSHASAAQSAPPSTMEAAIAAAAL 951

Query: 939 --------GIPSSCTSDTECEVCQ 954
                    I      D  CE CQ
Sbjct: 952 QAAELPATDIKFCAIDDPTCEACQ 975


>gi|296135013|ref|YP_003642255.1| ribonucleoside-diphosphate reductase, alpha subunit [Thiomonas
           intermedia K12]
 gi|295795135|gb|ADG29925.1| ribonucleoside-diphosphate reductase, alpha subunit [Thiomonas
           intermedia K12]
          Length = 978

 Score =  963 bits (2489), Expect = 0.0,   Method: Composition-based stats.
 Identities = 548/959 (57%), Positives = 685/959 (71%), Gaps = 35/959 (3%)

Query: 22  FPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVT 81
                   ++I+RNG V  F+PSKI+ A+ KAF+AV+G   + S  +++ +  LTE  V 
Sbjct: 29  ALGDFSDYKIIRRNGAVVGFEPSKIAVAMTKAFLAVQGGQGAASASMRETVNALTENVVR 88

Query: 82  RLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPI 141
            LL+   S    HIEDIQDQVE SLM++G H++TR YVLYRE R+  RA Q  +      
Sbjct: 89  ALLRSRPSGGTFHIEDIQDQVELSLMRTGQHEVTRAYVLYRERRTQERAKQKAAAEQQES 148

Query: 142 APKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLET 200
           AP L ++ D G     +   L  ++E AC  L  DV +  +++ET +N+YDG+   ++  
Sbjct: 149 APVLHVL-DGGLRKPLDQAALVSLIESACVNLSADVKAAPIVAETLRNLYDGVPMLEVYK 207

Query: 201 ALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYI 260
           A I +SRTLIE++P+Y+KVTAR LL  +RRE L       +     +M   Y EYF R I
Sbjct: 208 ASILASRTLIERDPDYSKVTARLLLHTMRRETLN------EDIPQEQMTQRYAEYFPRCI 261

Query: 261 EEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYF--------LHINGS 312
           +EGV+  LL E +  FDL  L   LK ERD  F+YLGLQ LYDRYF        ++ +G 
Sbjct: 262 KEGVELELLDERLGQFDLARLGAALKAERDLQFDYLGLQTLYDRYFLANRADTRVNKDGR 321

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           RIE+PQAFFMRVAMGL+L E ++E RA+EFY LLSSF FM STPTLFN+GTR  QLSSC+
Sbjct: 322 RIELPQAFFMRVAMGLSLNEIDREARAIEFYELLSSFDFMSSTPTLFNAGTRRSQLSSCY 381

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTV DDL GI+ A++ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV N
Sbjct: 382 LTTVADDLDGIYEAIKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVN 441

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKR
Sbjct: 442 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKR 501

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V +   WTLFSP +V DLHD +GK+FE AY  YE++A  GEIK+F+ + AV LWRKML+M
Sbjct: 502 VMEGGEWTLFSPADVPDLHDKFGKDFEQAYTRYEQKAALGEIKLFKTLPAVQLWRKMLSM 561

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH  
Sbjct: 562 LFETGHPWITFKDACNVRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLVAHLK 621

Query: 613 N-----NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSAL 667
           +        D  KL  TI+TA+R+LDNVIDIN + + KA+ +N  HR +GLG+MGFQ  L
Sbjct: 622 DAADGAKVIDQAKLKRTIQTAMRMLDNVIDINYYAVAKARNANMKHRPVGLGIMGFQDCL 681

Query: 668 HLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIG 727
           + L IPY S +AVE AD SME + + A  AS ELA+ERG YSS+ GSLWDQG+ P+DS+ 
Sbjct: 682 YQLRIPYGSQQAVEFADRSMEAVCYEAYWASSELARERGRYSSYGGSLWDQGILPMDSLK 741

Query: 728 LLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSY 786
           LLAE R   +  + +S L W+ L+ ++   GMRNSNC+AIAPTATI+NI GV   I+P++
Sbjct: 742 LLAEQRGGYVEADTSSTLDWNALRAQIAQHGMRNSNCVAIAPTATISNIVGVDACIEPTF 801

Query: 787 QNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHA 846
           QNLYVKSN+SG+FTV+N +LV +LK R LWD  M++DLKY DGS   I+RIP DLK ++A
Sbjct: 802 QNLYVKSNLSGEFTVINQYLVRDLKARGLWDAVMVADLKYFDGSTQRIDRIPADLKALYA 861

Query: 847 TAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSR 906
           TAFE D  W+IE+A+RRQKWIDQAQSLN+Y+   SGK LD  Y+ AWL GLKTTYYLR+ 
Sbjct: 862 TAFETDTQWIIEAAARRQKWIDQAQSLNIYMANASGKLLDDTYKLAWLRGLKTTYYLRTI 921

Query: 907 SATSVEKSTLKGVDGKLNAVPVTD-----------PNSSTHSLGIPSSCTSDTECEVCQ 954
            AT  EKST+K   G+LNAVP +              +   S  I      + ECE CQ
Sbjct: 922 GATHAEKSTVKA--GQLNAVPQSPSESVSALASASAQAVVQSGDIRYCAIDNPECEACQ 978


>gi|121608467|ref|YP_996274.1| ribonucleotide-diphosphate reductase subunit alpha
           [Verminephrobacter eiseniae EF01-2]
 gi|121553107|gb|ABM57256.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Verminephrobacter eiseniae EF01-2]
          Length = 968

 Score =  962 bits (2487), Expect = 0.0,   Method: Composition-based stats.
 Identities = 535/974 (54%), Positives = 683/974 (70%), Gaps = 38/974 (3%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
           H      +    A P  A      ++  Q+++RNG V  F P KI+ A+MKAF+AV G  
Sbjct: 12  HTLPADVQAKPAAAPDHA------LEHYQIMRRNGAVVPFQPQKIALAMMKAFLAVHGTQ 65

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S  V++++  LT+     L++        HIED+QDQVE  LM+ GHH+I R YVLY
Sbjct: 66  GAASASVREVVDGLTQTVTRALMRSRPGGGTFHIEDVQDQVELGLMRGGHHEIARSYVLY 125

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKI 180
           RE R+  R+ Q       P A  L ++   G  ++ +  RL+ ++E AC GL  DV +  
Sbjct: 126 RERRTQERSRQG--SPQQPAAALLHVLDA-GVRVALDPARLQALIESACVGLGPDVKADP 182

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +++ET +N+YDG+   ++  A I ++RTLIEK+P+Y+  TAR LL  + REVL +     
Sbjct: 183 IVAETMRNLYDGVPMDEVCKAAILAARTLIEKDPDYSYATARLLLHTIVREVLGSDVP-- 240

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
                 +M   Y +YF R+I++GV   LL E ++ +DL  L   ++ ERD  F+YLGLQ 
Sbjct: 241 ----QAQMALAYGDYFPRFIKKGVDNGLLDERLLQYDLQRLGAAIRAERDLKFDYLGLQT 296

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLH+  +RIE+PQ FFMRVAMGLAL E E+E RA+EFY +LSSF FM STPTLFN
Sbjct: 297 LYDRYFLHVRKTRIELPQVFFMRVAMGLALNEVEREARAIEFYEVLSSFDFMSSTPTLFN 356

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGT   QLSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LG++I GTNG+
Sbjct: 357 SGTLRSQLSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGSYIAGTNGE 416

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 417 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRTHDMN 476

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFM RV +   WTLFSP  V DLH+L+G +FE AY  YE QA RG I   R +
Sbjct: 477 TANWIPDLFMHRVMEKGHWTLFSPSSVPDLHELFGADFEKAYVAYEEQAARGAIGPARTV 536

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKMLTMLFETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+S  ETAVC
Sbjct: 537 QATDLWRKMLTMLFETGHPWITFKDACNLRSPQQHAGVVHSSNLCTEITLNTSDSETAVC 596

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGS+NLL H  + Q D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  HR +GLG+
Sbjct: 597 NLGSVNLLQHLKDGQIDHDKLRQTITVAMRMLDNVIDINYYAVRKARDSNLRHRPVGLGV 656

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           M FQ  L+ L IPYAS  AVE AD+SME I ++A  AS ELA+ERG Y S++GSLW++G 
Sbjct: 657 MAFQDCLYELRIPYASQAAVEFADQSMEAICYYAYWASTELAKERGKYLSYEGSLWERGQ 716

Query: 721 FPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
            P+D++ LLA+ R   L ++R+SRL WD L++++   GMRNSNC+AIAPTATI+NI GV 
Sbjct: 717 LPLDTLDLLAQARGDYLQVDRSSRLDWDALRQKIAQDGMRNSNCVAIAPTATISNIVGVD 776

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
            SI+PS+ NL VKSN+SG+FTV+N+ LV +LK+  LWDE MI DLK+  GS+  I+R+P 
Sbjct: 777 ASIEPSFGNLSVKSNLSGEFTVINAGLVRDLKRLGLWDEVMIMDLKHFKGSLHPIDRVPQ 836

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
           D+K +++TAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SG+KLD  Y+ AW+ GLKT
Sbjct: 837 DIKALYSTAFEVDPQWLVEAASRRQKWIDQAQSLNIYMAGASGRKLDETYKLAWVRGLKT 896

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVPV-------------------TDPNSSTHSLGI 940
           TYYLR++SAT VE ST+    G+LNAV                             +  I
Sbjct: 897 TYYLRTQSATHVEMSTVN--TGQLNAVSSGPHGDAFGAAATSTPMSTAAAQAGDRPATDI 954

Query: 941 PSSCTSDTECEVCQ 954
                 +  CE CQ
Sbjct: 955 AFCALDNPTCEACQ 968


>gi|33598410|ref|NP_886053.1| ribonucleotide-diphosphate reductase subunit alpha [Bordetella
           parapertussis 12822]
 gi|33603350|ref|NP_890910.1| ribonucleotide-diphosphate reductase subunit alpha [Bordetella
           bronchiseptica RB50]
 gi|33574539|emb|CAE39186.1| ribonucleoside-diphosphate reductase alpha chain [Bordetella
           parapertussis]
 gi|33577474|emb|CAE34739.1| ribonucleoside-diphosphate reductase alpha chain [Bordetella
           bronchiseptica RB50]
          Length = 975

 Score =  962 bits (2485), Expect = 0.0,   Method: Composition-based stats.
 Identities = 544/979 (55%), Positives = 700/979 (71%), Gaps = 39/979 (3%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P+       E +      P   +     +I+RNG V  F+PSKI+ A+ KAF+AV G  
Sbjct: 10  RPTAVPPAQSETS----TDPNSGQWASYNIIRRNGSVVGFEPSKIAIAMTKAFLAVNGGQ 65

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT Q V+ L+++  +    HIED+QDQVE +LM+SG H + R YVLY
Sbjct: 66  GAASARVRELVEQLTAQAVSALVRNRPAGGTFHIEDVQDQVELALMRSGEHDVARAYVLY 125

Query: 122 REERSDVRAAQ----SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDV 176
           RE R+  RAA       S   A   P L ++ D+G     +   L   +E A  GL Q  
Sbjct: 126 RERRAQERAAAAEVLEKSSPAAAQEPTLSVV-DNGVRRPLDLAALRATIEAAGEGLTQYT 184

Query: 177 SSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTV 236
            ++ +L ET KN+YDG+   ++  + I ++R L+EK+P Y++VTAR LL  +R+EVL   
Sbjct: 185 DTEAILKETVKNLYDGVPVDEVFKSAILAARALVEKDPAYSQVTARLLLHTIRKEVLG-- 242

Query: 237 YKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYL 296
               ++ +  +M   Y EYF  +I+ G++  LL   + ++DL  +A  L   RD  F YL
Sbjct: 243 ----EEVSQADMATRYAEYFPAFIQRGIEGGLLDAKLAEYDLERVAKALDGRRDLQFGYL 298

Query: 297 GLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTP 356
           GLQ LYDRYFLH+ G+RIE+PQ FFMRVAMGLAL+E ++E RA+EFY +LSSF FM STP
Sbjct: 299 GLQTLYDRYFLHVRGTRIELPQVFFMRVAMGLALREADREARAIEFYEILSSFDFMSSTP 358

Query: 357 TLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHG 416
           TLFNSGT H QLSSC+LTTV DDL GI+ A++ENA+LAKY+GGLGNDWTPVR L +HI G
Sbjct: 359 TLFNSGTLHSQLSSCYLTTVSDDLEGIYDAIKENALLAKYAGGLGNDWTPVRALRSHIKG 418

Query: 417 TNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRT 476
           TNG+SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGD+RRRT
Sbjct: 419 TNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDERRRT 478

Query: 477 HDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKV 536
           HDMNTANWIPDLFMKRV +N  WTLFSP +  DLHD YGK FE AY  YE +   GE+K+
Sbjct: 479 HDMNTANWIPDLFMKRVMENGEWTLFSPSDCPDLHDKYGKAFEQAYAGYEAKVASGELKL 538

Query: 537 FRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEE 596
           F+K+ AV+LWRKML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+++ E
Sbjct: 539 FKKMPAVSLWRKMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNATE 598

Query: 597 TAVCNLGSINLLAHFAN-----NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNH 651
            AVCNLGS+NL+AH         + D+DKL  TI  A+R+LDNVIDIN + ++KA+ SN 
Sbjct: 599 IAVCNLGSVNLVAHMKPSANGGYELDHDKLKRTIGVAMRMLDNVIDINYYAVDKARNSNE 658

Query: 652 THRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSF 711
            HR +G+G+MGFQ  LH++ +PYAS +A++ AD SME + +HA  AS ELAQERG Y S+
Sbjct: 659 RHRPVGMGIMGFQDCLHVMRVPYASQDAIDFADRSMEAVCYHAYWASSELAQERGRYQSY 718

Query: 712 KGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTA 770
           +GSLW +G+ P D++ +L E R   + ++ +S L WD L+ R+K  GMRNSNC+AIAPTA
Sbjct: 719 EGSLWSRGILPQDTLAMLREERGGNVDVDDSSSLDWDTLRSRIKEHGMRNSNCIAIAPTA 778

Query: 771 TIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGS 830
           TI+NI GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK+  LWDE M++DLKY DGS
Sbjct: 779 TISNIIGVSACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKKLGLWDEVMVADLKYFDGS 838

Query: 831 IGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYR 890
           +  I+R+P +L+K++ATAFE++P WL+E ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+
Sbjct: 839 LSRIDRVPSELRKLYATAFEVEPSWLVECASRRQKWIDQAQSLNIYMSGASGKKLDDTYK 898

Query: 891 QAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIP--------- 941
            AW  GLKTTYYLR+  ATS EKST +G  G+LNAV   D  + +     P         
Sbjct: 899 LAWQRGLKTTYYLRTLGATSAEKSTGRG--GELNAVSAGDHGAGSAVSAAPVLPEPEIVG 956

Query: 942 SSCTSDT------ECEVCQ 954
           + CT         ECE CQ
Sbjct: 957 AVCTMRPGDPGFEECEACQ 975


>gi|160896948|ref|YP_001562530.1| ribonucleotide-diphosphate reductase subunit alpha [Delftia
           acidovorans SPH-1]
 gi|160362532|gb|ABX34145.1| ribonucleoside-diphosphate reductase, alpha subunit [Delftia
           acidovorans SPH-1]
          Length = 973

 Score =  961 bits (2484), Expect = 0.0,   Method: Composition-based stats.
 Identities = 534/967 (55%), Positives = 688/967 (71%), Gaps = 32/967 (3%)

Query: 12  EDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDI 71
           + A PS A+    +  G Q+I+R+G V  F P KI+ A+ KAF+AV G   + S  V++ 
Sbjct: 15  DAANPSSAHHLSVQ-DGYQIIRRSGDVVPFTPQKIAVALTKAFLAVRGAQGAASASVRET 73

Query: 72  IKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA 131
           +  LT+  V  LL+        HIED+QDQVE  LM+ GHH + R YVLYR+ R+  RA 
Sbjct: 74  VDELTQAVVRALLRSRPGGGTFHIEDVQDQVELGLMRGGHHDVARAYVLYRDRRNQERAE 133

Query: 132 QSHSKSDAPIAP-----KLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSET 185
           Q  +   A  A       L +  D+G  +  +  RL  ++E +C  L  D+ +  +++ET
Sbjct: 134 QKKAAEAAAAAAAAPAPVLHVT-DNGQRVPLDQARLLALIEASCRNLNADIQAAPIVAET 192

Query: 186 YKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATH 245
            +N+YDG+   ++  A I ++RTLIEK+P+Y  VTAR LL  + REV+       +    
Sbjct: 193 LRNLYDGVPIEEVFKASILAARTLIEKDPDYTYVTARLLLHTIVREVMG------RDVQP 246

Query: 246 HEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRY 305
            ++Q  Y EYF  +I +GV   LL+  ++++DL  LA  +K ERD  F+YLGLQ LYDRY
Sbjct: 247 ADIQAAYAEYFPGFIRKGVDNELLNPELLNYDLPRLAAAIKAERDEQFDYLGLQTLYDRY 306

Query: 306 FLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRH 365
           FLH+  +RIE+PQ+FFMRVAMGLAL+E ++  RA+EFY LLSSF FM STPTLFNSGT  
Sbjct: 307 FLHVRKTRIELPQSFFMRVAMGLALQEEDRNARAIEFYELLSSFDFMSSTPTLFNSGTLR 366

Query: 366 PQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVI 425
            QLSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT VR LG+ I GTNG+SQGV+
Sbjct: 367 SQLSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWTRVRALGSRIKGTNGESQGVV 426

Query: 426 PFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWI 485
           PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWI
Sbjct: 427 PFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWI 486

Query: 486 PDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVAL 545
           PDLFMKRV +   WTLFSP +V DLHDL+G  FE AY  YE +AD GE+K+F++I A+ L
Sbjct: 487 PDLFMKRVMEKGHWTLFSPSDVGDLHDLFGAAFEHAYTAYETKADNGELKLFKRIPAMDL 546

Query: 546 WRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSI 605
           WRKML+MLFETGHPW+TFKDPCN+RSPQQH GVVHSSNLCTEITLN+S  ETAVCNLGS+
Sbjct: 547 WRKMLSMLFETGHPWVTFKDPCNVRSPQQHAGVVHSSNLCTEITLNTSDTETAVCNLGSV 606

Query: 606 NLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQS 665
           NL  H  +   D+ KL  TI TA+R+LDNVIDIN + ++KAK SN  HR +GLGLMGFQ 
Sbjct: 607 NLARHIVDGAIDHGKLRKTITTAMRMLDNVIDINYYAVQKAKDSNLRHRPVGLGLMGFQD 666

Query: 666 ALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDS 725
           AL+ + I YAS  AVE AD+SME I ++A  AS ELA+ERG YSS+KGSLWDQG+ P+D+
Sbjct: 667 ALYEMRIAYASDAAVEFADQSMEAICYYAYWASTELAKERGQYSSYKGSLWDQGILPLDT 726

Query: 726 IGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDP 784
           + LL + R   + ++R+SRL WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+P
Sbjct: 727 LNLLEKARGGYVEVDRSSRLDWDALRAKIGQHGMRNSNCVAIAPTATISNIVGVDASIEP 786

Query: 785 SYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKI 844
           S+ NL VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P D+K +
Sbjct: 787 SFGNLSVKSNLSGEFTVINQYLVRDLKRLGLWDDVMVMDLKHFDGSLRPIDRVPQDVKSL 846

Query: 845 HATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLR 904
           +ATAFE++P WL+E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR
Sbjct: 847 YATAFEVEPTWLVEAAARRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLR 906

Query: 905 SRSATSVEKSTLKG-----------------VDGKLNAVPVTDPNSSTHSLGIPSSCTSD 947
           + SAT++EKST++                                +   +  I      D
Sbjct: 907 TTSATNIEKSTVQSRVLNAVPSAAAAQPAAVNTSSALEAAAAAARAQAPATDIKFCAIDD 966

Query: 948 TECEVCQ 954
             CE CQ
Sbjct: 967 PGCEACQ 973


>gi|119713587|gb|ABL97638.1| ribonucleotide-diphosphate reductase alpha subunit [uncultured
           marine bacterium EB0_39H12]
          Length = 955

 Score =  961 bits (2483), Expect = 0.0,   Method: Composition-based stats.
 Identities = 542/954 (56%), Positives = 707/954 (74%), Gaps = 7/954 (0%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
            K+ NK                   ++VIKRNG V S+D  KI+ AI KAF+AVEG  A+
Sbjct: 6   QKEENKQKTTQIEQEQPKPAIAPGQMRVIKRNGSVVSYDAEKIAIAITKAFLAVEGGAAA 65

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S R+ + +  L     T   +   S   +HIE+IQDQVE  LM+SG  K+ R YVLYRE
Sbjct: 66  ASTRIHNEVNQLANSVTTTFTRRMPSGGTLHIEEIQDQVELELMRSGEQKVARTYVLYRE 125

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLS 183
           ER  +R      +        +++ +++G   + + K LE++V EAC GL+  +++ ++ 
Sbjct: 126 ERKQLR---QKEEPQKEEKEGIRVTLENGDEDTQDIKHLEIMVTEACEGLEGTNAQQIID 182

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
           E  KN+YDG++E D  T+L+ +SRTL+E+EPNY  VTAR LL+ +R E L T  +  ++A
Sbjct: 183 EANKNLYDGVTEEDARTSLVMTSRTLVEQEPNYTYVTARILLDNIRTEAL-TYLELQKQA 241

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
           T  EM+ LYP+    ++ +GV+  +L+  +++ D+  L   +   RD  F YLGLQ LYD
Sbjct: 242 TQQEMKVLYPQALRSFLAKGVENEILNPELLEMDIEKLGKAIDSSRDMDFTYLGLQTLYD 301

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYF+H    R E+PQ FFMRV+MGLAL+E ++E++A+EFYNLLSSF +M STPTLFNSGT
Sbjct: 302 RYFIHDTEIRYELPQVFFMRVSMGLALREEKREEKAIEFYNLLSSFDYMSSTPTLFNSGT 361

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
           +H QLSSC+LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVRGLG+ I GTNGKSQG
Sbjct: 362 KHSQLSSCYLTTVPDDLHGIYGAIQDNAMLSKWAGGLGNDWTPVRGLGSQIKGTNGKSQG 421

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVC+YLETWH+D+EEF++LRKNTGDDRRRTHDMNTAN
Sbjct: 422 VVPFLKVVNDTAVAVNQGGKRKGAVCSYLETWHVDIEEFVELRKNTGDDRRRTHDMNTAN 481

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAV 543
           W+PDLF+KRV+++  WTLF+P +  DLHDLYG EFE  YE YE Q   GEI+ F+++ A 
Sbjct: 482 WVPDLFLKRVSEDKKWTLFTPSDTPDLHDLYGLEFEKRYEEYETQTKTGEIEFFKEVEAK 541

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLG 603
            LW+KML+M+FETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+S +E AVCNLG
Sbjct: 542 DLWKKMLSMVFETGHPWITFKDVCNLRSPQQHTGVVHSSNLCTEITLNTSQDEIAVCNLG 601

Query: 604 SINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGF 663
           S+NL  H  + + D +KL  TI TA+R+LDNVIDIN + ++ A+ SN  HR IGLG+MGF
Sbjct: 602 SVNLTHHIKDGKMDEEKLEKTINTAIRMLDNVIDINFYAVKAAETSNMKHRPIGLGIMGF 661

Query: 664 QSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPI 723
             AL++L  PYAS EAV+ AD+SME +S++AI AS +LA+ERGAY S++GSLW QG+ PI
Sbjct: 662 HDALYMLETPYASQEAVDFADKSMEMVSYYAIKASSDLAKERGAYQSYEGSLWSQGILPI 721

Query: 724 DSIGLLAEVRD--ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
           DSI LL E R    L M+ +S + WD L++ V+  G+RNSN MAIAPTATIANI GVSQS
Sbjct: 722 DSIKLLKESRGEDYLEMDESSSMDWDGLREIVRNQGIRNSNVMAIAPTATIANITGVSQS 781

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P+YQNLYVKSN+SG+FTV N  +V  LK+  LWD  MI+DLKY+DGS+  I RIP+++
Sbjct: 782 IEPTYQNLYVKSNLSGEFTVTNIPMVENLKRLGLWDSVMINDLKYYDGSVKGISRIPEEV 841

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           K+++ATAF+I+P WLI++ASRRQKWIDQ+QSLNLY+DEP+GKKLD +YR AWL GLKTTY
Sbjct: 842 KELYATAFDIEPRWLIDAASRRQKWIDQSQSLNLYIDEPNGKKLDIMYRMAWLRGLKTTY 901

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTS-DTECEVCQ 954
           YLRSRSAT+ EKST+   +    +          ++   PS+C+  D +C+ CQ
Sbjct: 902 YLRSRSATTAEKSTISTGELNAVSATAQPEVQPQNNTTAPSACSILDPDCDACQ 955


>gi|325983071|ref|YP_004295473.1| ribonucleoside-diphosphate reductase, alpha subunit [Nitrosomonas
           sp. AL212]
 gi|325532590|gb|ADZ27311.1| ribonucleoside-diphosphate reductase, alpha subunit [Nitrosomonas
           sp. AL212]
          Length = 954

 Score =  961 bits (2483), Expect = 0.0,   Method: Composition-based stats.
 Identities = 543/946 (57%), Positives = 695/946 (73%), Gaps = 19/946 (2%)

Query: 15  FPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKN 74
            P+    F +     +VI+RNG V +F+P KIS A+ KAF+AV+G   + S+RV++++ N
Sbjct: 22  MPTQNSRFSQH----RVIRRNGAVVTFEPGKISVALTKAFIAVDGGQGAASVRVREVVVN 77

Query: 75  LTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSH 134
           LT+  V  LL+    +   HIEDIQDQVE +LM+SG H + R YVLYREER+  RA    
Sbjct: 78  LTQDVVNALLRRQPDSGTFHIEDIQDQVELALMRSGEHDVARAYVLYREERTRERARLKQ 137

Query: 135 SKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGL 193
             +    A  L +M D+G  +  +  +L  ++E +C+GL + V   ++L  T K++YDG+
Sbjct: 138 KSTAETAAEVLYVM-DNGQRVPLDVAKLSALIETSCAGLGNAVDPALILKATLKDLYDGV 196

Query: 194 SESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYP 253
              ++  +LI S+R LIEK+P Y+ VTAR LL+ +R EVL        + +   M+  Y 
Sbjct: 197 PIDEVRKSLILSARVLIEKDPAYSYVTARLLLDNVRYEVLGA------EVSQQAMKSHYQ 250

Query: 254 EYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSR 313
           EYF  +I+ G++A LL + +  FDL  L+  L  +RD  F+YLGLQ LYDRYFLHI   R
Sbjct: 251 EYFPAFIKRGIEADLLDQRLAQFDLARLSEALDADRDLQFDYLGLQTLYDRYFLHIKEQR 310

Query: 314 IEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFL 373
           IE+PQAFFMRVAMGLAL E ++E RA+EFY +LSSF FM STPTLFNSGT   QLSSC+L
Sbjct: 311 IELPQAFFMRVAMGLALNEIDREARAIEFYQVLSSFDFMSSTPTLFNSGTCRSQLSSCYL 370

Query: 374 TTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAND 433
           TTVPDDL GI+ +++ENA+LAKY+GGLGNDWT VR +GA I GTNGKSQGV+PFLKV +D
Sbjct: 371 TTVPDDLDGIYESIKENALLAKYAGGLGNDWTAVRAMGARIKGTNGKSQGVVPFLKVVSD 430

Query: 434 TAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV 493
           TAVAVNQGGKRKGAVCAYLE WH+D+EEFL+LRKNTGDDRRRTHDMNTA WIPDLFMKRV
Sbjct: 431 TAVAVNQGGKRKGAVCAYLECWHLDIEEFLELRKNTGDDRRRTHDMNTATWIPDLFMKRV 490

Query: 494 TQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTML 553
            +   WTLFSP +V DLH+ +G++FE AY  YE + +RGE+++++KI AV LWRKML+ML
Sbjct: 491 MEGGDWTLFSPSDVPDLHEKFGQQFEQAYLGYEARIERGELELYKKIPAVQLWRKMLSML 550

Query: 554 FETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFAN 613
           FETGHPWITFKDPCN+RSPQ H+GVVHSSNLCTEITLN++ +E AVCNLGS+NL+AH  +
Sbjct: 551 FETGHPWITFKDPCNVRSPQNHIGVVHSSNLCTEITLNTNDKEIAVCNLGSVNLVAHLKD 610

Query: 614 NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIP 673
              D DKL  TI   +R+LDNVIDIN + + KA+ +N  HR +GLG+MGFQ  LH L IP
Sbjct: 611 GALDLDKLKRTIHVVMRMLDNVIDINFYAVAKARNANLKHRPVGLGIMGFQDCLHQLGIP 670

Query: 674 YASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR 733
           Y SP AVE AD SME +++ A  AS ELAQERG YS++KGSLWD+G+ P D++ +L + R
Sbjct: 671 YGSPAAVEFADRSMEAVAYQAYWASTELAQERGCYSTYKGSLWDRGILPHDTLTVLQQER 730

Query: 734 -DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVK 792
              +  + ++ L WD L++R+K  GMRNSNC+AIAPTATI+NI GVS SI+P+YQNLYVK
Sbjct: 731 GGYVEADLSATLDWDALRQRIKLHGMRNSNCLAIAPTATISNIVGVSASIEPTYQNLYVK 790

Query: 793 SNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEID 852
           SN+SG+FT+ N  LVN+LK+ +LWDE MISDLKY DG+I  I+RIPD+++ ++ATAFE+D
Sbjct: 791 SNLSGEFTITNRSLVNDLKKLNLWDEVMISDLKYFDGAISKIDRIPDNIRTLYATAFEMD 850

Query: 853 PMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVE 912
           P+WLIE+ +RRQKWIDQ+QSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLRS  AT+ E
Sbjct: 851 PLWLIEAGARRQKWIDQSQSLNIYMGGVSGKKLDETYKLAWLRGLKTTYYLRSMGATAAE 910

Query: 913 KSTLKGVDGKLNAVPVTDPNSSTHSL----GIPSSCTSDTECEVCQ 954
           KST++   G LNAVP                I      D  CE CQ
Sbjct: 911 KSTVRA--GSLNAVPADGGIVKAAVEVSTVEIKYCAIDDESCESCQ 954


>gi|270156778|ref|ZP_06185435.1| ribonucleotide-diphosphate reductase alpha subunit [Legionella
           longbeachae D-4968]
 gi|289164773|ref|YP_003454911.1| ribonucleoside-diphosphate reductase, alpha subunit [Legionella
           longbeachae NSW150]
 gi|269988803|gb|EEZ95057.1| ribonucleotide-diphosphate reductase alpha subunit [Legionella
           longbeachae D-4968]
 gi|288857946|emb|CBJ11806.1| putative ribonucleoside-diphosphate reductase, alpha subunit
           [Legionella longbeachae NSW150]
          Length = 941

 Score =  961 bits (2483), Expect = 0.0,   Method: Composition-based stats.
 Identities = 562/939 (59%), Positives = 693/939 (73%), Gaps = 16/939 (1%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
            L    P     ++ IKRNG V ++D +KI  AI KAF+A EG  AS S R+   I+ LT
Sbjct: 18  ELTANAPGL---LKTIKRNGKVVNYDDTKIKIAITKAFIADEGGTASTSDRIHQQIEELT 74

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
            Q      +   S   VHIEDIQDQVE +LM+SGH+K+ R YVLYREE    R   +  K
Sbjct: 75  RQITQVFKRRLPSGGAVHIEDIQDQVELALMRSGHYKVARAYVLYREEHRKARE--NELK 132

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
             A     L I M DG L   +++R++ IV EAC  L+ V ++ V+ +  +N+Y+    +
Sbjct: 133 KQASDQKLLLITMPDGELKPLDTERMDTIVHEACRNLEHVDAEPVIKDALRNLYNEAKFA 192

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           D+  ALI ++RTL+EKEPNY  V+AR LL+ LR E L  +      AT  EM  LYP YF
Sbjct: 193 DVHKALIMAARTLVEKEPNYTYVSARLLLDCLRIEALHKL-GIEADATFDEMSQLYPAYF 251

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             Y+  G+K  +L E M DFDL  L   L  ERD  F YL LQ LYDRYF+H  G R E+
Sbjct: 252 KIYVAHGIKQGMLDEKMADFDLEKLGKALLPERDMKFTYLSLQTLYDRYFIHDQGIRYEL 311

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQAFFMRVAMGLA++E +K ++A+EFY LLSSF +M STPTLFNSGT  PQLSSC+LTTV
Sbjct: 312 PQAFFMRVAMGLAIREKDKNEKAIEFYQLLSSFDYMSSTPTLFNSGTIRPQLSSCYLTTV 371

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
           PD L GI+ A+++NA+L+KY+GGLGNDWTPVR +G+HI GTNGKSQGV+PFL VA+ TAV
Sbjct: 372 PDHLDGIYSAIKDNALLSKYAGGLGNDWTPVRAMGSHIKGTNGKSQGVVPFLNVADATAV 431

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLE WH DVEEFL+LRKNTGDDRRRTHDMNTA WIPDLFM RV ++
Sbjct: 432 AVNQGGKRKGAVCAYLECWHKDVEEFLELRKNTGDDRRRTHDMNTALWIPDLFMMRVRED 491

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
           A WTLFSPDEV +LHD +GK FE  Y  YE +A +G +K  + +SAV LWRKML+MLFET
Sbjct: 492 ADWTLFSPDEVPELHDQFGKAFEALYNKYEEKAHQGLMKNVKTVSAVKLWRKMLSMLFET 551

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPW+TFKDPCN+RSPQQH GVVHSSNLCTEITLN+S EE AVCNLGSINL AH  N + 
Sbjct: 552 GHPWMTFKDPCNLRSPQQHCGVVHSSNLCTEITLNTSEEEIAVCNLGSINLPAHIKNGKL 611

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D +KL  TI+TAVR+LDNVIDIN +++ +A+ SN  HR +GLGLMGFQ AL+ L I YAS
Sbjct: 612 DIEKLKQTIKTAVRMLDNVIDINYYSVPQARNSNLKHRPVGLGLMGFQDALYELKIDYAS 671

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DE 735
            EAVE AD SME IS++AI AS +LA+ERG+YSS++GSLW +G+ PIDSI LL + R   
Sbjct: 672 EEAVEFADSSMELISYYAIEASCDLAKERGSYSSYEGSLWSKGILPIDSINLLQQARNKY 731

Query: 736 LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNM 795
           L  +R+ RL W+ L+ +V+T GMRNSN MAIAPTATI+NICGV+QSI+P+YQNLYVKSN+
Sbjct: 732 LEQDRSQRLDWESLRIKVRTQGMRNSNVMAIAPTATISNICGVAQSIEPTYQNLYVKSNL 791

Query: 796 SGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMW 855
           SG+FTV+N +LV +LK  +LWDE M++DLKY +GS+  I RIP DLKK +AT+FEIDP+W
Sbjct: 792 SGEFTVINPYLVADLKALELWDEVMVNDLKYFNGSVQPISRIPADLKKRYATSFEIDPIW 851

Query: 856 LIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKST 915
           L+++ASRRQKWIDQAQSLN+Y+ EPSGKKLD +Y  AW+ GLKTTYYLRS  A++ EKST
Sbjct: 852 LVDAASRRQKWIDQAQSLNIYMAEPSGKKLDQLYMHAWIRGLKTTYYLRSMGASNAEKST 911

Query: 916 LKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           +   D  LNAV +        +    +    D +CE CQ
Sbjct: 912 V--TDSALNAVKI-------MTEAPKACSILDPDCEACQ 941


>gi|319764327|ref|YP_004128264.1| ribonucleoside-diphosphate reductase, alpha subunit [Alicycliphilus
           denitrificans BC]
 gi|330826375|ref|YP_004389678.1| ribonucleoside-diphosphate reductase subunit alpha [Alicycliphilus
           denitrificans K601]
 gi|317118888|gb|ADV01377.1| ribonucleoside-diphosphate reductase, alpha subunit [Alicycliphilus
           denitrificans BC]
 gi|329311747|gb|AEB86162.1| ribonucleoside-diphosphate reductase, alpha subunit [Alicycliphilus
           denitrificans K601]
          Length = 970

 Score =  960 bits (2480), Expect = 0.0,   Method: Composition-based stats.
 Identities = 536/973 (55%), Positives = 682/973 (70%), Gaps = 34/973 (3%)

Query: 4   SKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGAS 63
           +    +      P+            Q+I+RNG V  F+P KI+ A+MKAF+AV G   +
Sbjct: 10  TAPSTQPHAADAPATDASG-GVFSHYQIIRRNGAVVPFEPQKIAVAMMKAFLAVHGTQGA 68

Query: 64  RSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYRE 123
            S  V++++  LT+  V  L++   S    HIED+QDQVE  LM+  HH++ R YVLYRE
Sbjct: 69  ASASVREVVDELTQAVVRALMRSRPSGGTFHIEDVQDQVELGLMRGSHHEVARAYVLYRE 128

Query: 124 ERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVL 182
            R+  RA +       P  P L ++   G  I  +  RL+ ++E AC+ L  DV +  + 
Sbjct: 129 RRAQERAQKKEQL--LPQMPALYVLDK-GQRIELDILRLQALIESACANLGSDVQAAPIA 185

Query: 183 SETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQK 242
           +ET +N+YDG+   ++  A I ++RTLIEK+P Y   TAR LL  + REVL         
Sbjct: 186 AETLRNLYDGVPMDEVYKASILAARTLIEKDPGYTYATARLLLHTIVREVLGQ------D 239

Query: 243 ATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILY 302
                M   Y   F ++I +GV   LL   ++DFDL  L   LK  RD  F+YLGLQ LY
Sbjct: 240 VAPAGMAAAYAANFPQFIRKGVDNELLDPRLLDFDLQRLGQALKAGRDLQFDYLGLQTLY 299

Query: 303 DRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEK----RAVEFYNLLSSFHFMCSTPTL 358
           DRYFLH+  +RIE+PQAFFMRVAMGLAL+E + +     RA+EFY LLSSF FM STPTL
Sbjct: 300 DRYFLHVKKTRIELPQAFFMRVAMGLALREGDPKTTGSARAIEFYELLSSFDFMSSTPTL 359

Query: 359 FNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTN 418
           FNSGT   QLSSC+LTTVPD+L GI+ +++ENA+L+K++GGLGNDWT VR LGA I GTN
Sbjct: 360 FNSGTLRSQLSSCYLTTVPDELGGIYESIKENALLSKFAGGLGNDWTRVRALGARIKGTN 419

Query: 419 GKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHD 478
           G+SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+DVEEFL+LRKNTGDDRRRTHD
Sbjct: 420 GESQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDVEEFLELRKNTGDDRRRTHD 479

Query: 479 MNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFR 538
           MNTANWIPDLFMKRV     WTLFSP +V DLHDLYG+ FE AY  YE + D GE+++F+
Sbjct: 480 MNTANWIPDLFMKRVMDKGQWTLFSPSDVPDLHDLYGQAFERAYTAYEAKVDSGELQLFK 539

Query: 539 KISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA 598
           ++ AV LWRKML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  ETA
Sbjct: 540 RVPAVDLWRKMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTSDTETA 599

Query: 599 VCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGL 658
           VCNLGS+NL  H  +   D+DKL  T+ TA+R+LDNVIDIN + ++KA+ SN  HR +GL
Sbjct: 600 VCNLGSVNLARHLKDGAIDHDKLRKTVSTAMRMLDNVIDINYYAVDKARDSNLRHRPVGL 659

Query: 659 GLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQ 718
           GLMGFQ AL+ L IPY+S  AV  ADESME I ++A  AS ELA+ERG YSS++GSLW +
Sbjct: 660 GLMGFQDALYELRIPYSSDAAVTFADESMEAICYYAYWASTELARERGTYSSYEGSLWSK 719

Query: 719 GVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICG 777
           G+ P+DS+ LLA+ R   + ++RT+RL WD L+ ++   GMRNSNC+AIAPTATI+NI G
Sbjct: 720 GILPLDSLELLAKERGGYVEVDRTTRLDWDALRSKITQDGMRNSNCIAIAPTATISNIVG 779

Query: 778 VSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERI 837
           V  SI+PS+ NL VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+  GS+  I+R+
Sbjct: 780 VDASIEPSFGNLSVKSNLSGEFTVINQYLVRDLKKLGLWDDVMLMDLKHFKGSLHAIDRV 839

Query: 838 PDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGL 897
           P ++K ++ATAFE+ P WL+E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ GL
Sbjct: 840 PQNVKALYATAFEVAPAWLVEAAARRQKWIDQAQSLNIYMAGASGKKLDETYKLAWVRGL 899

Query: 898 KTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSS----------------THSLGIP 941
           KTTYYLR++SAT VE ST+     +LNAV     + S                  +  + 
Sbjct: 900 KTTYYLRTQSATHVEMSTVNTR--QLNAVSAGTDSQSGALNAAAAAAQTQAGALPATDVK 957

Query: 942 SSCTSDTECEVCQ 954
                D  CE CQ
Sbjct: 958 FCAIDDPSCEACQ 970


>gi|302877616|ref|YP_003846180.1| ribonucleoside-diphosphate reductase, alpha subunit [Gallionella
           capsiferriformans ES-2]
 gi|302580405|gb|ADL54416.1| ribonucleoside-diphosphate reductase, alpha subunit [Gallionella
           capsiferriformans ES-2]
          Length = 944

 Score =  960 bits (2480), Expect = 0.0,   Method: Composition-based stats.
 Identities = 547/958 (57%), Positives = 686/958 (71%), Gaps = 30/958 (3%)

Query: 11  DEDAFPSLAYPFPEKIKG------VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR 64
           +  + P+         +        +V++RNG V  F+P+KIS A+ KAF+AV G  A+ 
Sbjct: 3   NAASAPTSLSSAAGDKEANSSFDLYKVVRRNGSVVVFEPAKISVALTKAFIAVSGGPAAA 62

Query: 65  SIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE 124
           S RV++++  LT+  V  L++       +HIEDIQDQVE  LM+SG H + R YVLYREE
Sbjct: 63  SARVRELVDQLTQGVVIALMRRQPHGGTLHIEDIQDQVELGLMRSGEHDVARAYVLYREE 122

Query: 125 RSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLS 183
            S  RA           A  + +   DG +   +  RL ++V+ AC GL +V  +++VL 
Sbjct: 123 HSRSRAQ----TQVQQPAHVINVTGKDGVVQPLDLARLSVLVQSACEGLGEVVDAELVLQ 178

Query: 184 ETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA 243
              K+MYDG+   ++   LI S+R++IEKEP Y  VTAR LL  +  EVL       +  
Sbjct: 179 VALKDMYDGVPLHEVHKCLILSARSMIEKEPAYNFVTARLLLNNICSEVLG------EDV 232

Query: 244 THHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYD 303
              +M   Y +YF ++I+ G+ A LL E +  FDL  LA +L   RD  F YLGLQ LYD
Sbjct: 233 APADMATRYADYFPKFIKRGIAAELLDEKLAGFDLPRLAAELDASRDLQFGYLGLQTLYD 292

Query: 304 RYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           RYFLHI G+RIE PQ FFMRVAMGLAL E ++E RA+EFY LLS F FMCSTPTLFNSG+
Sbjct: 293 RYFLHIGGTRIEAPQVFFMRVAMGLALNEIDREARAIEFYRLLSGFDFMCSTPTLFNSGS 352

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
           R  QLSSC+L+TV D+L GI+ A+++NA+LAK++GGLGNDWTPVR LGAHI GTNG+SQG
Sbjct: 353 RRSQLSSCYLSTVEDNLEGIYDAIKDNALLAKFAGGLGNDWTPVRALGAHIKGTNGESQG 412

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
           V+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNT+N
Sbjct: 413 VVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLDLRKNTGDDRRRTHDMNTSN 472

Query: 484 WIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAV 543
           WIPDLFMKRV +   WTLFSP +V DLHDL+G +FEIAY  YE +A  G+IK+++ + A 
Sbjct: 473 WIPDLFMKRVMEGGNWTLFSPSDVKDLHDLFGIDFEIAYTAYEEKAAAGQIKLYKTVQAA 532

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLG 603
           +LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++++E AVCNLG
Sbjct: 533 SLWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNADEIAVCNLG 592

Query: 604 SINLLAHFANNQF------DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIG 657
           S+NL AH            D+ KL  TI TA+R+LDNVIDIN + + KA+ SN  HR +G
Sbjct: 593 SVNLPAHLYPEGHDLAGQIDHAKLRRTINTAMRMLDNVIDINYYAVAKARNSNLKHRPVG 652

Query: 658 LGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWD 717
           +G+MGFQ  LH L +PY+S EAVE AD SME + ++A  AS ELA+ERG Y+S+KGSLWD
Sbjct: 653 MGIMGFQDCLHQLRLPYSSMEAVEFADRSMEAVCYYAYWASTELAEERGRYASYKGSLWD 712

Query: 718 QGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANIC 776
            G+ P D++ LL E R   + ++ +  + WD L+ R+   GMRNSNC+AIAPTATI+NI 
Sbjct: 713 CGILPQDTLDLLREERGGYVEVDTSVSMDWDALRARIGQYGMRNSNCVAIAPTATISNII 772

Query: 777 GVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIER 836
           GVS  I+P+YQNL+VKSN+SG+FTV+N  LV ELK+  LWDE MISDLKY DGS+  I+R
Sbjct: 773 GVSACIEPTYQNLFVKSNLSGEFTVINDHLVAELKRLGLWDEVMISDLKYFDGSLAKIDR 832

Query: 837 IPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMG 896
           IP +L+ ++ATAFE++P WLIE+ASRRQKWIDQAQSLN+Y+   SG+KLD  Y+ AW+ G
Sbjct: 833 IPAELRSLYATAFEVEPSWLIEAASRRQKWIDQAQSLNIYMAGVSGRKLDDTYKLAWVRG 892

Query: 897 LKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           LKTTYYLR+  ATS EKST  G  G LNAV V D      +         + ECE CQ
Sbjct: 893 LKTTYYLRTLGATSAEKST--GRAGALNAVSVGD----APAETTQFCSIDNPECEACQ 944


>gi|33593915|ref|NP_881559.1| ribonucleotide-diphosphate reductase subunit alpha [Bordetella
           pertussis Tohama I]
 gi|33563989|emb|CAE43254.1| ribonucleoside-diphosphate reductase alpha chain [Bordetella
           pertussis Tohama I]
 gi|332383334|gb|AEE68181.1| ribonucleotide-diphosphate reductase subunit alpha [Bordetella
           pertussis CS]
          Length = 975

 Score =  959 bits (2478), Expect = 0.0,   Method: Composition-based stats.
 Identities = 543/979 (55%), Positives = 699/979 (71%), Gaps = 39/979 (3%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P+       E +      P   +     +I+RNG V  F+PSKI+ A+ KAF+AV G  
Sbjct: 10  RPTAVPPAQSETS----TDPNSGQWASYNIIRRNGSVVGFEPSKIAIAMTKAFLAVNGGQ 65

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT Q V+ L+++  +    HIED+QDQVE +LM+SG H + R YVLY
Sbjct: 66  GAASARVRELVEQLTAQAVSALVRNRPAGGTFHIEDVQDQVELALMRSGEHDVARAYVLY 125

Query: 122 REERSDVRAAQ----SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDV 176
           RE R+  RAA       S   A   P L ++ D+G     +   L   +E A  GL Q  
Sbjct: 126 RERRAQERAAAAEVLEKSSPAAAQEPTLSVV-DNGVRRPLDLAALRATIEAAGEGLTQYT 184

Query: 177 SSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTV 236
            ++ +L ET KN+YDG+   ++  + I ++R L+EK+P Y++VTAR LL  +R+EVL   
Sbjct: 185 DTEAILKETVKNLYDGVPVDEVFKSAILAARALVEKDPAYSQVTARLLLHTIRKEVLG-- 242

Query: 237 YKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYL 296
               ++ +  +M   Y EYF  +I+ G++  LL   + ++DL  +A  L   RD  F YL
Sbjct: 243 ----EEVSQADMATRYAEYFPAFIQRGIEGGLLDAKLAEYDLERVAKALDGRRDLQFGYL 298

Query: 297 GLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTP 356
           GLQ LYDRYFLH+ G+RIE+PQ FFMRVAMGLAL+E ++E RA+EFY +LSSF FM STP
Sbjct: 299 GLQTLYDRYFLHVRGTRIELPQVFFMRVAMGLALREADREARAIEFYEILSSFDFMSSTP 358

Query: 357 TLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHG 416
           TLFNSGT H QLSSC+LTTV DDL GI+ A++ENA+LAKY+GGLGNDWTPVR L +HI G
Sbjct: 359 TLFNSGTLHSQLSSCYLTTVSDDLEGIYDAIKENALLAKYAGGLGNDWTPVRALRSHIKG 418

Query: 417 TNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRT 476
           TNG+SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGD+RRRT
Sbjct: 419 TNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDERRRT 478

Query: 477 HDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKV 536
           HDMNTANWIPDLFMKRV +N  WTLFSP +  DLHD YGK FE AY  YE +   GE+K+
Sbjct: 479 HDMNTANWIPDLFMKRVMENGEWTLFSPSDCPDLHDKYGKAFEQAYAGYEAKVASGELKL 538

Query: 537 FRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEE 596
           F+K+ AV+LWRKML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+++ E
Sbjct: 539 FKKMPAVSLWRKMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNATE 598

Query: 597 TAVCNLGSINLLAHFANNQF-----DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNH 651
            AVCNLGS+NL+AH   N       ++DKL  TI  A+R+LDNVIDIN + ++KA+ SN 
Sbjct: 599 IAVCNLGSVNLVAHMKPNANGGYELNHDKLKRTIGVAMRMLDNVIDINYYAVDKARNSNE 658

Query: 652 THRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSF 711
            HR +G+G+MGFQ  LH++ +PYAS +A++ AD SME + +HA  AS ELAQERG Y S+
Sbjct: 659 RHRPVGMGIMGFQDCLHVMRVPYASQDAIDFADRSMEAVCYHAYWASSELAQERGRYQSY 718

Query: 712 KGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTA 770
           +GSLW +G+ P D++ +L E R   + ++ +S L WD L+ R+K  GMRNSNC+AIAPTA
Sbjct: 719 EGSLWSRGILPQDTLAMLREERGGNVDVDDSSSLDWDTLRSRIKEHGMRNSNCIAIAPTA 778

Query: 771 TIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGS 830
           TI+NI G S  I+P++QNLYVKSN+SG+FTVVN +LV +LK+  LWDE M++DLKY DGS
Sbjct: 779 TISNIIGASACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKKLGLWDEVMVADLKYFDGS 838

Query: 831 IGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYR 890
           +  I+R+P +L+K++ATAFE++P WL+E ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+
Sbjct: 839 LSRIDRVPSELRKLYATAFEVEPSWLVECASRRQKWIDQAQSLNIYMSGASGKKLDDTYK 898

Query: 891 QAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIP--------- 941
            AW  GLKTTYYLR+  ATS EKST +G  G+LNAV   D  + +     P         
Sbjct: 899 LAWQRGLKTTYYLRTLGATSAEKSTGRG--GELNAVSAGDHGAGSAVSAAPVLPEPEIVG 956

Query: 942 SSCTSDT------ECEVCQ 954
           + CT         ECE CQ
Sbjct: 957 AVCTMRPGDPGFEECEACQ 975


>gi|329902474|ref|ZP_08273119.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548766|gb|EGF33403.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 969

 Score =  958 bits (2476), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/947 (58%), Positives = 688/947 (72%), Gaps = 26/947 (2%)

Query: 24  EKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRL 83
             +   ++++RNG V +F+PSKIS A+ KAF+AV G   + S RV+++++ LT   V  L
Sbjct: 33  AALADYRILRRNGAVVAFEPSKISIAVTKAFLAVNGGQGAASARVRELVEQLTATVVAAL 92

Query: 84  LQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAP 143
           ++   +    HIEDIQDQVE +LM+SG H + R YVLYR +R + RA Q  ++  A    
Sbjct: 93  VRRQPAGGTFHIEDIQDQVELALMRSGEHDVARAYVLYRAKRMEERALQQAARPAAASV- 151

Query: 144 KLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETAL 202
           +L +  +DG     + +++  +++ AC GL+  V +  + +ET KN+YDG+   +L  + 
Sbjct: 152 QLHVT-EDGQRRLLDMQQVHKLIDAACIGLEKHVDANAIFAETVKNLYDGVPVEELHKSA 210

Query: 203 IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
           I ++R L+EK+P Y  VTAR L+  +R+EV        ++    + Q  Y EYF ++I  
Sbjct: 211 ILAARALMEKDPAYTTVTARILMHVIRKEVFG------KEVAQADAQAHYLEYFPQFIHN 264

Query: 263 GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
           G+ A LL   +  FDL  LA  L  +RD  F Y+GLQ LYDRYFLHI   RIEMPQAF+M
Sbjct: 265 GIAAELLDAKLAGFDLDRLAKALVPDRDLQFGYIGLQTLYDRYFLHIRDIRIEMPQAFYM 324

Query: 323 RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
           RVAMGLAL E ++E+RA+EFYNLLSSF FM STPTLFNSGT   QLSSC+LTTV DDL G
Sbjct: 325 RVAMGLALNEAKREERAIEFYNLLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVADDLEG 384

Query: 383 IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
           I+ A+++NA+LAKY+GGLGNDWTPVR LGAHI GTNGKSQGV+PFLKV NDTAVAVNQGG
Sbjct: 385 IYDAIKDNALLAKYAGGLGNDWTPVRSLGAHIKGTNGKSQGVVPFLKVVNDTAVAVNQGG 444

Query: 443 KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
           KRKGAVCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV +   W LF
Sbjct: 445 KRKGAVCAYLETWHMDIEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVMEKGSWMLF 504

Query: 503 SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
           SP EV DLHD  G+ FE AY  YE  A RGE+++F+K+ A+ LWRKML+MLFETGHPWIT
Sbjct: 505 SPSEVPDLHDKVGRAFEAAYTGYEAAAARGELRMFKKVEALDLWRKMLSMLFETGHPWIT 564

Query: 563 FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
           FKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL AH  + Q D+ KL 
Sbjct: 565 FKDPCNIRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLPAHMKDGQLDHVKLQ 624

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TIR A+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ  LH++ +PYAS EAV  
Sbjct: 625 KTIRIAMRMLDNVIDINYYAVQKARDSNMRHRPVGLGIMGFQDCLHIMRVPYASAEAVSF 684

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRT 741
           AD+SME + ++A +AS ELA+ERGAYSS+KGSLWD+G+ P DS+ LL E R   L  + +
Sbjct: 685 ADKSMEAVCYYAYTASTELAEERGAYSSYKGSLWDRGILPQDSLKLLMEERGGYLETDLS 744

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
             + W  L+ R+K  GMRNSNC+AIAPTATI+NI GV+  I+P+YQNLYVKSN+SG+FT 
Sbjct: 745 EAMDWTPLRARIKQFGMRNSNCVAIAPTATISNIIGVAACIEPTYQNLYVKSNLSGEFTE 804

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           +N +LV +LK RDLWDE MISDLKY DGS+  I+R+P +L+ I+ATAFEI+P WL+E+AS
Sbjct: 805 INEYLVRDLKARDLWDEVMISDLKYFDGSLARIDRVPQELRAIYATAFEIEPSWLVEAAS 864

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+  AT  EKST K   G
Sbjct: 865 RRQKWIDQAQSLNIYMAGASGKKLDETYKLAWLRGLKTTYYLRTIGATHTEKSTSK--TG 922

Query: 922 KLNAVPVTDPNSSTHSLG--------IPSSCTSDT------ECEVCQ 954
            LNAV     +S                 SC          ECE CQ
Sbjct: 923 SLNAVSADGVSSGVALSAYTTAGADVDGPSCVLRPGDDGFEECEACQ 969


>gi|297538243|ref|YP_003674012.1| ribonucleoside-diphosphate reductase subunit alpha [Methylotenera
           sp. 301]
 gi|297257590|gb|ADI29435.1| ribonucleoside-diphosphate reductase, alpha subunit [Methylotenera
           sp. 301]
          Length = 938

 Score =  956 bits (2472), Expect = 0.0,   Method: Composition-based stats.
 Identities = 561/937 (59%), Positives = 692/937 (73%), Gaps = 18/937 (1%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLL 84
            +  +QVI+RNG    F   KIS AI KAF+AVEG  +  S RV+D +  L++     L+
Sbjct: 13  SLPTLQVIRRNGAAVQFTLDKISIAITKAFLAVEGNQSGASQRVRDQVATLSQLVNNALM 72

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
           +   +   +HIEDIQDQVE +LM++G+H + R YVLYRE+R+  RAA+  S     ++  
Sbjct: 73  RRLPAGGSIHIEDIQDQVELALMRNGNHDVARAYVLYREKRNAERAAEKASHPTTELSHT 132

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALI 203
           L +   DG LI  + K+L  +V EAC  L DV +  IV+ +  +++YDG+  +++  ALI
Sbjct: 133 LNV-NIDGKLIPLDIKQLNEMVGEACLNLGDVVNPSIVVEQAVRDLYDGIPFTEVYKALI 191

Query: 204 FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
            S+R+LIE EP Y  VTAR  L+ +R EVL       ++ +H +M   Y EYF RYI+ G
Sbjct: 192 LSARSLIETEPAYNYVTARLQLDLVRAEVLG------ERVSHAQMDEHYAEYFPRYIKMG 245

Query: 264 VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMR 323
           + A LL   +  FDL  LA  L  +RDF F YLG+Q LYDRYFLHI   RIE+PQ FFMR
Sbjct: 246 INAELLDSRLAQFDLTKLAAALNKDRDFQFGYLGIQTLYDRYFLHIEERRIELPQIFFMR 305

Query: 324 VAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGI 383
           VAMGLA+ E ++E RA+EFYN+LSSF FM STPTLFN+GT H QLSSC+LTTV DDL GI
Sbjct: 306 VAMGLAINEIDRESRAIEFYNVLSSFDFMSSTPTLFNAGTLHSQLSSCYLTTVSDDLDGI 365

Query: 384 FGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGK 443
           +  ++ENAML KY+GGLGNDWTPVR LGA I GTNGKSQGVIPFLKV NDTAVAVNQGGK
Sbjct: 366 YQGIKENAMLQKYAGGLGNDWTPVRSLGARIKGTNGKSQGVIPFLKVVNDTAVAVNQGGK 425

Query: 444 RKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFS 503
           RKGAVC YLETWH+D+EEFLDLRKNTGDDRRRTHDMNTA+WIPDLFM+RVT+   WTLFS
Sbjct: 426 RKGAVCGYLETWHLDIEEFLDLRKNTGDDRRRTHDMNTAHWIPDLFMRRVTEAGDWTLFS 485

Query: 504 PDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITF 563
           P +V DLHD YGK FE AY  YER+A+ GEIK+F+KI A+ +WRKML+MLFETGHPWITF
Sbjct: 486 PSDVPDLHDKYGKAFETAYVEYERRAENGEIKLFKKIPALQMWRKMLSMLFETGHPWITF 545

Query: 564 KDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF----DYD 619
           KDPCNIRSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NLL H A        D D
Sbjct: 546 KDPCNIRSPQQHVGVVHSSNLCTEITLNTSETEIAVCNLGSVNLLQHLAEVNGKLVLDND 605

Query: 620 KLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEA 679
           KL +TI+  +R+LDNV+DIN + + KA+ +N  HR +G+G+MGFQ+ LH + IPYAS EA
Sbjct: 606 KLQATIKIGMRMLDNVVDINFYPVGKARNANTRHRPVGMGIMGFQNCLHAMRIPYASMEA 665

Query: 680 VEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAM 738
           VE AD +ME + ++A  AS  LA+ER AYSSFKGSLWDQG+ P+D++ LL   R   + +
Sbjct: 666 VEFADRAMEMVCYNAYYASTVLAEERAAYSSFKGSLWDQGILPLDTLDLLLNERGGNVEV 725

Query: 739 NRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGD 798
           +R+  L WD L+ R++ +GMRNSNC+AIAPTATI+NI GVS SI+P YQNLYVKSN+SG+
Sbjct: 726 DRSKTLDWDALRNRIQKVGMRNSNCVAIAPTATISNIVGVSASIEPEYQNLYVKSNLSGE 785

Query: 799 FTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIE 858
           FT+VN  LV +LK R LWD  M+SDLKY DGS+  I+R+P DLK+++ATAF++DP WLIE
Sbjct: 786 FTIVNEQLVIDLKARGLWDAVMVSDLKYFDGSLQKIDRVPADLKQLYATAFDVDPTWLIE 845

Query: 859 SASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKG 918
           +A+RRQKWIDQAQSLNLY   PSGKKL+  Y  AW  GLKTTYYLRS  AT+ EKST  G
Sbjct: 846 AAARRQKWIDQAQSLNLYFAVPSGKKLNDTYLLAWQRGLKTTYYLRSMGATAAEKST--G 903

Query: 919 VDGKLNAVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
             G+LNAV      +    L  P  C+ D  ECE CQ
Sbjct: 904 SGGELNAVSAGLEEAPKEYL--PKVCSIDNPECESCQ 938


>gi|114332418|ref|YP_748640.1| ribonucleotide-diphosphate reductase subunit alpha [Nitrosomonas
           eutropha C91]
 gi|114309432|gb|ABI60675.1| ribonucleoside-diphosphate reductase, alpha subunit [Nitrosomonas
           eutropha C91]
          Length = 957

 Score =  955 bits (2467), Expect = 0.0,   Method: Composition-based stats.
 Identities = 545/959 (56%), Positives = 691/959 (72%), Gaps = 16/959 (1%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEK-IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
           PS                P   +     +VI+RNG V +F+P KIS A+ KAF+AV G  
Sbjct: 8   PSSSSILQKNFLGEMTDSPATRQDYSQYKVIRRNGAVVAFEPGKISIAMTKAFIAVRGGQ 67

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
           ++ S  +++I+  LT + V  L +        HIEDIQDQVE +LM+SG H + R YVLY
Sbjct: 68  SAASSSMREIVAQLTGEVVHALTRRRPGGGTFHIEDIQDQVELALMRSGDHDVARAYVLY 127

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKI 180
           REER+  RA Q      +  A  L I+ ++G  I  +  RL   +E AC  L +V ++ +
Sbjct: 128 REERARERARQQKEPPTSTQAAVLHIV-ENGQRIPLDPSRLTARIESACQHLGNVVNAGL 186

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           ++    +++YDG+   ++  + I S+R LIEKEP Y+ VTAR LL+ +R EVL       
Sbjct: 187 IVKAMLRDLYDGVPAEEVRKSAILSARALIEKEPAYSFVTARLLLDNIRHEVLG------ 240

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           +  +H  MQ  Y +YF  +I +G++A LL E +  FDL  L+  L  +RD  F YLGLQ 
Sbjct: 241 EDVSHEAMQSRYADYFPGFIRQGMEAGLLDERLGQFDLARLSETLIADRDLQFGYLGLQT 300

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLHI+  RIE+PQAFFMRVAMGLAL E ++E RA+EFY+LLS+F FM STPTLFN
Sbjct: 301 LYDRYFLHISERRIELPQAFFMRVAMGLALNEIDREARAIEFYHLLSTFDFMSSTPTLFN 360

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGTR  QLSSC+L+TVPD L GI+ A++ENA+L+K++GGLGNDWTPVR +GA I GTNGK
Sbjct: 361 SGTRRSQLSSCYLSTVPDSLDGIYEAIKENALLSKFAGGLGNDWTPVRAMGARIKGTNGK 420

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV +DTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 421 SQGVVPFLKVVSDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMN 480

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TA W+PDLFMKR+ ++  WTLFSP +  DLH+ YGK FE AY  YE QA +G + + ++I
Sbjct: 481 TAVWVPDLFMKRMLEDQEWTLFSPSDTPDLHEKYGKAFEEAYIAYEEQATQGRLALHKRI 540

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKMLTMLFETGHPWITFKDPCNIRSPQ HVGVVHSSNLCTEITLN++ +E AVC
Sbjct: 541 PARQLWRKMLTMLFETGHPWITFKDPCNIRSPQNHVGVVHSSNLCTEITLNTNEKEIAVC 600

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGSINL AH  + + D  KL  T+ TA+R+LDNVIDIN + + KA+ +N  HR +GLG+
Sbjct: 601 NLGSINLPAHIVDGKLDLTKLKQTVATAMRMLDNVIDINFYAVAKARNANLRHRPVGLGI 660

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ  LH L I YAS EAVE AD SME +++H   AS ELA+ERG Y+++ GSLW++G+
Sbjct: 661 MGFQDCLHKLGISYASREAVEFADSSMEAVAYHTYWASTELAEERGTYATYHGSLWERGI 720

Query: 721 FPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
            P DS+ LL E R   + ++ +S L W  L++R+K  GMRNSNC+AIAPTATI+NI GVS
Sbjct: 721 LPQDSLALLQEERGGHVEVDTSSTLDWTPLRERIKQYGMRNSNCLAIAPTATISNIIGVS 780

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
            SI+P+YQNLYVKSN+SG+FTVVN  LVN+LK++DLWDE MI+DLK++DG+   I+RIP+
Sbjct: 781 ASIEPTYQNLYVKSNLSGEFTVVNQSLVNDLKKQDLWDEVMIADLKHYDGAASKIDRIPE 840

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
           +L+ ++ATAFEIDP WL+E+A+RRQKWIDQAQSLNLY+   SGKK+D +YR AWL GLKT
Sbjct: 841 NLRALYATAFEIDPRWLVEAAARRQKWIDQAQSLNLYMSGASGKKMDDLYRLAWLRGLKT 900

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVPVT----DPNSSTHSLGIPSSCTSDTECEVCQ 954
           TYYLR+  AT+ EKST+    G LNAVP        +S             D ECE CQ
Sbjct: 901 TYYLRAMGATTAEKSTVH--TGTLNAVPAQQNGHTDSSGQIHSATKQCAIDDPECEACQ 957


>gi|288941564|ref|YP_003443804.1| ribonucleoside-diphosphate reductase subunit alpha [Allochromatium
           vinosum DSM 180]
 gi|288896936|gb|ADC62772.1| ribonucleoside-diphosphate reductase, alpha subunit [Allochromatium
           vinosum DSM 180]
          Length = 985

 Score =  954 bits (2466), Expect = 0.0,   Method: Composition-based stats.
 Identities = 566/975 (58%), Positives = 707/975 (72%), Gaps = 23/975 (2%)

Query: 2   HPSKDV---NKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVE 58
           HP++         +   P  A         VQVI+RNG +T FDPSKI  A+ KAF+AVE
Sbjct: 12  HPAQARHADPSASQTTTPDSAESTGHIPGRVQVIRRNGQITHFDPSKIMVAMTKAFLAVE 71

Query: 59  GKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREY 118
           G  A  S R+ D +  LTEQ V  L +       VHIEDIQDQVE +LM++G H+I R+Y
Sbjct: 72  GDSAGASSRIHDRVAELTEQVVGALTRRLSGGGTVHIEDIQDQVELALMRAGEHRIARDY 131

Query: 119 VLYREERSDVRAAQSHSKSDAPIAPK-LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVS 177
           VLYRE R+  RAA+S +++ A   P  + + + DG+    +   +  ++EE+C  L  V 
Sbjct: 132 VLYREARARERAARSAAETAAIREPHPINVTLADGSTRPLDVAHMARLLEESCRDLDAVD 191

Query: 178 SKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVY 237
              +LS+T +N++DG+ E+D+  AL+ S+RTLIE+EP Y++  AR LL+ LRRE L  + 
Sbjct: 192 PNAILSDTLRNLFDGVREADVRQALVMSARTLIEREPQYSQAAARLLLDILRREALGFLD 251

Query: 238 KKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLG 297
                 T  +M   Y +YF  YI+       L   +  +DL  L   LK ERD  F YLG
Sbjct: 252 LAVGVETQADMAERYGDYFAAYIKRAADLEHLDGQLARYDLKRLGAALKPERDLQFTYLG 311

Query: 298 LQILYDRYFLHI-NGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTP 356
           LQ LYDRYF+H  +G R E+PQAFFMRVAMGLA+ E E+E+RA+EFY LLSSF FMCSTP
Sbjct: 312 LQTLYDRYFIHTADGIRFELPQAFFMRVAMGLAINEIEREERAIEFYELLSSFDFMCSTP 371

Query: 357 TLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHG 416
           TLFNSG+  PQLSSCFLTTVPDDL GI+ A+++NA+L+K++GGLGNDWT VRG+GAHI G
Sbjct: 372 TLFNSGSPRPQLSSCFLTTVPDDLDGIYSAIKDNALLSKFAGGLGNDWTRVRGMGAHIKG 431

Query: 417 TNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRT 476
           TNGKSQGVIPFLKVANDTA+AVNQGG+R+GAVCAYLETWHID+EEFLDLRKNTGDDRRRT
Sbjct: 432 TNGKSQGVIPFLKVANDTAIAVNQGGRRRGAVCAYLETWHIDIEEFLDLRKNTGDDRRRT 491

Query: 477 HDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKV 536
           HDMNTANW+PDLFMKRV ++  WTLFSPDE  DLHDL G+ FE AY  YE +A RGE+K+
Sbjct: 492 HDMNTANWVPDLFMKRVAEDGHWTLFSPDETPDLHDLTGQAFEQAYVAYEERAARGELKI 551

Query: 537 FRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEE 596
            +++ AV LWRKML MLFETGHPWI FKDPCN+R   QHVGVVHSSNLCTEITL+++  E
Sbjct: 552 SKRLKAVDLWRKMLAMLFETGHPWIAFKDPCNLRYTNQHVGVVHSSNLCTEITLHTNDLE 611

Query: 597 TAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAI 656
            AVCNLGSINL AH  +   D  +L  T+RTA+R+LDNVID N + + +A+ SN  HR +
Sbjct: 612 AAVCNLGSINLAAHITDKGLDTQRLRRTVRTAMRMLDNVIDYNFYNVPQARASNLRHRPV 671

Query: 657 GLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLW 716
           GLGLMGFQ AL+ L IPYAS EAV  AD+S E++S++AI AS +LA ERG Y SF+GSLW
Sbjct: 672 GLGLMGFQDALYRLRIPYASQEAVAFADQSTEYLSYYAIEASADLAAERGRYPSFEGSLW 731

Query: 717 DQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANI 775
            QGV PIDSIGL+ + R   L M+ +  L WD L++R++T+GMRNSNC+AIAPTATI+NI
Sbjct: 732 SQGVLPIDSIGLMEQGRGGYLQMDTSHTLDWDRLRERIQTVGMRNSNCLAIAPTATISNI 791

Query: 776 CGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIE 835
            GVSQSI+P+YQNL+VKSN+SG+FTVVN +LV +LK+R LWD  M++DLKY+DGS+  I+
Sbjct: 792 VGVSQSIEPTYQNLFVKSNLSGEFTVVNPYLVADLKERGLWDAVMVNDLKYYDGSLLPID 851

Query: 836 RIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLM 895
           RIPD+LK+++ATAFEIDP WL+E+ASRRQKW+DQAQSLNLY+ EPSGKKLD +Y+ AW+ 
Sbjct: 852 RIPDELKELYATAFEIDPRWLVEAASRRQKWLDQAQSLNLYMQEPSGKKLDNLYKLAWVR 911

Query: 896 GLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS------------- 942
           GLKTTYYLRS  AT VEKST+    G+ N +     N        PS             
Sbjct: 912 GLKTTYYLRSMGATHVEKSTM-ADTGRANRLSAVGGNYLGRQTAKPSDTTDDTPAAATAT 970

Query: 943 ---SCTSDTECEVCQ 954
                  D +CE CQ
Sbjct: 971 PSACSILDPDCEACQ 985


>gi|158341283|ref|YP_001522353.1| ribonucleotide-diphosphate reductase subunit alpha [Acaryochloris
           marina MBIC11017]
 gi|158311524|gb|ABW33135.1| ribonucleotide-diphosphate reductase, alpha subunit [Acaryochloris
           marina MBIC11017]
          Length = 960

 Score =  952 bits (2460), Expect = 0.0,   Method: Composition-based stats.
 Identities = 543/960 (56%), Positives = 684/960 (71%), Gaps = 33/960 (3%)

Query: 14  AFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIK 73
             P             +VI+RNG V  F+  KI+ A+ KAF+AV+G  +  S RV++++ 
Sbjct: 15  LPPIQGGSVEGLDAEYKVIRRNGSVVGFEADKIAIAMTKAFLAVKGVQSGVSARVRELVA 74

Query: 74  NLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS 133
            LT   VT L +   +    HIEDIQDQVE +LM+SG H + R YVLYRE+RS  R  Q 
Sbjct: 75  TLTTNVVTALKRRQPTGGTFHIEDIQDQVELALMRSGEHDVARAYVLYREKRSQKRTQQH 134

Query: 134 HSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDG 192
             ++          +MD G  +  + +R   +V+ AC  L D VS K +  E  KN+YDG
Sbjct: 135 GIEAAPIY------LMDGGDRVLLDLERFNDLVDSACINLGDTVSGKAIADEALKNIYDG 188

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
            S  +L  + I ++R+ IEK+P+Y+KVTAR LL ++R+EVL        + T  EMQ  Y
Sbjct: 189 ASVVELHKSAILAARSHIEKDPDYSKVTARLLLHRIRQEVLGA------EVTQAEMQARY 242

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            EYF  +I++G+   LL E +  F+L  L + L  ERD  F YLGLQ LYDRYFLH    
Sbjct: 243 AEYFPHFIQQGIATGLLDEKLAQFNLQKLGSVLVAERDLQFGYLGLQTLYDRYFLHTEDR 302

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           RIE+PQAFFMRVAMGLAL E ++E+RA EFY++LS F FM STPTLFNSGT   QLSSC+
Sbjct: 303 RIELPQAFFMRVAMGLALNEIDREERAAEFYDILSKFDFMSSTPTLFNSGTVRSQLSSCY 362

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPD L GI+ A+++NA+L+KY+GGLGNDWTPVR LGAHI GTNGKSQGV+PFLKV N
Sbjct: 363 LTTVPDALDGIYSAIKDNALLSKYAGGLGNDWTPVRALGAHIKGTNGKSQGVVPFLKVVN 422

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHD+NTANWIPDLFMKR
Sbjct: 423 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDINTANWIPDLFMKR 482

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V ++  WTLFSPD V DLHD  GKEFE AY  YE+QA +GE+K F+ + A  LWRKML+M
Sbjct: 483 VMEDGDWTLFSPDIVPDLHDKVGKEFETAYLAYEQQAAKGELKPFKTVPANTLWRKMLSM 542

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKDPCN+RSPQQH+G+VHSSNLCTE+TLN++  E AVCNLGS+NL+ H  
Sbjct: 543 LFETGHPWITFKDPCNVRSPQQHIGMVHSSNLCTEVTLNTNENEIAVCNLGSVNLVNHMV 602

Query: 613 ----NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALH 668
                 Q D  KL  TI  A+R+LDNVID+N + +  A+ SN  HR +GLG+MGFQ  LH
Sbjct: 603 EKNGQMQLDQAKLQHTITIAMRMLDNVIDLNYYAVSTARNSNLKHRPVGLGIMGFQDCLH 662

Query: 669 LLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGL 728
            L +PYAS +AV+ AD +ME + ++A  AS ELAQERG YS++KGSLWD+G+ P D++ L
Sbjct: 663 QLRLPYASQDAVDFADRAMEAVCYYAYWASTELAQERGRYSTYKGSLWDRGILPQDTLAL 722

Query: 729 LAEVRDEL-AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQ 787
           L EVR     ++ +S + WD L+ R+   GMRNSNC+AIAPTATIANI GVS  I+P+YQ
Sbjct: 723 LKEVRGGFVEVDESSTMDWDLLRDRIAQHGMRNSNCVAIAPTATIANIIGVSACIEPTYQ 782

Query: 788 NLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHAT 847
           NLYVKSN+SG+FTVVN +LV +LK R+LWDE MI+DLKY DGS+  I+RIP +L++++AT
Sbjct: 783 NLYVKSNLSGEFTVVNEYLVRDLKVRELWDEVMIADLKYFDGSLAKIDRIPPELRQLYAT 842

Query: 848 AFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRS 907
           AFE++P W++E+A+RR KWIDQAQSLN+Y+   SGKKLD IY+ AW  GLKTTYYLRS  
Sbjct: 843 AFEVEPNWIVEAAARRSKWIDQAQSLNIYMAGASGKKLDQIYKLAWQRGLKTTYYLRSLG 902

Query: 908 ATSVEKSTLKGVDGKLNAVPVTDPNS-------STHSLGIPSSCTSDT------ECEVCQ 954
           AT VEKST       LNAV     ++       ++ S  +   C+         +CE CQ
Sbjct: 903 ATHVEKST--APASSLNAVSNNGSSNGIGNILTTSKSENLGQVCSLSPGDANFDDCEACQ 960


>gi|30250347|ref|NP_842417.1| ribonucleotide-diphosphate reductase subunit alpha [Nitrosomonas
           europaea ATCC 19718]
 gi|30181142|emb|CAD86335.1| Ribonucleotide reductase large subunit [Nitrosomonas europaea ATCC
           19718]
          Length = 955

 Score =  951 bits (2459), Expect = 0.0,   Method: Composition-based stats.
 Identities = 532/955 (55%), Positives = 688/955 (72%), Gaps = 10/955 (1%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEK-IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
           PS    +           P   +     ++I+RNG V +F+P KIS A+ KAF+AV G  
Sbjct: 8   PSSSPVQQKNFLEEMTDLPATRQNYSQYKIIRRNGAVVAFEPGKISIALTKAFIAVRGGQ 67

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
           ++ S  +++I+  LT + V  L +        HIEDIQDQVE +LM+SG H I R YVLY
Sbjct: 68  SAASSSMREIVAQLTGEVVHALTRRRPEGGTFHIEDIQDQVELALMRSGDHDIARAYVLY 127

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKI 180
           REER+  RA Q  ++  +     L ++ ++G  I  +  +L   +E AC  L + V + +
Sbjct: 128 REERARERARQQSAQPASGQVAVLHVV-ENGQKIPLDPAQLMARIESACQNLGNTVDAAL 186

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           ++    K++YDG+   ++  + I S+R LIEKEP Y+ VTAR LL+ +R EVL       
Sbjct: 187 IVKSMLKDLYDGVPAEEVRKSAILSARALIEKEPAYSFVTARLLLDNIRYEVLG------ 240

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           ++  H  MQ  Y EYF  ++ +G++A LL E +  FDL  L+  L  +RD  F YLGLQ 
Sbjct: 241 EEVAHEAMQSRYAEYFPEFVRKGIEAGLLDERLGQFDLARLSEALAADRDLQFGYLGLQT 300

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLH++  RIE+PQ FFMRVAMGLAL E ++E RA+EFY+LLS F FM STPTLFN
Sbjct: 301 LYDRYFLHVSERRIELPQIFFMRVAMGLALNEIDREARAIEFYHLLSKFDFMSSTPTLFN 360

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGTR  QLSSC+L+TVPD L GI+ A++ENA+L+K++GGLGNDWTPVR +GA I GTNGK
Sbjct: 361 SGTRRSQLSSCYLSTVPDSLDGIYEAIKENALLSKFAGGLGNDWTPVRAMGARIKGTNGK 420

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV +DTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 421 SQGVVPFLKVVSDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMN 480

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TA W+PDLFMKR+ ++  WTLFSP +  DLHD +G+ FE AY  YE QA +G + +F++I
Sbjct: 481 TAVWVPDLFMKRMQEDQEWTLFSPSDTPDLHDKFGRAFEEAYIAYEEQAAQGRLTLFKRI 540

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKMLTMLFETGHPWITFKDPCNIRSPQ HVGVVHSSNLCTEITLN+S +E AVC
Sbjct: 541 PARQLWRKMLTMLFETGHPWITFKDPCNIRSPQNHVGVVHSSNLCTEITLNTSEKEIAVC 600

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGS+NLLAH  + + D  +L  T+ TA+R+LDNVIDIN + + KA+ +N  HR +GLG+
Sbjct: 601 NLGSVNLLAHIVDGKLDQARLKQTVTTAMRMLDNVIDINFYAVAKARNANFRHRPVGLGI 660

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ  LH L I YASPEAVE AD SME +++H   AS ELA+ERG Y++++GSLWD+G+
Sbjct: 661 MGFQDCLHKLGISYASPEAVEFADRSMEAVAYHTYWASTELAEERGTYATYRGSLWDRGI 720

Query: 721 FPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
            P D++ LL E R   + ++ +S   WD L+ R++  GMRNSNC+AIAPTATI+NI GVS
Sbjct: 721 LPQDTLELLREERGGHVEIDTSSTQDWDALRDRIRQYGMRNSNCLAIAPTATISNIIGVS 780

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
            SI+P+YQNLYVKSN+SG+FTVVN +LVN+LK++DLWDE MI+DLK++DG++  I+R+P+
Sbjct: 781 ASIEPTYQNLYVKSNLSGEFTVVNQWLVNDLKKQDLWDEVMIADLKHYDGAVSKIDRVPE 840

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
           +L+ ++ATAFE+DP WL+E+ASRRQKWIDQAQSLNLY+   SGKK+D +YR AWL GLKT
Sbjct: 841 NLRNLYATAFEVDPRWLVEAASRRQKWIDQAQSLNLYMAGASGKKMDELYRLAWLRGLKT 900

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           TYYLR+  AT+ EKST+                 +            + ECE CQ
Sbjct: 901 TYYLRALGATTAEKSTVHTGTLNAVPAQHEAHAGNLAHSAPQQCAIDNPECEACQ 955


>gi|120556761|ref|YP_961112.1| ribonucleotide-diphosphate reductase subunit alpha [Marinobacter
           aquaeolei VT8]
 gi|120326610|gb|ABM20925.1| ribonucleoside-diphosphate reductase, alpha subunit [Marinobacter
           aquaeolei VT8]
          Length = 949

 Score =  950 bits (2455), Expect = 0.0,   Method: Composition-based stats.
 Identities = 534/941 (56%), Positives = 688/941 (73%), Gaps = 31/941 (3%)

Query: 18  LAYPFPEK-IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
              P P    + +QVIKRNG + SF+P+KIS A+ KAF+AVEG  A+ S R+ D +  +T
Sbjct: 36  AEPPAPATDTQSLQVIKRNGTLVSFNPAKISVAVTKAFLAVEGDQAAGSARINDAVHRVT 95

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           EQ V  + +  K+   VHIEDIQDQVE +LM++   K+ R YVLYREE +  RA      
Sbjct: 96  EQVVQAISRRLKAGGKVHIEDIQDQVELALMRAEEQKVARAYVLYREEHARQRA----VD 151

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
                 P L +   DG++   +   ++  VE+A +GL  ++   ++ +  +N+YDG+ E+
Sbjct: 152 EPVEAHPHLTVKKADGSIAPLDLGLMKQQVEQASTGLDGINGDSLVEDALRNLYDGIEET 211

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           ++ +ALI ++R  IE+EP+Y+ VTAR LLE+LR E      +         +  +YP+  
Sbjct: 212 EVLSALIMTARGRIEREPDYSAVTARLLLEQLRLET----AEALDLPRSLPLAEIYPQAL 267

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             +I  G++  LL E++  FDL  L N LK ERD  F +LGLQ LYDRYFLH N +R+E+
Sbjct: 268 SAFIHAGIRYELLDEALAAFDLERLGNALKPERDLQFGFLGLQTLYDRYFLHWNKARLEL 327

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRVAMGLAL+E +   RA+EFY LLSSF +M STPTLFNSGTRH QLSSC+LTTV
Sbjct: 328 PQVFFMRVAMGLALREDDPNARAIEFYELLSSFDYMASTPTLFNSGTRHSQLSSCYLTTV 387

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDL GI+GA+++NA+L+K++GGLGNDWTPVR LG+HI GTNG+SQGV+PFLKV NDTAV
Sbjct: 388 GDDLEGIYGAIRDNALLSKWAGGLGNDWTPVRALGSHIKGTNGQSQGVVPFLKVVNDTAV 447

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGD+RRRTHDMNTANW+PDL ++R+ ++
Sbjct: 448 AVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWVPDLLIERMRED 507

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLFSP +V DLHDLYG  F   Y++YE  A++G+IK+F+KI A  LWRKMLT+LFET
Sbjct: 508 REWTLFSPSDVPDLHDLYGNAFRERYQHYEALAEQGKIKLFKKIPAKQLWRKMLTVLFET 567

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGS+NL AH  + + 
Sbjct: 568 GHPWITFKDPCNLRSPQQHQGVVHSSNLCTEITLNTSADEIAVCNLGSVNLAAHIKDGEL 627

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D  +L  T+ TAVR+LDNVIDIN + + +A+ SN  HR +GLGLMGFQ AL+ L +PY+S
Sbjct: 628 DVTRLERTVNTAVRMLDNVIDINFYAVPQARNSNLKHRPVGLGLMGFQDALYQLGLPYSS 687

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--D 734
           PEAVE AD +ME +S+ A+ AS  LA ERGAY +++GSLW QG+ P+DS+GLL + R   
Sbjct: 688 PEAVEFADVAMEQLSYFALRASATLAGERGAYDTYEGSLWSQGILPMDSVGLLKDNRRDG 747

Query: 735 ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
           +L++N  SRL W  +++ +   GMRNSN MAIAPTATI+NI GVSQSI+P+YQNL+VKSN
Sbjct: 748 DLSLNTNSRLDWTPVRELIAKNGMRNSNVMAIAPTATISNIVGVSQSIEPAYQNLFVKSN 807

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTVVN  LV +LK   LWD  M++DLKY DGS+  I+RIP +LK  +ATAFEIDP 
Sbjct: 808 LSGEFTVVNPSLVRDLKAEGLWDNVMVNDLKYFDGSVQQIDRIPAELKARYATAFEIDPR 867

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           WL+E+A+RRQKW+DQAQSLNLY+ EPSGKKLD +Y+ AW  GLKTTYYLRS  AT  EK+
Sbjct: 868 WLVEAAARRQKWLDQAQSLNLYMAEPSGKKLDALYQLAWERGLKTTYYLRSLGATGAEKT 927

Query: 915 TLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
                              +  S   P  C+ D  +CE CQ
Sbjct: 928 -------------------APVSAPQPQVCSIDNPDCEACQ 949


>gi|302525966|ref|ZP_07278308.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptomyces
           sp. AA4]
 gi|302434861|gb|EFL06677.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptomyces
           sp. AA4]
          Length = 967

 Score =  949 bits (2452), Expect = 0.0,   Method: Composition-based stats.
 Identities = 566/911 (62%), Positives = 693/911 (76%), Gaps = 9/911 (0%)

Query: 16  PSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNL 75
           PS A   P     V+VI+R+G V+ FD  KIS A+ KAF+AVEG  A+ S RV  ++  L
Sbjct: 31  PSAAEGAPSA---VRVIRRDGSVSPFDAGKISVALTKAFLAVEGGDAAASSRVHHVVAEL 87

Query: 76  TEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS 135
           TEQ    LL+H      +HIE IQDQVE +LM+ GHHK+ R YVLYR+ER    A    +
Sbjct: 88  TEQVEAALLRHTGPETALHIEQIQDQVELALMRGGHHKVARAYVLYRDER----AKAREA 143

Query: 136 KSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSE 195
            + A     L +   DGTL   +  R+  +V EA +GL+DVS++ VL+E  +N+YDG++ 
Sbjct: 144 AAPAHAEVALSVKGADGTLRPLDWARVSHVVGEAVAGLEDVSAEPVLAEAKRNLYDGITA 203

Query: 196 SDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEY 255
            +L  A I ++R L+E+EPNY+ V+AR LL+KLR E L+ +   P++A+  EM   Y  Y
Sbjct: 204 DELALAQIMAARVLVEQEPNYSFVSARLLLDKLRGEALSYLAGAPRQASQDEMTSEYAPY 263

Query: 256 FCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIE 315
           F  Y+   V+  L+   +  FDL  +   ++ ERD  F +LGLQ LYDRYF H NG R E
Sbjct: 264 FRAYLRRAVELELVDAELTTFDLDKITAAIRPERDLDFGFLGLQTLYDRYFQHHNGVRFE 323

Query: 316 MPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTT 375
           +PQAFFMRVAMGLA++E  +E RA+EFY LLS+FHFM STPTLFNSGT   QLSSCFLTT
Sbjct: 324 LPQAFFMRVAMGLAIREDNREARAIEFYELLSTFHFMASTPTLFNSGTNRAQLSSCFLTT 383

Query: 376 VPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTA 435
           V DDL  IF A + NA+LAKYSGGLGNDWTPVRGLGAHI GTNG+SQGV+PFLK+ANDTA
Sbjct: 384 VDDDLDSIFQAYKNNALLAKYSGGLGNDWTPVRGLGAHIKGTNGQSQGVVPFLKIANDTA 443

Query: 436 VAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ 495
           VAVNQGGKRKGA CAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANW+PD F++RV  
Sbjct: 444 VAVNQGGKRKGAACAYLETWHVDIEEFLDLRKNTGDDRRRTHDMNTANWVPDEFLRRVEA 503

Query: 496 NAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFE 555
           NA WTLFSP+E  DLHDLYG  F   Y  YE  A RGEIKVFRK+ AV LWR+MLTMLFE
Sbjct: 504 NAEWTLFSPNETPDLHDLYGNAFAQRYREYEAAAARGEIKVFRKVRAVELWRRMLTMLFE 563

Query: 556 TGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ 615
           TGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN++++E AVCNLGS+NLL H     
Sbjct: 564 TGHPWITFKDPCNLRSPQQHVGVVHSSNLCTEITLNTTTDEVAVCNLGSVNLLKHVTPEG 623

Query: 616 FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA 675
            D ++L  T+RTAVR+LDNVIDIN +TI +A++SN  HR +GLG+MGFQ AL  L +P+A
Sbjct: 624 LDTERLEKTVRTAVRMLDNVIDINFYTIPEARRSNLRHRPVGLGIMGFQDALFELGVPFA 683

Query: 676 SPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-- 733
           S EAV+ AD SME +S++AISAS +LA+ERG Y +F+GSLW +G+ PIDS+ LL + R  
Sbjct: 684 SEEAVKFADVSMEHLSYYAISASTDLAEERGQYQTFEGSLWSKGILPIDSMQLLIDARQG 743

Query: 734 DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS 793
           D L ++ ++ L W  L++RVKT+GMRNSN MAIAPTATI+NI GV QSI+P +QNLYVKS
Sbjct: 744 DGLDVDTSTTLDWAPLRERVKTVGMRNSNVMAIAPTATISNISGVGQSIEPLFQNLYVKS 803

Query: 794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDP 853
           NMSGDFTVVN  LV  LK R LWDE M+SDLKY DGS+G I+R+PDDLK ++ATAFEI+ 
Sbjct: 804 NMSGDFTVVNPHLVKSLKARGLWDEVMVSDLKYFDGSLGQIDRVPDDLKALYATAFEIES 863

Query: 854 MWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK 913
            W++++ S RQKWIDQAQSLNLY+  PSG+KLD +YR AW  GLKTTYYLR++SAT VEK
Sbjct: 864 KWIVDAGSVRQKWIDQAQSLNLYIAAPSGRKLDELYRYAWHKGLKTTYYLRAQSATHVEK 923

Query: 914 STLKGVDGKLN 924
           STL+G DGKLN
Sbjct: 924 STLRGTDGKLN 934


>gi|226227155|ref|YP_002761261.1| ribonucleoside-diphosphate reductase alpha subunit [Gemmatimonas
           aurantiaca T-27]
 gi|226090346|dbj|BAH38791.1| ribonucleoside-diphosphate reductase alpha subunit [Gemmatimonas
           aurantiaca T-27]
          Length = 957

 Score =  945 bits (2442), Expect = 0.0,   Method: Composition-based stats.
 Identities = 565/929 (60%), Positives = 715/929 (76%), Gaps = 4/929 (0%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           QVI+RN  ++ FDPSKI+ A+ KAF+AVEG  A+ S RV+DI++      V  L +H  +
Sbjct: 29  QVIRRNRTLSPFDPSKIAVAMTKAFVAVEGSSAATSARVRDIVERRCVSVVEALTRHADA 88

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA-PKLKIM 148
              +HIE+IQDQVE +LM+ GHHK+ R YVLYREER+ +R      ++   +A   ++  
Sbjct: 89  QRALHIEEIQDQVELALMRGGHHKVARAYVLYREERARLRRESGAEETTPGVATSTVRFR 148

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              G L + +   L +++++AC GL  VS+  VL ET +N+YDG++  +L  A I ++RT
Sbjct: 149 TATGELRTIDQGHLGLVIDDACDGLDGVSAVSVLDETLRNIYDGITADELSLAPILAART 208

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E EPNYA V+AR LLE+LR EVL+ ++ +  +A   +M   Y +YF  ++  G+   L
Sbjct: 209 LVETEPNYAYVSARLLLERLRAEVLSGIHGQEVEARPADMTRHYVDYFPLFVARGIDTGL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   +  FDL  LA+ L+ ERD AF YLGLQ LYDRY LH +G R+E+PQ FFMRVAMGL
Sbjct: 269 LDPELARFDLHRLASALRPERDLAFRYLGLQTLYDRYLLHNDGVRLELPQTFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL+E ++E RA+EFY LLSSF FMCSTPTLFNSGT   QLSSCFLTTVPDDL GIF +++
Sbjct: 329 ALREVDREARAIEFYELLSSFDFMCSTPTLFNSGTPRAQLSSCFLTTVPDDLDGIFKSVK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+LAKYSGGLGNDW+ VRGLG++I GTNG+SQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 389 DNALLAKYSGGLGNDWSRVRGLGSYIRGTNGRSQGVVPFLKVANDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWHID+E+FLDLRKNTGDDRRRTHDMNTANWIPDLFM+RV ++  WTLFSPDEV 
Sbjct: 449 CAYLETWHIDIEDFLDLRKNTGDDRRRTHDMNTANWIPDLFMQRVEEDGDWTLFSPDEVP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDLYG+ F   Y  +E +A+RGE+ V +++ AV LWR+MLTMLFETGHPWITFKDPCN
Sbjct: 509 DLHDLYGRAFAERYVQHEIRAERGEVTVHKRVKAVDLWRRMLTMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GV+HSSNLCTEITLN+S  E AVCNLGS+NL  H +    D  +LA+T+RTA
Sbjct: 569 LRSPQQHTGVIHSSNLCTEITLNTSDSEVAVCNLGSVNLANHISGGGIDRARLANTVRTA 628

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN +TI +A++SN  HR +GLG+MGFQ ALH+L +PYAS  A+  ADESME
Sbjct: 629 VRMLDNVIDINFYTIPEARRSNLRHRPVGLGIMGFQDALHMLRVPYASEAAIRFADESME 688

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWD 747
           F+S+ AI+AS +LA ERG+Y SF GSLW +G+ PIDS+ LL   R   L  +R+SRL W 
Sbjct: 689 FLSYEAIAASSDLAVERGSYGSFNGSLWQRGILPIDSLALLDASREGRLECDRSSRLDWS 748

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L++RV+T G+RNSN +AIAPTATI+NICGVSQSI+PSY+NL+VKSNMSG+FT VN +LV
Sbjct: 749 SLRERVQTQGIRNSNLLAIAPTATISNICGVSQSIEPSYRNLFVKSNMSGEFTEVNEYLV 808

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK R LWDE M+ DLKY DGS+G I+R+P+DLK+++ TAFE+D  WLIE+A+RRQKWI
Sbjct: 809 QDLKSRGLWDEVMVGDLKYFDGSLGPIDRVPEDLKQLYMTAFEVDCAWLIEAAARRQKWI 868

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLNLY+  P+G++LD +YR AW  GLKTTYYLRS++AT VEKSTL   DGKLNAV 
Sbjct: 869 DQAQSLNLYVARPNGRQLDTLYRLAWRRGLKTTYYLRSQAATHVEKSTLTRTDGKLNAVA 928

Query: 928 VTDPNSSTHSLGI--PSSCTSDTECEVCQ 954
           V    + +    +  P+    + +CE CQ
Sbjct: 929 VAAAQTVSAIEAVTAPACSIDNPDCEACQ 957


>gi|311696540|gb|ADP99413.1| ribonucleotide-diphosphate reductase subunit alpha [marine
           bacterium HP15]
          Length = 921

 Score =  944 bits (2439), Expect = 0.0,   Method: Composition-based stats.
 Identities = 534/947 (56%), Positives = 688/947 (72%), Gaps = 33/947 (3%)

Query: 14  AFPSLAYPFPEK---IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQD 70
           +  +LA P P      + +QVIKRNG +  FDPSKIS A+ KAF+AVEG  A+ S R+ D
Sbjct: 2   SASALAEPRPTSHTDTESLQVIKRNGTLVGFDPSKISIAVTKAFLAVEGDTAAGSARIND 61

Query: 71  IIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRA 130
            +  +T+Q +  + +  K+   VHIEDIQDQVE +LM++   K+ R YVLYREE +  RA
Sbjct: 62  AVHRVTDQVIQAIGRRLKAGGKVHIEDIQDQVELALMRAEEQKVARAYVLYREEHARERA 121

Query: 131 AQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMY 190
             +         P L +    G +   +   +++ VE+A +GL+ +    ++ +   N+Y
Sbjct: 122 RHAPV----EAHPHLTVKKTSGEIAPLDLGLMKLQVEQAATGLEGIDGDSLVDDALTNLY 177

Query: 191 DGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQC 250
           DG++E D+ +ALI ++R+ IE+EP+Y+ VTAR LLE+    +               +  
Sbjct: 178 DGIAEEDVLSALIMTARSRIEREPDYSAVTARLLLEQ----LRLENAAALGLPISLPLAE 233

Query: 251 LYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHIN 310
           +YP+    ++E G++  LL E++  FDL  L   L+ ERD  F +LGLQ LYDRYFLH N
Sbjct: 234 IYPQALSAFVEAGIRYELLDEALAAFDLERLGAALQPERDLQFGFLGLQTLYDRYFLHWN 293

Query: 311 GSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSS 370
            +R+E+PQ FFMRVAMGLAL+E +   RA+EFYNLLSSF +M STPTLFNSGTRH QLSS
Sbjct: 294 KARLELPQVFFMRVAMGLALREDDPNARAIEFYNLLSSFDYMASTPTLFNSGTRHSQLSS 353

Query: 371 CFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKV 430
           C+LTTV DDL  I+GA+++NAML+K++GGLGNDWTPVR LG+HI GTNG+SQGV+PFLKV
Sbjct: 354 CYLTTVGDDLEDIYGAIRDNAMLSKWAGGLGNDWTPVRALGSHIKGTNGQSQGVVPFLKV 413

Query: 431 ANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFM 490
            NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGD+RRRTHDMNTANW+PDL +
Sbjct: 414 VNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWVPDLLI 473

Query: 491 KRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKML 550
           +R+ ++  WTLFSP +  DLHDLYG  F   YE+YE  A++G+IK+F+KI A  LWRKML
Sbjct: 474 ERMREDRDWTLFSPSDAPDLHDLYGNAFRERYEHYEALAEQGKIKLFKKIPAKQLWRKML 533

Query: 551 TMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAH 610
           T+LFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGS+NL AH
Sbjct: 534 TVLFETGHPWITFKDPCNLRSPQQHRGVVHSSNLCTEITLNTSADEIAVCNLGSVNLTAH 593

Query: 611 FANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLL 670
            AN + D  +L  T+ TAVR+LDNVIDIN + + +A+ SN  HR +GLG+MGFQ AL+ L
Sbjct: 594 IANGELDVQRLEQTVNTAVRMLDNVIDINYYAVPQARNSNLKHRPVGLGIMGFQDALYQL 653

Query: 671 HIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLA 730
            +PY+SPEAVE AD +ME +S+ AI AS  LA ERGAY S++GSLW QG+ PIDSI LL 
Sbjct: 654 GLPYSSPEAVEFADVAMEQLSYFAIRASATLAGERGAYESYEGSLWQQGILPIDSINLLK 713

Query: 731 EVR--DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQN 788
           E R   +L++N  +RL W  +++ + T GMRNSN MAIAPTATI+NI GVSQSI+P+YQN
Sbjct: 714 ENRREGDLSVNTNARLDWSPVRELIATNGMRNSNVMAIAPTATISNIVGVSQSIEPAYQN 773

Query: 789 LYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATA 848
           L+VKSN+SG+FTVVN  LV +LK   LWD  M++DLKY DGS+  I+RIP++LK  +ATA
Sbjct: 774 LFVKSNLSGEFTVVNPSLVRDLKAEGLWDNVMVNDLKYFDGSVQQIDRIPNELKARYATA 833

Query: 849 FEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSA 908
           FEID  WL+E+A+RRQKW+DQAQSLNLY+ EPSGKKLD +Y+ AW  GLKTTYYLRS  A
Sbjct: 834 FEIDARWLVEAAARRQKWLDQAQSLNLYMAEPSGKKLDALYQLAWERGLKTTYYLRSLGA 893

Query: 909 TSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           T  EK+                   +  +   P  C+  D +CE CQ
Sbjct: 894 TGAEKT-------------------APVAAPQPQVCSIDDPDCEACQ 921


>gi|253998798|ref|YP_003050861.1| ribonucleoside-diphosphate reductase subunit alpha [Methylovorus
           sp. SIP3-4]
 gi|253985477|gb|ACT50334.1| ribonucleoside-diphosphate reductase, alpha subunit [Methylovorus
           sp. SIP3-4]
          Length = 937

 Score =  943 bits (2438), Expect = 0.0,   Method: Composition-based stats.
 Identities = 560/940 (59%), Positives = 697/940 (74%), Gaps = 24/940 (2%)

Query: 24  EKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRL 83
             +  +QVI+R+G    F   KIS A+ KAF+AV G+ ++ S  ++  ++ LT+  V  L
Sbjct: 13  AALPSLQVIRRDGAAVPFAADKISIALTKAFLAVAGEHSTISSHMRTEVQALTDTVVAAL 72

Query: 84  LQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAP 143
           ++   +   +HIEDIQDQVE +LM+SG H + R YVLYRE+        +   +    AP
Sbjct: 73  VRRKPAGGSIHIEDIQDQVELALMRSGEHDVARAYVLYREK------RAAERAAQQAPAP 126

Query: 144 KLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETAL 202
            L ++  DG  +  + + L  +V EAC  L D V   +++ +  +++YDG+   ++  AL
Sbjct: 127 TLHVLQ-DGKRVPLDQQLLLSMVTEACVNLGDAVQPAVIVEQAIRDLYDGMPFDEVRRAL 185

Query: 203 IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
           I S+R+LIE+EP Y  VTAR  L+ +R EVL       +  +H  M   Y EYF +YI+ 
Sbjct: 186 ILSARSLIEREPAYNYVTARLQLDLVRAEVLG------EAVSHTAMAQRYAEYFPQYIKT 239

Query: 263 GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
           G+ A LL E +  FDL  LA+ L  +RD  F YLGLQ LYDRYFLHI   RIE+PQ FFM
Sbjct: 240 GIAAELLDERLAQFDLSRLASVLVADRDLQFGYLGLQTLYDRYFLHIEERRIELPQVFFM 299

Query: 323 RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
           RVAMGLA+ E ++E RA+EFY++LSSF FM STPTLFNSGTRH QLSSC+LTTV DDL G
Sbjct: 300 RVAMGLAINEIDRESRAIEFYHVLSSFDFMSSTPTLFNSGTRHSQLSSCYLTTVSDDLDG 359

Query: 383 IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
           I+ A++ENA+L K++GGLGNDWTPVR LG+ I GTNGKSQGVIPFLKV NDTAVAVNQGG
Sbjct: 360 IYQAIKENALLQKFAGGLGNDWTPVRALGSRIKGTNGKSQGVIPFLKVVNDTAVAVNQGG 419

Query: 443 KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
           KRKGAVC YLE+WH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFM+RV  NA WTLF
Sbjct: 420 KRKGAVCGYLESWHLDLEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMQRVQANADWTLF 479

Query: 503 SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
           SP +V DLHDLYGK FE AY NYER+AD GEIK+F+++ AV LWRKML+MLFETGHPWIT
Sbjct: 480 SPSDVPDLHDLYGKAFETAYTNYERRADHGEIKLFKRVPAVQLWRKMLSMLFETGHPWIT 539

Query: 563 FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFAN----NQFDY 618
           FKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH          D 
Sbjct: 540 FKDPCNIRSPQQHVGVVHSSNLCTEITLNTSETEIAVCNLGSVNLMAHLKREGDSYVLDQ 599

Query: 619 DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
            KLA+TIR A+R+LDNV+DIN + + KA+ SN+ HR +GLG+MGFQ ALH + +PYAS  
Sbjct: 600 AKLAATIRVAMRMLDNVVDINFYAVGKARNSNYRHRPVGLGIMGFQDALHAMRVPYASSA 659

Query: 679 AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LA 737
           AVE AD +ME + ++A  AS  LA+ERGAYSSF+GSLWDQG+ P+D++ LL+E R   + 
Sbjct: 660 AVEFADRAMEAVCYNAYLASSYLAEERGAYSSFRGSLWDQGILPLDTLNLLSEARGGQVE 719

Query: 738 MNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG 797
           ++R+S L WD L++R++ +GMRNSNC+AIAPTATI+NI GVS SI+P YQNLYVKSN+SG
Sbjct: 720 VDRSSTLDWDSLRQRIQRVGMRNSNCVAIAPTATISNIVGVSASIEPEYQNLYVKSNLSG 779

Query: 798 DFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLI 857
           +FTVVN  LV +LK R LWDE MI+D+KY+DGS+  IER+P DLK+++ATAFE+DP+WL+
Sbjct: 780 EFTVVNEQLVQDLKARGLWDEVMIADIKYYDGSLAAIERVPADLKQLYATAFEVDPVWLV 839

Query: 858 ESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           E+A+RRQKWIDQAQSLNLY   PSGKKL+ +Y  AWL GLKTTYYLRS  ATS EKST  
Sbjct: 840 EAAARRQKWIDQAQSLNLYFAAPSGKKLNDVYLLAWLRGLKTTYYLRSLGATSAEKST-- 897

Query: 918 GVDGKLNAVPVTDPNSSTHSLGIPS---SCTSDTECEVCQ 954
           G  G+LNAV    P S+      P        D  CE CQ
Sbjct: 898 GQGGELNAVSSGLPVSAASPSAEPEPKQCLIDDPGCEACQ 937


>gi|313200885|ref|YP_004039543.1| ribonucleoside-diphosphate reductase subunit alpha [Methylovorus
           sp. MP688]
 gi|312440201|gb|ADQ84307.1| ribonucleoside-diphosphate reductase, alpha subunit [Methylovorus
           sp. MP688]
          Length = 937

 Score =  941 bits (2432), Expect = 0.0,   Method: Composition-based stats.
 Identities = 558/940 (59%), Positives = 697/940 (74%), Gaps = 24/940 (2%)

Query: 24  EKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRL 83
             +  +QVI+R+G    F   KIS A+ KAF+AV G+ ++ S  ++  ++ LT+  V  L
Sbjct: 13  AALPSLQVIRRDGAAVPFAADKISIALTKAFLAVAGEHSTISTHMRTEVQALTDTVVAAL 72

Query: 84  LQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAP 143
           ++   +   +HIEDIQDQVE +LM+SG H + R YVLYRE+        +   +    AP
Sbjct: 73  VRRKPAGGSIHIEDIQDQVELALMRSGEHDVARAYVLYREK------RAAERAAQQAPAP 126

Query: 144 KLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETAL 202
            L ++  DG  +  + + L  +V EAC  L D V   +++ +  +++YDG+   ++  AL
Sbjct: 127 TLHVLQ-DGKRVPLDQQLLLSMVTEACVNLGDAVQPAVIVEQAMRDLYDGMPFDEVRRAL 185

Query: 203 IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
           I S+R+LIE+EP Y  VTAR  L+ +R EVL       +  +H  M   Y EYF +YI+ 
Sbjct: 186 ILSARSLIEREPAYNYVTARLQLDLVRAEVLG------EAVSHTAMAQRYAEYFPQYIKA 239

Query: 263 GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
           G+ A LL E +  FDL  LA+ L  +RD  F YLGLQ LYDRYFLHI   RIE+PQ FFM
Sbjct: 240 GIAAELLDERLAQFDLSRLASVLVADRDLQFGYLGLQTLYDRYFLHIEERRIELPQVFFM 299

Query: 323 RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
           RVAMGLA+ E ++E RA+EFY++LSSF FM STPTLFNSGTRH QLSSC+LTTV DDL G
Sbjct: 300 RVAMGLAINEIDRESRAIEFYHVLSSFDFMSSTPTLFNSGTRHSQLSSCYLTTVSDDLDG 359

Query: 383 IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
           I+ A++ENA+L K++GGLGNDWTPVR LG+ I GTNGKSQGVIPFLKV NDTAVAVNQGG
Sbjct: 360 IYQAIKENALLQKFAGGLGNDWTPVRALGSRIKGTNGKSQGVIPFLKVVNDTAVAVNQGG 419

Query: 443 KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
           KRKGAVC YLE+WH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFM+RV  NA WTLF
Sbjct: 420 KRKGAVCGYLESWHLDLEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMQRVQANADWTLF 479

Query: 503 SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
           SP +V DLHDLYGK FE AY NYER+AD GEIK+F+++ AV LWRKML+MLFETGHPWIT
Sbjct: 480 SPSDVPDLHDLYGKAFETAYTNYERRADHGEIKLFKRVPAVQLWRKMLSMLFETGHPWIT 539

Query: 563 FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFAN----NQFDY 618
           FKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH          D 
Sbjct: 540 FKDPCNIRSPQQHVGVVHSSNLCTEITLNTSETEIAVCNLGSVNLMAHLKREGDSYVLDQ 599

Query: 619 DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
            KLA+TIR A+R+LDNV+DIN + + KA+ SN+ HR +GLG+MGFQ ALH + +PYAS  
Sbjct: 600 TKLAATIRVAMRMLDNVVDINFYAVGKARNSNYRHRPVGLGIMGFQDALHAMRVPYASAA 659

Query: 679 AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LA 737
           AVE AD +ME + ++A  AS  LA+ERGAYSSF+GSLWDQG+ P+D++ LL+E R   + 
Sbjct: 660 AVEFADRAMEAVCYNAYLASSYLAEERGAYSSFRGSLWDQGILPLDTLNLLSEARGGQVE 719

Query: 738 MNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG 797
           ++R+  L WD L++R++ +GMRNSNC+AIAPTATI+NI GVS SI+P YQNLYVKSN+SG
Sbjct: 720 VDRSRTLDWDSLRQRIQRVGMRNSNCVAIAPTATISNIVGVSASIEPEYQNLYVKSNLSG 779

Query: 798 DFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLI 857
           +FTVVN  LV +LK R LWDE MI+D+KY+DGS+  IER+P DLK+++ATAFE+DP+WL+
Sbjct: 780 EFTVVNEQLVQDLKARGLWDEVMIADIKYYDGSLAAIERVPADLKQLYATAFEVDPVWLV 839

Query: 858 ESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           E+A+RRQKWIDQAQSLNLY   PSGKKL+ +Y  AWL GLKTTYYLRS  ATS EKST  
Sbjct: 840 EAAARRQKWIDQAQSLNLYFAAPSGKKLNDVYLLAWLRGLKTTYYLRSLGATSAEKST-- 897

Query: 918 GVDGKLNAVPVTDPNSSTHSLGIPS---SCTSDTECEVCQ 954
           G  G+LNAV    P  +  +   P        D +CE CQ
Sbjct: 898 GQGGELNAVSSALPAVAAATNAEPEPKQCLIDDPDCEACQ 937


>gi|114321251|ref|YP_742934.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227645|gb|ABI57444.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 928

 Score =  938 bits (2424), Expect = 0.0,   Method: Composition-based stats.
 Identities = 540/927 (58%), Positives = 688/927 (74%), Gaps = 18/927 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           QVI+RNG +T+FDP KI  A+ KAF+AVEG+ ++ + R+Q +   LT Q V  L +   +
Sbjct: 18  QVIRRNGALTAFDPDKIQLAMKKAFLAVEGERSADAARIQQVTAELTAQVVQALTRR-PT 76

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
           A  +HIEDIQDQVE +LM++G HK+ R YVLYREE +  R  ++  +      P+L +  
Sbjct: 77  ATPIHIEDIQDQVELALMRAGEHKVARAYVLYREEHARKRRQEATDEP-----PRLHMTR 131

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
            DG  +  +   L  ++  AC  L D   + V  E ++N+YDG++E ++  ALI S+R+L
Sbjct: 132 TDGEQVPLDESLLRRVLHHACHELADTDPERVAREAWRNLYDGVTEQEVHKALILSARSL 191

Query: 210 IEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
           IE+EP Y  V AR L  +L  E L  +      A   +    Y +YF RYI  GV+  LL
Sbjct: 192 IEQEPAYGHVAARLLQHQLNGEALRFLDFPYDGAPGADPG--YTDYFARYIRRGVELELL 249

Query: 270 HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLA 329
            E ++ FDL  LA  L  ERD  F YLGLQ LYDRY  H +G+R E+PQAFFMRVAMGL 
Sbjct: 250 DEQLLTFDLERLAEALMPERDLQFNYLGLQTLYDRYLQHWDGTRFELPQAFFMRVAMGLT 309

Query: 330 LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQE 389
           L+E E+E+RA+EFY LLSSF FM STPTLFNSGTR PQLSSC+LT+VPDDL GI+GA+++
Sbjct: 310 LQEVEREERAIEFYRLLSSFDFMSSTPTLFNSGTRRPQLSSCYLTSVPDDLGGIYGAIRD 369

Query: 390 NAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVC 449
           NA+L+K++GGLGNDWT VR +GAHI GTNG+SQGV+PFLKVA+DTAVAVNQGGKRKGAVC
Sbjct: 370 NALLSKFAGGLGNDWTRVRAMGAHIKGTNGRSQGVVPFLKVASDTAVAVNQGGKRKGAVC 429

Query: 450 AYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSD 509
           AYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTA+W+PDLFM+R   +A WTLFSPD+ + 
Sbjct: 430 AYLETWHLDVEEFLELRKNTGDDRRRTHDMNTAHWVPDLFMQRAEADADWTLFSPDDAAH 489

Query: 510 LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNI 569
           LH+LYG+ F+ AYE+ E +A RGEI+ ++ +SA  LWR+ML MLFETGHPWITFKDPCN+
Sbjct: 490 LHELYGQAFKAAYEDLEARAARGEIRNYKVVSAKQLWRRMLGMLFETGHPWITFKDPCNL 549

Query: 570 RSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAV 629
           RSPQQH GVVHSSNLCTEITLN+S EE AVCNLGS+NL AH   +  D+++L +T+RTA+
Sbjct: 550 RSPQQHAGVVHSSNLCTEITLNTSDEEIAVCNLGSVNLAAHTTPDGLDHERLRNTVRTAM 609

Query: 630 RVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEF 689
           R+LDNVIDIN +++ +A+++N  HR +GLG+MGFQ AL+   +PYAS EAV  AD S E 
Sbjct: 610 RMLDNVIDINYYSVPQARRANLRHRPVGLGVMGFQDALYAQDLPYASDEAVAFADRSQEA 669

Query: 690 ISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDE 748
           IS++AI AS +LA+ERGAY SF+GSLW +G  P+DSI  + E R  +  M+ +S L W  
Sbjct: 670 ISYYAIEASADLARERGAYPSFEGSLWQRGELPLDSIQRVVEARDGDCTMDTSSSLDWAA 729

Query: 749 LKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVN 808
           L+++V+T GMRNSNC+AIAPTATIANI GVSQ I+P+++NLYVKSN+SG+FTVVN  LV 
Sbjct: 730 LREKVRT-GMRNSNCLAIAPTATIANIVGVSQGIEPAFKNLYVKSNLSGEFTVVNPALVR 788

Query: 809 ELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWID 868
            LK   LWD  M++DLKY+DGS+  I R+P++LK+  ATAFE+D  WL+++ SRRQKW+D
Sbjct: 789 ALKAYGLWDAVMVNDLKYYDGSVQPIGRVPEELKQRFATAFELDSEWLVQAGSRRQKWLD 848

Query: 869 QAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG-KLNAVP 927
           Q+QSLNLY+ EPSG KLD +YRQAW +GLKTTYYLRS  AT VEKST+      +LNAV 
Sbjct: 849 QSQSLNLYMAEPSGPKLDALYRQAWRLGLKTTYYLRSTGATQVEKSTMDPARANRLNAVS 908

Query: 928 VTDPNSSTHSLGIPSSCTSDTECEVCQ 954
                      G  S    D ECE CQ
Sbjct: 909 AA-------PGGGQSCSVDDPECEACQ 928


>gi|149375673|ref|ZP_01893442.1| Ribonucleotide reductase, alpha subunit [Marinobacter algicola
           DG893]
 gi|149360075|gb|EDM48530.1| Ribonucleotide reductase, alpha subunit [Marinobacter algicola
           DG893]
          Length = 921

 Score =  937 bits (2422), Expect = 0.0,   Method: Composition-based stats.
 Identities = 525/939 (55%), Positives = 671/939 (71%), Gaps = 30/939 (3%)

Query: 19  AYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQ 78
                     +QVIKRNG +  FD SKIS A+ KAF+AVEG  A+ S R+ D ++ +T Q
Sbjct: 10  GQSASTSTASLQVIKRNGALVGFDASKISVAVTKAFLAVEGDEAAGSARIHDSVERVTHQ 69

Query: 79  TVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSD 138
            +  + +  K+   VHIEDIQDQVE +LM++   K+ R YVLYRE  +  RA    S + 
Sbjct: 70  VMQAISRRLKAGGKVHIEDIQDQVELALMRAEEQKVARAYVLYREAHAQERA----SLAP 125

Query: 139 APIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDL 198
               P L +   +G     +   +++ VE A   L+ +  + ++    +N+YDG++E ++
Sbjct: 126 VEAHPTLTVKKANGEAAPLDLGLMKVQVERASQELEGIDGESLVEGALRNLYDGIAEEEV 185

Query: 199 ETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCR 258
            +ALI ++R  IE+EP+Y+ VTAR LLE+LR E  T +           +  +YP+    
Sbjct: 186 LSALIMTARGRIEQEPDYSAVTARLLLEQLRLETATALKLPLSLP----LAEIYPQALST 241

Query: 259 YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
           +IE+G+   LL E+M  FDL  L   LK ERD+ F +LGLQ LYDRYFL+  G R+E+PQ
Sbjct: 242 FIEQGIHYELLDEAMAAFDLERLGAALKPERDYQFGFLGLQTLYDRYFLNWKGDRLELPQ 301

Query: 319 AFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPD 378
            FFMRV+MGLAL+E +   RA+EFY+LLSSF +M STPTLFNSGTRH QLSSC+LTTV D
Sbjct: 302 VFFMRVSMGLALQEDDPNARAIEFYDLLSSFDYMASTPTLFNSGTRHSQLSSCYLTTVQD 361

Query: 379 DLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
           DL GI+GA+++NAML+K++GGLGNDWTPVR LG+HI GTNG SQGV+PFLKV NDTAVAV
Sbjct: 362 DLEGIYGAIRDNAMLSKWAGGLGNDWTPVRALGSHIKGTNGSSQGVVPFLKVVNDTAVAV 421

Query: 439 NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
           NQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGD+RRRTHDMNTANW+PDL ++R+  +  
Sbjct: 422 NQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWVPDLLIERMRSDQD 481

Query: 499 WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
           WTLFSP++  DLHDLYG  F   Y+ YE  A RGEI +F+ +SA  LWRKMLT+LFETGH
Sbjct: 482 WTLFSPNDTPDLHDLYGNAFRERYQEYEAMAARGEITLFKTVSAKQLWRKMLTVLFETGH 541

Query: 559 PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDY 618
           PWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGSINL AH  N + D 
Sbjct: 542 PWITFKDPCNLRSPQQHRGVVHSSNLCTEITLNTSADEIAVCNLGSINLAAHVHNGELDV 601

Query: 619 DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
            +L  T+ TAVR+LDNV+DIN + + +A+ SN  HR +GLGLMGFQ AL+ L++PY S E
Sbjct: 602 QRLERTVNTAVRMLDNVVDINYYAVPQARNSNFKHRPVGLGLMGFQDALYRLNLPYTSAE 661

Query: 679 AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DEL 736
           AVE AD +ME IS+ AI AS  LA ERGAY +++GSLW +G+ PIDSI LL   R   +L
Sbjct: 662 AVEFADVAMEQISYFAIRASAVLAGERGAYETYEGSLWHEGILPIDSINLLKANRREGDL 721

Query: 737 AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
           ++N  + L W  +++ +   GMRNSN MAIAPTATI+NI GVSQSI+P+YQNL+VKSN+S
Sbjct: 722 SLNTDTLLDWTPVRELIARNGMRNSNVMAIAPTATISNIVGVSQSIEPAYQNLFVKSNLS 781

Query: 797 GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
           G+FTVVN  LV +LK   LWD  M++DLKY DGS+  I+RIP  LK  +ATAFEID  WL
Sbjct: 782 GEFTVVNPSLVRDLKAEGLWDNVMVNDLKYFDGSVQQIDRIPAALKARYATAFEIDARWL 841

Query: 857 IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
           +E+A+RRQKW+DQAQSLNLY+ EPSGKKLD +Y+ +W  GLKTTYYLRS  AT  EK+  
Sbjct: 842 VEAAARRQKWLDQAQSLNLYMAEPSGKKLDELYQLSWERGLKTTYYLRSLGATGAEKT-- 899

Query: 917 KGVDGKLNAVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
                            +  +   P  C+ D  +CE CQ
Sbjct: 900 -----------------APVAAPQPQVCSIDEPDCEACQ 921


>gi|160872690|ref|ZP_02062822.1| ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide
           reductase) [Rickettsiella grylli]
 gi|159121489|gb|EDP46827.1| ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide
           reductase) [Rickettsiella grylli]
          Length = 946

 Score =  937 bits (2422), Expect = 0.0,   Method: Composition-based stats.
 Identities = 538/928 (57%), Positives = 674/928 (72%), Gaps = 20/928 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKRNG +  +DPSKI  AI KAF+AVEG  A+ S R+ + +  LT+Q  T L Q + 
Sbjct: 37  LQVIKRNGKLVDYDPSKIRVAITKAFLAVEGGQAALSTRIHERVSQLTQQITTILQQRHP 96

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
               + IE IQDQVE +LM+   H++ R YVLYREER  +RA             +L+I 
Sbjct: 97  QGGTLSIETIQDQVELALMRVEAHQVARAYVLYREERRKMRAETKP-----HSEIQLQIT 151

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+    +  +L +++ E C+ L+DV  + +L ET +N+YDG+  +D++ ALI S+R+
Sbjct: 152 LTDGSQRPLDLIQLSLLITETCNDLKDVKHERILQETLRNLYDGMPAADIDKALIISARS 211

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E +P Y   TARFLL  L  E L  +         H    +Y  YF  YI+ G++  L
Sbjct: 212 LVEHDPQYTYATARFLLRTLYAEALHFLELP---LHTHRHSGIYSHYFQHYIKRGIQLEL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   +  FDL  L+  L  ERD  F YLGLQ LYDRYFLH +  R E+PQAFFMRVAMGL
Sbjct: 269 LDPQLHTFDLEQLSQALLPERDQQFTYLGLQTLYDRYFLHADHIRFELPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A  E+ K  RA+EFY+LLSSF +M STPTLFNSGT  PQLSSCFLTTV DDL  I+ A++
Sbjct: 329 AQHESNKNDRAIEFYHLLSSFDYMASTPTLFNSGTLRPQLSSCFLTTVTDDLDHIYSAIK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+K++GGLGNDWTPVR +GA I GTNGKS GV+PFL VAN +AVAVNQGGKRKGAV
Sbjct: 389 DNALLSKFAGGLGNDWTPVRAMGARIKGTNGKSLGVVPFLNVANASAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKR+ +   WTLFSPDE  
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKRLMKGENWTLFSPDETP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G  FE  Y+ YE +A RGEIK F+ I A  LWRKML++LFETGHPWITFKDPCN
Sbjct: 509 DLHDAFGSAFEEKYQAYEAKALRGEIKNFKTIPAATLWRKMLSLLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAH-FANNQFDYDKLASTIRT 627
           +RSPQQHVG +HSSNLCTEITLN+S +E AVCNLGSINL  H   + + +  KL  TIRT
Sbjct: 569 LRSPQQHVGTIHSSNLCTEITLNTSIDEIAVCNLGSINLPQHLTESGEIEKTKLRQTIRT 628

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           A+R+LDNVIDIN +T+ +A++SN  HR IGLGLMGFQ AL+ L +PYAS  A+  AD++M
Sbjct: 629 AIRMLDNVIDINYYTVPQARRSNLKHRPIGLGLMGFQDALYQLRLPYASDAAITFADQTM 688

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDEL-AMNRTSRLPW 746
           E IS++AI AS +LA ERGAY SF GSLW QGV P+DSI  L + R E    +RT+RL W
Sbjct: 689 ELISYYAIEASSDLAHERGAYESFPGSLWSQGVLPLDSIARLQKARGEFLDQDRTARLDW 748

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+K+V   GMR+SNCMAIAPTATI+NICGVSQSI+P+YQNL+VKSNMSG+FT++N +L
Sbjct: 749 DTLRKKVM-HGMRHSNCMAIAPTATISNICGVSQSIEPTYQNLFVKSNMSGEFTMINPYL 807

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           +N+LK   LWD  M++DLKY+DGS+  IERIPD LK+++ATAFEI   WL+E+ SRRQKW
Sbjct: 808 INDLKLLGLWDAVMLNDLKYYDGSLQKIERIPDHLKQLYATAFEIPAHWLVEAGSRRQKW 867

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQ+QSLNLY+   SGKKLD +Y+Q WL GLKT+YYLR+  AT  EK+TL          
Sbjct: 868 IDQSQSLNLYMAHASGKKLDELYKQVWLKGLKTSYYLRTMGATHTEKATL---------A 918

Query: 927 PVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
                +   +++  P+    D +CE CQ
Sbjct: 919 KSHLNSVHMNTVATPACSIVDPDCESCQ 946


>gi|212212092|ref|YP_002303028.1| ribonucleotide-diphosphate reductase subunit alpha [Coxiella
           burnetii CbuG_Q212]
 gi|212010502|gb|ACJ17883.1| ribonucleoside-diphosphate reductase alpha chain [Coxiella burnetii
           CbuG_Q212]
          Length = 941

 Score =  931 bits (2405), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/929 (59%), Positives = 687/929 (73%), Gaps = 18/929 (1%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
            ++V+KR+G V  +D ++I+ A+ KAF+AVEG+ A+ S RVQ+I+  LT+Q      +  
Sbjct: 29  QLRVVKRDGRVVKYDANRITIAMKKAFLAVEGETAAESGRVQEIVSRLTDQITDLFHKRW 88

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
            S  +VHIE IQD+VE +LM +G HK  R YVLY     + R  Q   +  +     + I
Sbjct: 89  PSGGVVHIETIQDKVELALMYAGLHKAARAYVLY----REERRKQREEQKASEAENTIHI 144

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            +DDG  I  +   L  +V  ACS L+ V +  +L ET  N++DG++  D+   L+ ++R
Sbjct: 145 TLDDGATILLDQSWLARMVHSACSDLEGVDAVKILEETKNNLFDGVALKDVYKGLVMTAR 204

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           TL+E EPNY  VTAR LL  L REVL  +   PQ   H ++   YPE F  +I  G++  
Sbjct: 205 TLVENEPNYTYVTARLLLHDLYREVLNGLN-LPQDLMHEDIAHYYPEAFKNFIRHGIETE 263

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
            LH ++  FDL YLA  LK ERD  F YL LQ LYDRY +H    RIE+PQ FFMRVAMG
Sbjct: 264 HLHPNLQTFDLNYLAQALKPERDQQFTYLSLQTLYDRYLIHHQQVRIELPQVFFMRVAMG 323

Query: 328 LALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           LA  E   + +RAVEFYN+LSSF FM STPTLFNSGT  PQLSSCFLTTVPD L GI+GA
Sbjct: 324 LAQSEGEARNERAVEFYNVLSSFDFMSSTPTLFNSGTVFPQLSSCFLTTVPDSLDGIYGA 383

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           L++NA+L+KY+GGLGNDWTPVR +GA+I GTNGKS GV+PFL VA+ TA+AVNQGGKRKG
Sbjct: 384 LKDNALLSKYAGGLGNDWTPVRAMGAYIKGTNGKSLGVVPFLNVADATAIAVNQGGKRKG 443

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV ++  WTLFSPDE
Sbjct: 444 AVCAYLETWHMDIEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVFEDGQWTLFSPDE 503

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
           V DLHD +G+ FEIAY  YE +A RGEI+  + ISA++LWRK+L+MLFETGHPW+TFKD 
Sbjct: 504 VPDLHDKFGEAFEIAYVAYEEKAHRGEIR-SKTISALSLWRKILSMLFETGHPWVTFKDA 562

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           CNIRSPQQHVGV+HSSNLCTEITLN+S EE AVCNLGSINL+ H  + + D +KLA T +
Sbjct: 563 CNIRSPQQHVGVIHSSNLCTEITLNTSREEIAVCNLGSINLVNHMKDGKLDTEKLARTTK 622

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TA+R+LDNVIDIN +++ +A+ SN  HR IGLGLMGFQ AL+L +IPYAS  AV+ AD+S
Sbjct: 623 TAIRMLDNVIDINYYSVPQARTSNLKHRPIGLGLMGFQDALYLQNIPYASEAAVQFADQS 682

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLP 745
           ME IS++AI AS+ELA+ERG Y +F  SLW QG+ PIDSI LL + R      N    L 
Sbjct: 683 METISYYAIQASMELAKERGPYETFNNSLWSQGILPIDSIQLLKKSRGKYFEQNTDQTLD 742

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W+ L+K+V   GMRNSN MAIAPTATI+NICG+SQSI+P+YQNL+VKSN+SG+FTV+N +
Sbjct: 743 WNALRKQVVAHGMRNSNVMAIAPTATISNICGISQSIEPTYQNLFVKSNLSGEFTVINPY 802

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV ELK R LWD  M+ DLKY++GS+  I+RIP +LKK++ATAFE++P WL+E+ASRRQK
Sbjct: 803 LVRELKSRQLWDNVMVHDLKYYNGSVQKIDRIPAELKKLYATAFEVEPRWLVEAASRRQK 862

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+ EPSGKKLD +YR AWL GLKTTYYLRS  AT  EK+T+   D  LNA
Sbjct: 863 WIDQAQSLNLYMAEPSGKKLDVLYRMAWLRGLKTTYYLRSMGATGTEKATIH--DTTLNA 920

Query: 926 VPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           V   +  +        +    D +CE CQ
Sbjct: 921 VTGQNNPN--------ACAIDDPDCEACQ 941



 Score = 37.9 bits (86), Expect = 9.4,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 83/211 (39%), Gaps = 17/211 (8%)

Query: 138 DAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIV--LSETYKNMYDGLSE 195
           +A    +L+++  DG ++ +++ R+ + +++A   ++  ++     + E    + D ++ 
Sbjct: 23  EAIQPGQLRVVKRDGRVVKYDANRITIAMKKAFLAVEGETAAESGRVQEIVSRLTDQIT- 81

Query: 196 SDLETAL--------IFSSRTLIEKEPNYAKV--TARFLLEKLRREVLTTVYKKPQKATH 245
            DL            I + +  +E    YA +   AR  +            +K  +A +
Sbjct: 82  -DLFHKRWPSGGVVHIETIQDKVELALMYAGLHKAARAYVLYREERRKQREEQKASEAEN 140

Query: 246 HEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRY 305
                L  +     +++   AR++H +  D + V     L+  ++  F+ + L+ +Y   
Sbjct: 141 TIHITL-DDGATILLDQSWLARMVHSACSDLEGVDAVKILEETKNNLFDGVALKDVYKGL 199

Query: 306 FLHINGSRIEMPQAFFMRVAMGLALKETEKE 336
            +         P   +  V   L L +  +E
Sbjct: 200 VMTARTLVENEPNYTY--VTARLLLHDLYRE 228


>gi|29654844|ref|NP_820536.1| ribonucleotide-diphosphate reductase subunit alpha [Coxiella
           burnetii RSA 493]
 gi|161831609|ref|YP_001597388.1| ribonucleotide-diphosphate reductase subunit alpha [Coxiella
           burnetii RSA 331]
 gi|29542112|gb|AAO91050.1| ribonucleoside-diphosphate reductase alpha chain [Coxiella burnetii
           RSA 493]
 gi|161763476|gb|ABX79118.1| ribonucleoside-diphosphate reductase, alpha subunit [Coxiella
           burnetii RSA 331]
          Length = 941

 Score =  931 bits (2405), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/929 (59%), Positives = 686/929 (73%), Gaps = 18/929 (1%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
            ++V+KR+G V  +D ++I+ A+ KAF+AVEG+ A+ S RVQ+I+  LT+Q      +  
Sbjct: 29  QLRVVKRDGRVVKYDANRITIAMKKAFLAVEGETAAESGRVQEIVSRLTDQITDLFHKRW 88

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
            S   VHIE IQD+VE +LM +G HK  R YVLY     + R  Q   +  +     + I
Sbjct: 89  PSGGAVHIETIQDKVELALMYAGLHKAARAYVLY----REERRKQREEQKASEAENTIHI 144

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            +DDG  I  +   L  +V  ACS L+ V +  +L ET  N++DG++  D+   L+ ++R
Sbjct: 145 TLDDGATILLDQSWLARMVHSACSDLEGVDAVKILEETKNNLFDGVALKDVYKGLVMTAR 204

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           TL+E EPNY  VTAR LL  L REVL  +   PQ   H ++   YPE F  +I  G++  
Sbjct: 205 TLVENEPNYTYVTARLLLHDLYREVLNGLN-LPQDLMHEDIAHYYPEAFKNFIRHGIETE 263

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
            LH ++  FDL YLA  LK ERD  F YL LQ LYDRY +H    RIE+PQ FFMRVAMG
Sbjct: 264 HLHPNLQTFDLNYLAQALKPERDQQFTYLSLQTLYDRYLIHHQQVRIELPQVFFMRVAMG 323

Query: 328 LALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           LA  E   + +RAVEFYN+LSSF FM STPTLFNSGT  PQLSSCFLTTVPD L GI+GA
Sbjct: 324 LAQSEGEARNQRAVEFYNVLSSFDFMSSTPTLFNSGTVFPQLSSCFLTTVPDSLDGIYGA 383

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           L++NA+L+KY+GGLGNDWTPVR +GA+I GTNGKS GV+PFL VA+ TA+AVNQGGKRKG
Sbjct: 384 LKDNALLSKYAGGLGNDWTPVRAMGAYIKGTNGKSLGVVPFLNVADATAIAVNQGGKRKG 443

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV ++  WTLFSPDE
Sbjct: 444 AVCAYLETWHMDIEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVFEDGQWTLFSPDE 503

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
           V DLHD +G+ FEIAY  YE +A RGEI+  + ISA++LWRK+L+MLFETGHPW+TFKD 
Sbjct: 504 VPDLHDKFGEAFEIAYVAYEEKAHRGEIR-SKTISALSLWRKILSMLFETGHPWVTFKDA 562

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           CNIRSPQQHVGV+HSSNLCTEITLN+S EE AVCNLGSINL+ H  + + D +KLA T +
Sbjct: 563 CNIRSPQQHVGVIHSSNLCTEITLNTSREEIAVCNLGSINLVNHMKDGKLDTEKLARTTK 622

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TA+R+LDNVIDIN +++ +A+ SN  HR IGLGLMGFQ AL+L +IPYAS  AV+ AD+S
Sbjct: 623 TAIRMLDNVIDINYYSVPQARTSNLKHRPIGLGLMGFQDALYLQNIPYASEAAVQFADQS 682

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLP 745
           ME IS++AI AS+ELA+ERG Y +F  SLW QG+ PIDSI LL + R      N    L 
Sbjct: 683 METISYYAIQASMELAKERGPYETFNNSLWSQGILPIDSIQLLKKSRGKYFEQNTDQTLD 742

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W+ L+K+V   GMRNSN MAIAPTATI+NICG+SQSI+P+YQNL+VKSN+SG+FTV+N +
Sbjct: 743 WNALRKQVVAHGMRNSNVMAIAPTATISNICGISQSIEPTYQNLFVKSNLSGEFTVINPY 802

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV ELK R LWD  M+ DLKY++GS+  I+RIP +LKK++ATAFE++P WL+E+ASRRQK
Sbjct: 803 LVRELKSRQLWDNVMVHDLKYYNGSVQKIDRIPAELKKLYATAFEVEPRWLVEAASRRQK 862

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+ EPSGKKLD +YR AWL GLKTTYYLRS  AT  EK+T+   D  LNA
Sbjct: 863 WIDQAQSLNLYMAEPSGKKLDVLYRMAWLRGLKTTYYLRSMGATGTEKATIH--DTTLNA 920

Query: 926 VPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           V   +  +        +    D +CE CQ
Sbjct: 921 VTGQNNPN--------ACAIDDPDCEACQ 941



 Score = 37.9 bits (86), Expect = 9.4,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 83/211 (39%), Gaps = 17/211 (8%)

Query: 138 DAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIV--LSETYKNMYDGLSE 195
           +A    +L+++  DG ++ +++ R+ + +++A   ++  ++     + E    + D ++ 
Sbjct: 23  EAIQPGQLRVVKRDGRVVKYDANRITIAMKKAFLAVEGETAAESGRVQEIVSRLTDQIT- 81

Query: 196 SDLETAL--------IFSSRTLIEKEPNYAKV--TARFLLEKLRREVLTTVYKKPQKATH 245
            DL            I + +  +E    YA +   AR  +            +K  +A +
Sbjct: 82  -DLFHKRWPSGGAVHIETIQDKVELALMYAGLHKAARAYVLYREERRKQREEQKASEAEN 140

Query: 246 HEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRY 305
                L  +     +++   AR++H +  D + V     L+  ++  F+ + L+ +Y   
Sbjct: 141 TIHITL-DDGATILLDQSWLARMVHSACSDLEGVDAVKILEETKNNLFDGVALKDVYKGL 199

Query: 306 FLHINGSRIEMPQAFFMRVAMGLALKETEKE 336
            +         P   +  V   L L +  +E
Sbjct: 200 VMTARTLVENEPNYTY--VTARLLLHDLYRE 228


>gi|153208311|ref|ZP_01946690.1| ribonucleoside-diphosphate reductase, alpha subunit [Coxiella
           burnetii 'MSU Goat Q177']
 gi|154706203|ref|YP_001423854.1| ribonucleotide-diphosphate reductase subunit alpha [Coxiella
           burnetii Dugway 5J108-111]
 gi|165919213|ref|ZP_02219299.1| ribonucleoside-diphosphate reductase, alpha subunit [Coxiella
           burnetii RSA 334]
 gi|212219267|ref|YP_002306054.1| ribonucleotide-diphosphate reductase subunit alpha [Coxiella
           burnetii CbuK_Q154]
 gi|120576095|gb|EAX32719.1| ribonucleoside-diphosphate reductase, alpha subunit [Coxiella
           burnetii 'MSU Goat Q177']
 gi|154355489|gb|ABS76951.1| ribonucleoside-diphosphate reductase alpha chain [Coxiella burnetii
           Dugway 5J108-111]
 gi|165917074|gb|EDR35678.1| ribonucleoside-diphosphate reductase, alpha subunit [Coxiella
           burnetii RSA 334]
 gi|212013529|gb|ACJ20909.1| ribonucleoside-diphosphate reductase alpha chain [Coxiella burnetii
           CbuK_Q154]
          Length = 941

 Score =  930 bits (2403), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/929 (59%), Positives = 686/929 (73%), Gaps = 18/929 (1%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
            ++V+KR+G V  +D ++I+ A+ KAF+AVEG+ A+ S RVQ+I+  LT+Q      +  
Sbjct: 29  QLRVVKRDGRVVKYDANRITIAMKKAFLAVEGETAAESGRVQEIVSRLTDQITDLFHKRW 88

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
            S   VHIE IQD+VE +LM +G HK  R YVLY     + R  Q   +  +     + I
Sbjct: 89  PSGGAVHIETIQDKVELALMYAGLHKAARAYVLY----REERRKQREEQKASEAENTIHI 144

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            +DDG  I  +   L  +V  ACS L+ V +  +L ET  N++DG++  D+   L+ ++R
Sbjct: 145 TLDDGATILLDQSWLARMVHSACSDLEGVDAVKILEETKNNLFDGVALKDVYKGLVMTAR 204

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           TL+E EPNY  VTAR LL  L REVL  +   PQ   H ++   YPE F  +I  G++  
Sbjct: 205 TLVENEPNYTYVTARLLLHDLYREVLNGLN-LPQDLMHEDIAHYYPEAFKNFIRHGIETE 263

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
            LH ++  FDL YLA  LK ERD  F YL LQ LYDRY +H    RIE+PQ FFMRVAMG
Sbjct: 264 HLHPNLQTFDLNYLAQALKPERDQQFTYLSLQTLYDRYLIHHQQVRIELPQVFFMRVAMG 323

Query: 328 LALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           LA  E   + +RAVEFYN+LSSF FM STPTLFNSGT  PQLSSCFLTTVPD L GI+GA
Sbjct: 324 LAQSEGEARNERAVEFYNVLSSFDFMSSTPTLFNSGTVFPQLSSCFLTTVPDSLDGIYGA 383

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           L++NA+L+KY+GGLGNDWTPVR +GA+I GTNGKS GV+PFL VA+ TA+AVNQGGKRKG
Sbjct: 384 LKDNALLSKYAGGLGNDWTPVRAMGAYIKGTNGKSLGVVPFLNVADATAIAVNQGGKRKG 443

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV ++  WTLFSPDE
Sbjct: 444 AVCAYLETWHMDIEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVFEDGQWTLFSPDE 503

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
           V DLHD +G+ FEIAY  YE +A RGEI+  + ISA++LWRK+L+MLFETGHPW+TFKD 
Sbjct: 504 VPDLHDKFGEAFEIAYVAYEEKAHRGEIR-SKTISALSLWRKILSMLFETGHPWVTFKDA 562

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           CNIRSPQQHVGV+HSSNLCTEITLN+S EE AVCNLGSINL+ H  + + D +KLA T +
Sbjct: 563 CNIRSPQQHVGVIHSSNLCTEITLNTSREEIAVCNLGSINLVNHMKDGKLDTEKLARTTK 622

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TA+R+LDNVIDIN +++ +A+ SN  HR IGLGLMGFQ AL+L +IPYAS  AV+ AD+S
Sbjct: 623 TAIRMLDNVIDINYYSVPQARTSNLKHRPIGLGLMGFQDALYLQNIPYASEAAVQFADQS 682

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLP 745
           ME IS++AI AS+ELA+ERG Y +F  SLW QG+ PIDSI LL + R      N    L 
Sbjct: 683 METISYYAIQASMELAKERGPYETFNNSLWSQGILPIDSIQLLKKSRGKYFEQNTDQTLD 742

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W+ L+K+V   GMRNSN MAIAPTATI+NICG+SQSI+P+YQNL+VKSN+SG+FTV+N +
Sbjct: 743 WNALRKQVVAHGMRNSNVMAIAPTATISNICGISQSIEPTYQNLFVKSNLSGEFTVINPY 802

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV ELK R LWD  M+ DLKY++GS+  I+RIP +LKK++ATAFE++P WL+E+ASRRQK
Sbjct: 803 LVRELKSRQLWDNVMVHDLKYYNGSVQKIDRIPAELKKLYATAFEVEPRWLVEAASRRQK 862

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+ EPSGKKLD +YR AWL GLKTTYYLRS  AT  EK+T+   D  LNA
Sbjct: 863 WIDQAQSLNLYMAEPSGKKLDVLYRMAWLRGLKTTYYLRSMGATGTEKATIH--DTTLNA 920

Query: 926 VPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           V   +  +        +    D +CE CQ
Sbjct: 921 VTGQNNPN--------ACAIDDPDCEACQ 941



 Score = 37.9 bits (86), Expect = 9.4,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 83/211 (39%), Gaps = 17/211 (8%)

Query: 138 DAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIV--LSETYKNMYDGLSE 195
           +A    +L+++  DG ++ +++ R+ + +++A   ++  ++     + E    + D ++ 
Sbjct: 23  EAIQPGQLRVVKRDGRVVKYDANRITIAMKKAFLAVEGETAAESGRVQEIVSRLTDQIT- 81

Query: 196 SDLETAL--------IFSSRTLIEKEPNYAKV--TARFLLEKLRREVLTTVYKKPQKATH 245
            DL            I + +  +E    YA +   AR  +            +K  +A +
Sbjct: 82  -DLFHKRWPSGGAVHIETIQDKVELALMYAGLHKAARAYVLYREERRKQREEQKASEAEN 140

Query: 246 HEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRY 305
                L  +     +++   AR++H +  D + V     L+  ++  F+ + L+ +Y   
Sbjct: 141 TIHITL-DDGATILLDQSWLARMVHSACSDLEGVDAVKILEETKNNLFDGVALKDVYKGL 199

Query: 306 FLHINGSRIEMPQAFFMRVAMGLALKETEKE 336
            +         P   +  V   L L +  +E
Sbjct: 200 VMTARTLVENEPNYTY--VTARLLLHDLYRE 228


>gi|198284353|ref|YP_002220674.1| ribonucleoside-diphosphate reductase subunit alpha
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665782|ref|YP_002427015.1| ribonucleotide-diphosphate reductase, alpha subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248874|gb|ACH84467.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517995|gb|ACK78581.1| ribonucleotide-diphosphate reductase, alpha subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 948

 Score =  927 bits (2395), Expect = 0.0,   Method: Composition-based stats.
 Identities = 548/972 (56%), Positives = 689/972 (70%), Gaps = 45/972 (4%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P+     G+    PS A          +VI+RN  + +FD SKI  A+ KAF+AVEG  
Sbjct: 3   KPTTQAVIGNPAYDPSEASH-------YKVIRRNNAMVNFDASKIHIAVTKAFLAVEGGS 55

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+D++  LTEQ +  L +        HIEDIQDQVE +LM++G H++ R YVLY
Sbjct: 56  GAASARVRDLVSRLTEQVIEALKRRQPGGGTFHIEDIQDQVELALMRAGEHEVARAYVLY 115

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKI 180
             E       Q  +       P +++   +G+  + +  RL  +++EACSGL   VS   
Sbjct: 116 -REERARERRQQAAAETPADVPVIRVSYPNGSQRALDMVRLRAVIDEACSGLGTAVSIDA 174

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +L  T KN+YDG+SE +L  A I +SR LIE++P YA  +AR LL+++R EVL       
Sbjct: 175 ILGNTVKNLYDGISEDELFQAPILASRVLIERDPAYAYASARLLLDRVRWEVLG------ 228

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           + AT  EM   YP+YF  Y++ G++  L+   +  +DL  +   L+ ERD  F+YLG+QI
Sbjct: 229 EAATQAEMTARYPQYFRDYLQTGIQNELIDPRLGQYDLERITAALRPERDLDFQYLGMQI 288

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLH+   RIE+PQAF+MRVAMGLA+ E ++E  A+ FY +LSSF F+ STPTLFN
Sbjct: 289 LYDRYFLHVRERRIELPQAFWMRVAMGLAMNEVDRETHAIAFYEVLSSFDFVSSTPTLFN 348

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           +GT  PQLSSCFLTTV DDL  I+ A++ENAML+K+SGGLGNDWTPVR LG+ I GTNGK
Sbjct: 349 AGTLRPQLSSCFLTTVGDDLDDIYEAIKENAMLSKFSGGLGNDWTPVRALGSFIKGTNGK 408

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 409 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMN 468

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFM+RV  NA WTLFSP+E  DLHDL G  F   YE+YER AD G I++F++I
Sbjct: 469 TANWIPDLFMERVENNAMWTLFSPNETPDLHDLTGSAFRERYEHYERMADAGGIELFKRI 528

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A+ LWRKMLTMLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN++++E AVC
Sbjct: 529 PAIHLWRKMLTMLFETGHPWITFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNAKEIAVC 588

Query: 601 NLGSINLLAHFANN-----------------QFDYDKLASTIRTAVRVLDNVIDINCHTI 643
           NLGS+NL++H                       D +KL  TIR A+R+LDNVID+N + +
Sbjct: 589 NLGSVNLVSHLRAVADAGALREDSTPEELLAMMDGEKLHHTIRVAMRMLDNVIDMNYYAV 648

Query: 644 EKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQ 703
            KA+ SN  HR +GLGLMGF  AL  + IPYAS  A+  AD S E IS+HAI AS +LA+
Sbjct: 649 AKARNSNLRHRPVGLGLMGFSDALLQMRIPYASAAALAFADISQEVISYHAIDASADLAR 708

Query: 704 ERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWDELKKRVKTIGMRNSN 762
           ERG+Y SF GSLW QG+ PIDSI LLA  R+  + ++R+  L W  L+ +V+  GMRNSN
Sbjct: 709 ERGSYQSFPGSLWSQGILPIDSIDLLAAGREHGVDVDRSQHLDWATLRSKVRG-GMRNSN 767

Query: 763 CMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMIS 822
           C+AIAPTATI+NI GVSQ I+P YQNLYVKSN+SG+FTVVNS+LV++LK+ +LWDE M++
Sbjct: 768 CLAIAPTATISNIVGVSQGIEPIYQNLYVKSNLSGEFTVVNSYLVHDLKRLELWDEVMVN 827

Query: 823 DLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSG 882
           DLKY DGS+  ++RIP  +K ++A AFE DP WL+E+A+RRQKW+DQAQSLNLY  +PSG
Sbjct: 828 DLKYFDGSVMPVDRIPASIKPLYANAFETDPEWLVEAAARRQKWLDQAQSLNLYFGQPSG 887

Query: 883 KKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPS 942
           KK+D IYR AW  GLKTTYYLRS  AT+ EKST++   G LNAV    P +         
Sbjct: 888 KKIDEIYRLAWKRGLKTTYYLRSLGATAAEKSTVQ--TGTLNAVVSGQPKA--------- 936

Query: 943 SCTSDTECEVCQ 954
               D  CE CQ
Sbjct: 937 CAIDDPTCEACQ 948


>gi|169634185|ref|YP_001707921.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii SDF]
 gi|169152977|emb|CAP02025.1| ribonucleoside diphosphate reductase, alpha subunit [Acinetobacter
           baumannii]
          Length = 943

 Score =  925 bits (2391), Expect = 0.0,   Method: Composition-based stats.
 Identities = 534/961 (55%), Positives = 687/961 (71%), Gaps = 42/961 (4%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           S+    P +I   QVIKR G V +FD  KIS AI KAF+AVEG+ ++ S R+ D I  LT
Sbjct: 2   SVITSTPGQI---QVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSADSSRIHDRITQLT 58

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           E  +    +   S   +HIE+IQDQVE +LM++G HK+ R YV+YR++R+  R   + + 
Sbjct: 59  EMVLNTFTRRLPSGGTIHIEEIQDQVELALMRTGEHKVARAYVIYRDQRASARKDTNSNH 118

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
                 P L++   +G L   +   L+  V  A  GL+ +  + ++ ET KN+Y+G+ ES
Sbjct: 119 -----HPTLQVTDANGQLQPLDLSALQATVNRAAEGLEGIDVQAIIDETVKNLYNGVKES 173

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           D+ T ++ ++RT IE+EPNY  VTAR L ++L    L  +      A +           
Sbjct: 174 DIATTMMMATRTRIEQEPNYTYVTARLLRDELVSTGLAFLGLPADTAEN--------NAL 225

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             ++++GV+  LL   ++ FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+
Sbjct: 226 EAFLKKGVELDLLSPDLLKFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFEL 285

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRV+MGLAL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+
Sbjct: 286 PQLFFMRVSMGLALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTI 345

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDLY I+GA+++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAV
Sbjct: 346 GDDLYDIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAV 405

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++
Sbjct: 406 AVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFED 465

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLF+P E  DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFET
Sbjct: 466 GEWTLFTPSETPDLHDLTGAEFAERYAYYESVAKEQNM-LHKKVRAKDLWRKMLSMLFET 524

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      
Sbjct: 525 GHPWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVKGGVL 584

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D +KLA T++TAVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + + Y S
Sbjct: 585 DREKLARTVKTAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGMAYGS 644

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE- 735
            EAV+ ADESME IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E 
Sbjct: 645 DEAVKFADESMEVISYYAIQTSSDLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPER 704

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
              ++RT RL WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN
Sbjct: 705 MFEVDRTQRLDWDSLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSN 764

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTV+N  LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++P 
Sbjct: 765 LSGEFTVINPCLVRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVEPR 824

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           W++++ASRRQKWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKS
Sbjct: 825 WIVDAASRRQKWIDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKS 884

Query: 915 TLKGVDGKLNAVPVTDPNSSTH--------------------SLGIPSSCTSD-TECEVC 953
           T+    G LNAV      ++                      +  +P +C+ D  +CE C
Sbjct: 885 TIN--TGALNAVKPATVEAAPAVAPVVEAKKPEAVEEDGFTQAAPVPMACSIDNPDCEAC 942

Query: 954 Q 954
           Q
Sbjct: 943 Q 943


>gi|169797063|ref|YP_001714856.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii AYE]
 gi|184157024|ref|YP_001845363.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii ACICU]
 gi|213156531|ref|YP_002318192.1| ribonucleoside-diphosphate reductase alpha subunit [Acinetobacter
           baumannii AB0057]
 gi|215484524|ref|YP_002326759.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii AB307-0294]
 gi|239501300|ref|ZP_04660610.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii AB900]
 gi|260555645|ref|ZP_05827865.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii ATCC 19606]
 gi|301345631|ref|ZP_07226372.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii AB056]
 gi|301512782|ref|ZP_07238019.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii AB058]
 gi|301596293|ref|ZP_07241301.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii AB059]
 gi|332852153|ref|ZP_08433980.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii 6013150]
 gi|332867552|ref|ZP_08437705.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii 6013113]
 gi|332872598|ref|ZP_08440566.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii 6014059]
 gi|169149990|emb|CAM87884.1| ribonucleoside diphosphate reductase, alpha subunit [Acinetobacter
           baumannii AYE]
 gi|183208618|gb|ACC56016.1| Ribonucleotide reductase, alpha subunit [Acinetobacter baumannii
           ACICU]
 gi|193076531|gb|ABO11187.2| ribonucleoside diphosphate reductase alpha subunit [Acinetobacter
           baumannii ATCC 17978]
 gi|213055691|gb|ACJ40593.1| ribonucleoside-diphosphate reductase alpha subunit [Acinetobacter
           baumannii AB0057]
 gi|213986949|gb|ACJ57248.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii AB307-0294]
 gi|260410556|gb|EEX03854.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii ATCC 19606]
 gi|322506923|gb|ADX02377.1| nrdA [Acinetobacter baumannii 1656-2]
 gi|323516790|gb|ADX91171.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332729525|gb|EGJ60864.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii 6013150]
 gi|332733969|gb|EGJ65114.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii 6013113]
 gi|332739127|gb|EGJ69986.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii 6014059]
          Length = 944

 Score =  925 bits (2390), Expect = 0.0,   Method: Composition-based stats.
 Identities = 535/962 (55%), Positives = 688/962 (71%), Gaps = 43/962 (4%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           S+    P +I   QVIKR G V +FD  KIS AI KAF+AVEG+ ++ S R+ D I  LT
Sbjct: 2   SVITSTPGQI---QVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSADSSRIHDRITQLT 58

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           E  +    +   S   +HIE+IQDQVE +LM++G HK+ R YV+YR++R+  R   + + 
Sbjct: 59  EMVLNTFTRRLPSGGTIHIEEIQDQVELALMRTGEHKVARAYVIYRDQRASARKDTNSNH 118

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
                 P L++   +G L   +   L+  V  A  GL+ +  + ++ ET KN+Y+G+ ES
Sbjct: 119 -----HPTLQVTDANGQLQPLDLSALQATVNRAAEGLEGIDVQAIIDETVKNLYNGVKES 173

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           D+ T ++ ++RT IE+EPNY  VTAR L ++L    L  +      A +           
Sbjct: 174 DIATTMMMATRTRIEQEPNYTYVTARLLRDELVSTGLAFLGLPADTAEN--------NAL 225

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             ++++GV+  LL   ++ FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+
Sbjct: 226 EAFLKKGVELDLLSPDLLKFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFEL 285

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRV+MGLAL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+
Sbjct: 286 PQLFFMRVSMGLALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTI 345

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDLY I+GA+++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAV
Sbjct: 346 GDDLYDIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAV 405

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++
Sbjct: 406 AVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFED 465

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLF+P E  DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFET
Sbjct: 466 GEWTLFTPSETPDLHDLTGAEFAERYAYYESVAKEQNM-LHKKVRAKDLWRKMLSMLFET 524

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      
Sbjct: 525 GHPWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVKGGVL 584

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D +KLA T++TAVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + + Y S
Sbjct: 585 DREKLARTVKTAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGMAYGS 644

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE- 735
            EAV  ADESME IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E 
Sbjct: 645 DEAVNFADESMEVISYYAIQTSSDLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPER 704

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
              ++RT RL WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN
Sbjct: 705 MFEVDRTQRLDWDSLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSN 764

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTV+N +LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++P 
Sbjct: 765 LSGEFTVINPYLVRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVEPR 824

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           W++++ASRRQKWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKS
Sbjct: 825 WIVDAASRRQKWIDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKS 884

Query: 915 TLKGVDGKLNAVP---------------------VTDPNSSTHSLGIPSSCTSD-TECEV 952
           T+    G LNAV                        + +  T +  +P +C+ D  +CE 
Sbjct: 885 TIN--TGALNAVKPATVEAAAPAAAPVVEAKKPEAVEEDGFTQAAPVPMACSIDNPDCEA 942

Query: 953 CQ 954
           CQ
Sbjct: 943 CQ 944


>gi|260551038|ref|ZP_05825243.1| ribonucleotide reductase [Acinetobacter sp. RUH2624]
 gi|260405986|gb|EEW99473.1| ribonucleotide reductase [Acinetobacter sp. RUH2624]
          Length = 944

 Score =  923 bits (2385), Expect = 0.0,   Method: Composition-based stats.
 Identities = 536/962 (55%), Positives = 686/962 (71%), Gaps = 43/962 (4%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           S+    P +I   QVIKR G V +FD  KIS AI KAF+AVEG+ +S S R+ D I  LT
Sbjct: 2   SVITSTPGQI---QVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSSDSSRIHDRITQLT 58

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           E  +    +   S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R   + + 
Sbjct: 59  EMVLNTFKRRLPSGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRASARQQTNSNH 118

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
                 P L++   +G L   +   L+  V  A  GL+ +  + ++ ET KN+Y+G+ ES
Sbjct: 119 -----HPTLQVTDANGQLQPLDLSALKATVNRAAEGLEGIEVEAIIDETVKNLYNGVKES 173

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           D+ T ++ ++RT IE+EPNY  VTAR L ++L    L  +      A +           
Sbjct: 174 DIATTMMMATRTRIEQEPNYTYVTARLLRDELVSTGLAFLGLPADTAEN--------NAL 225

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             ++++GV+  LL   ++ FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+
Sbjct: 226 EAFLKKGVELDLLSPDLLKFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFEL 285

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRV+MGLAL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+
Sbjct: 286 PQLFFMRVSMGLALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTI 345

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDLY I+GA+++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAV
Sbjct: 346 GDDLYDIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAV 405

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++
Sbjct: 406 AVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFED 465

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLF+P E  DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFET
Sbjct: 466 GEWTLFTPSETPDLHDLTGAEFAERYAYYESVAKEQNM-LHKKVRAKDLWRKMLSMLFET 524

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      
Sbjct: 525 GHPWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVRGGVL 584

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D +KLA T++TAVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + + Y S
Sbjct: 585 DREKLARTVKTAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGMAYGS 644

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE- 735
            EAV  ADESME IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E 
Sbjct: 645 DEAVNFADESMEVISYYAIQTSSDLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPER 704

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
              ++RT RL WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN
Sbjct: 705 MFEVDRTQRLDWDTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSN 764

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTV+N +LV  LK R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++P 
Sbjct: 765 LSGEFTVINPYLVRALKDRGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVEPR 824

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           W++++ASRRQKWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKS
Sbjct: 825 WIVDAASRRQKWIDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKS 884

Query: 915 TLKGVDGKLNAVP---------------------VTDPNSSTHSLGIPSSCTSD-TECEV 952
           T+    G LNAV                        + +  T +  +P +C+ D  +CE 
Sbjct: 885 TIN--TGALNAVKPATVEAAAPAAAPVVEAKKPEAVEEDGFTQAAPVPMACSIDNPDCEA 942

Query: 953 CQ 954
           CQ
Sbjct: 943 CQ 944


>gi|126664353|ref|ZP_01735337.1| Ribonucleotide reductase, alpha subunit [Marinobacter sp. ELB17]
 gi|126630679|gb|EBA01293.1| Ribonucleotide reductase, alpha subunit [Marinobacter sp. ELB17]
          Length = 929

 Score =  920 bits (2378), Expect = 0.0,   Method: Composition-based stats.
 Identities = 516/929 (55%), Positives = 665/929 (71%), Gaps = 29/929 (3%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKRNG + +F PSKI  A+ KAF+AVEG  A+ S R+ D +  +T+Q V  + +  K
Sbjct: 27  LQVIKRNGNLVNFTPSKIGVAVTKAFLAVEGDQAAGSARINDAVHRVTDQVVQAISRRLK 86

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           +   VHIEDIQDQVE +LM++   K+ R YVLYREE +  RA            P L + 
Sbjct: 87  AGGKVHIEDIQDQVELALMRAEEQKVARAYVLYREEHARERA----LHEPVEAHPTLTVK 142

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              G  +  +   ++  V+ A  GL  + ++ ++ E+ +N+Y+G+ E+++ +ALI ++R 
Sbjct: 143 QAGGRTVPLDLGLMKQQVDNAAFGLDGIDAESLVEESIRNLYNGIDEAEVLSALIMTARG 202

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EP+Y+ VTAR LLE+    +        +  T   +  +YP+    +I  G++  L
Sbjct: 203 RIEREPDYSAVTARLLLEQ----LRLESVTALKLDTSLSLADVYPQALSTFINAGIRYEL 258

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L E+M  FD+  L   LK ERD  F +LGLQ LYDRYFLH    R+E+PQ FFMRVAMGL
Sbjct: 259 LDEAMAAFDMERLGAALKPERDLQFGFLGLQTLYDRYFLHWKEDRLELPQVFFMRVAMGL 318

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L+E +   RA+EFY+LLSSF +M STPTLFNSGTRH QLSSC+LTTV DDL  I+G+++
Sbjct: 319 SLREDDPNSRAIEFYDLLSSFDYMSSTPTLFNSGTRHSQLSSCYLTTVDDDLEAIYGSIR 378

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR +GA I GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 379 DNAMLSKWAGGLGNDWTPVRAMGARIKGTNGQSQGVVPFLKVVNDTAVAVNQGGKRKGAV 438

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE+WH+D+EEFL+LRKNTGD+RRRTHDMNTANW+PDL ++R+ Q+  WTLFSP++  
Sbjct: 439 CAYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWVPDLLIERMRQDRDWTLFSPNDAP 498

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDLYG  F   Y++YE  A  G+I++F+ I A  LWRKMLT+LFETGHPWITFKDPCN
Sbjct: 499 DLHDLYGNAFRERYQHYEALAAEGKIELFKTIPAKQLWRKMLTVLFETGHPWITFKDPCN 558

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGS+NL AH  N + D  +L  T+ TA
Sbjct: 559 LRSPQQHKGVVHSSNLCTEITLNTSADEIAVCNLGSVNLAAHINNGELDVKRLERTVDTA 618

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +A+ SN  HR +GLGLMGFQ AL+ L + Y SP+AVE AD +ME
Sbjct: 619 VRMLDNVIDINFYAVPQARNSNLKHRPVGLGLMGFQDALYALRLSYTSPQAVEFADVAME 678

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DELAMNRTSRLPW 746
            +S+ AI AS  LA ERGAY S++GSLW Q + PIDSI  L   R   +L++N  SRL W
Sbjct: 679 QLSYFAIRASARLAAERGAYESYEGSLWSQKILPIDSIERLKAARLEGDLSVNTDSRLDW 738

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
             ++  +   GMRNSN MAIAPTATI+NI GVSQSI+P+YQNL+VKSN+SG+FTVVN  L
Sbjct: 739 APVRDLIAKHGMRNSNVMAIAPTATISNIVGVSQSIEPAYQNLFVKSNLSGEFTVVNPSL 798

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V +LK   LWD  M++DLKY+DGS+  IERIP +LK  +ATAFEID  WL+E+ASRRQKW
Sbjct: 799 VRDLKAEGLWDNVMVNDLKYYDGSVQQIERIPTELKSRYATAFEIDARWLVEAASRRQKW 858

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           +DQ QSLNLY+ +PSGKKLD +Y+ AW  GLKTTYYLRS  AT                 
Sbjct: 859 LDQGQSLNLYMAQPSGKKLDELYQLAWERGLKTTYYLRSLGATGA--------------- 903

Query: 927 PVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
              +  ++T +   P  C+ D  +CE CQ
Sbjct: 904 ---NEQAATVAAPQPQVCSIDEPDCEACQ 929


>gi|262369329|ref|ZP_06062657.1| ribonucleoside-diphosphate reductase alpha subunit [Acinetobacter
           johnsonii SH046]
 gi|262315397|gb|EEY96436.1| ribonucleoside-diphosphate reductase alpha subunit [Acinetobacter
           johnsonii SH046]
          Length = 943

 Score =  920 bits (2376), Expect = 0.0,   Method: Composition-based stats.
 Identities = 532/959 (55%), Positives = 690/959 (71%), Gaps = 38/959 (3%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           S++   P +I   QVIKR G V SFD  KIS AI KAF+AVEG+ ++ S R+ D I  LT
Sbjct: 2   SVSNSTPGQI---QVIKRTGDVASFDAEKISVAIGKAFLAVEGQQSADSSRIHDRISQLT 58

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           E  +    +   S   +HIE+IQDQVE +LM++G  K+ R YV+YR++R+D R     + 
Sbjct: 59  EMVLNTFSRRLPSGGTIHIEEIQDQVELALMRTGEQKVARAYVIYRDQRADARKQAGENH 118

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
                 P L+I   +G L   + ++LE  V +A  GL+ ++ + ++ ET KN+Y+G+  S
Sbjct: 119 -----HPTLQITDANGQLQPLDMRKLEATVTKAAEGLEGINVQAIIDETIKNLYNGVKAS 173

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           D+ T ++ ++RT IE+EPNY  VTAR L ++L    LT +      A    ++       
Sbjct: 174 DIATTMMMATRTRIEQEPNYTYVTARLLRDELVATGLTFLGLSEDTAEGDALET------ 227

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             ++++G++  LL   +++FDL  LA  ++ ER   F YLGLQ L+DRYF+H +G R E+
Sbjct: 228 --FLKKGIELDLLSPELLNFDLAKLAAAIQPERSNQFTYLGLQTLFDRYFIHSDGVRFEL 285

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRV+MGL+L E  +E+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+
Sbjct: 286 PQLFFMRVSMGLSLNEANREERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTI 345

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDLY I+GA+++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAV
Sbjct: 346 DDDLYDIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAV 405

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++
Sbjct: 406 AVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFED 465

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
           A WTLF+P E  DLHDL G EF   Y +YE  A    + + +KI A  LWRKML+MLFET
Sbjct: 466 AEWTLFTPSETPDLHDLMGAEFAERYAHYEAIAKETNM-LHKKIRAKDLWRKMLSMLFET 524

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGSINL+ H      
Sbjct: 525 GHPWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTSKDEIAVCNLGSINLVQHVQGGVL 584

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D +KLA T++TAVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + + Y S
Sbjct: 585 DREKLARTVKTAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMQLAYGS 644

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE- 735
             AV+ ADESME IS++AIS S +LA ERG Y +FKGSLWDQG+ PIDS+ L+A+ R E 
Sbjct: 645 DAAVDFADESMEVISYYAISTSSDLAVERGTYETFKGSLWDQGILPIDSLDLVAKTRPER 704

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
              ++RT RL WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN
Sbjct: 705 MFEVDRTQRLDWDTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSN 764

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTV+N +LV  LK R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++P 
Sbjct: 765 LSGEFTVINPYLVRALKDRGLWDSVMVNDLKHFEGSVQKISRIPEELKAIFATAFEVEPR 824

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           W++++ASRRQKWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKS
Sbjct: 825 WIVDAASRRQKWIDQAQSLNLYISGANGKKLDLTYKMAWLRGLKTTYYLRALGATSAEKS 884

Query: 915 TLKG------------------VDGKLNAVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
           T+                    V  ++    V +      +  +P +C+ D  +CE CQ
Sbjct: 885 TINTGALNAVKPATVTAAPVAAVAQEVKPEVVAEDEGFGQAAPVPMACSIDNPDCEACQ 943


>gi|256377254|ref|YP_003100914.1| ribonucleoside-diphosphate reductase, alpha subunit [Actinosynnema
           mirum DSM 43827]
 gi|255921557|gb|ACU37068.1| ribonucleoside-diphosphate reductase, alpha subunit [Actinosynnema
           mirum DSM 43827]
          Length = 950

 Score =  919 bits (2374), Expect = 0.0,   Method: Composition-based stats.
 Identities = 570/958 (59%), Positives = 706/958 (73%), Gaps = 26/958 (2%)

Query: 15  FPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKN 74
            P+   P       V+V++R+G V++FD +K+S A+ KAF+AVEG GA  S R+  +++ 
Sbjct: 1   MPTTTTPAAVAKAPVRVVRRDGAVSAFDATKVSVAMTKAFLAVEGDGAVASSRLHPLVEE 60

Query: 75  LTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSH 134
           LT Q    LL+H +  + +H+E IQDQVE  LM+ GHH + R YVLYREER+ VR     
Sbjct: 61  LTGQVEAALLKHVRPDVALHVEQIQDQVELVLMRGGHHAVARAYVLYREERAKVR----- 115

Query: 135 SKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLS 194
           + + +  AP +++   DG +   +  R+  +V EAC+GL DVS+  VL+ET +N+YDG++
Sbjct: 116 AATASAPAPTIRVTHPDGQVTPLDWDRVAAVVAEACAGLTDVSADTVLAETRRNLYDGIT 175

Query: 195 ESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPE 254
             +L TA I ++RTL+E EP+Y+  +AR LL+KLRRE L+ V  +P +AT  +M   Y +
Sbjct: 176 VDELATAQIMAARTLVETEPDYSFASARLLLDKLRREALSHVAGEPVEATGEQMS--YVD 233

Query: 255 YFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRI 314
           YF  Y+E GV    L   +  FDL  LA  ++ ERD AF++LG+Q LYDRYFLH +G R 
Sbjct: 234 YFPAYVELGVSVDRLDPELRTFDLPRLAAAIRPERDLAFDFLGMQTLYDRYFLHDDGVRY 293

Query: 315 EMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLT 374
           E+PQAFFMRVAMGLAL+E ++E RA+EFY LLSSF FMCSTPTLFNSGT  PQLSSCFLT
Sbjct: 294 ELPQAFFMRVAMGLALREDDREARAIEFYGLLSSFDFMCSTPTLFNSGTTRPQLSSCFLT 353

Query: 375 TVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDT 434
           TV DDL  IF   + NA+LAKYSGGLGNDWTPVRG+GAHI GTNG+SQGV+PFLK+ANDT
Sbjct: 354 TVDDDLDAIFRGYRNNALLAKYSGGLGNDWTPVRGMGAHIKGTNGQSQGVVPFLKIANDT 413

Query: 435 AVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVT 494
           AVAVNQGGKRKGA CAYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTANW+PD F++RV 
Sbjct: 414 AVAVNQGGKRKGAACAYLETWHVDVEEFLELRKNTGDDRRRTHDMNTANWVPDEFLRRVE 473

Query: 495 QNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLF 554
            +A WTLFSPDE  DLH+LYG  F   Y  YE  ADRGEI+V R++ AV LWR+MLT+LF
Sbjct: 474 ADAEWTLFSPDETPDLHELYGTAFAQRYRAYEEAADRGEIRVHRRVRAVDLWRRMLTVLF 533

Query: 555 ETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN 614
           ETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGSINL  H    
Sbjct: 534 ETGHPWITFKDPCNVRSPQQHAGVVHSSNLCTEITLNTSADEVAVCNLGSINLANHVTPT 593

Query: 615 QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPY 674
             D D+LA T RTAVR+LDNVIDIN +TI +A++SN  HR +GLGLMGF  +L +  IPY
Sbjct: 594 GLDRDRLARTTRTAVRMLDNVIDINFYTIPEARRSNLRHRPVGLGLMGFADSLFVQRIPY 653

Query: 675 ASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD 734
           AS EAVE AD SME ISFHA+ AS +LA ERG+Y SF+GSLW +GV PIDSI LLA+ R 
Sbjct: 654 ASSEAVEFADLSMELISFHALDASADLAAERGSYESFEGSLWSRGVLPIDSIALLADARG 713

Query: 735 -ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS 793
             L M+ +S L W  ++ + +  GMRNSN MAIAPTATI+NICGV QSI+P Y+NL+VK+
Sbjct: 714 GALDMDTSSTLDWSSVRDKARR-GMRNSNVMAIAPTATISNICGVGQSIEPLYRNLFVKA 772

Query: 794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDP 853
           NMSGDFTV+N  LV +LK R LWD AM+SDLKY DG++  ++R+P +LK ++ATAFE+  
Sbjct: 773 NMSGDFTVLNRHLVADLKARGLWDAAMVSDLKYFDGALTAVDRVPAELKALYATAFELSS 832

Query: 854 MWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK 913
            WL+E+ASRRQKWIDQAQSLNLYL  PSG+ LD +YR AW  GLKTTYYLRS SAT VEK
Sbjct: 833 DWLVEAASRRQKWIDQAQSLNLYLAAPSGRALDELYRLAWRKGLKTTYYLRSASATHVEK 892

Query: 914 STLKGVDGKLNAVPVTDPNSSTH-----------------SLGIPSSCTSDTECEVCQ 954
           STL+G DGKL  V +    +                         +   +D +CE CQ
Sbjct: 893 STLRGTDGKLTGVTLPPAAAPAARPAASSPSPAPVPELVLPAEGAACSITDPDCEACQ 950


>gi|262373380|ref|ZP_06066659.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           junii SH205]
 gi|262313405|gb|EEY94490.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           junii SH205]
          Length = 944

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 532/951 (55%), Positives = 682/951 (71%), Gaps = 40/951 (4%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
            +QVIKR G + +F+  KIS AI KAF+AVEG+  + S R+ D I  LTE  +    +  
Sbjct: 10  QLQVIKRTGEIATFNAEKISVAIGKAFLAVEGQQGADSSRIHDRISQLTEMVMNTFKRRL 69

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
            S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R     +       P L+I
Sbjct: 70  PSGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRATARQQTGANH-----HPTLQI 124

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
              +G L   +   L   +E A  GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++R
Sbjct: 125 TDHNGQLQPLDLDALTATIETASEGLEGIDVQAIVDETVKNLYNGVKESDIATTMMMATR 184

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T IE+EPNY  VTAR L  +L    L  +      + +  ++         ++++G++  
Sbjct: 185 TRIEQEPNYTYVTARLLCNELVGTGLEFLGLSTDTSENDALEP--------FLKKGIELD 236

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +++FDL  L+  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MG
Sbjct: 237 LLSPDLLNFDLAKLSAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMG 296

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E  KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA+
Sbjct: 297 LALNEENKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAM 356

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGA
Sbjct: 357 RDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGA 416

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++A WTLF+P E 
Sbjct: 417 VCAYLETWHLDVEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDAEWTLFTPSET 476

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDL G EF   Y +YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD C
Sbjct: 477 PDLHDLTGAEFAERYTHYEAVAKEQNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVC 535

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGSINL+ H      D +KLA TI+T
Sbjct: 536 NLRSPQQHVGVVHSSNLCTEITLNTSQDEIAVCNLGSINLVQHVQGGVLDREKLARTIKT 595

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + I Y S  AV+ ADESM
Sbjct: 596 AVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGIAYGSDAAVDFADESM 655

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ L+A+ R E    ++RT RL 
Sbjct: 656 EVISYYAIQTSSDLALERGAYSTFKGSLWDQGILPIDSLELVAKSRPERMFEVDRTQRLD 715

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +
Sbjct: 716 WDSLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPY 775

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++  W++++ASRRQK
Sbjct: 776 LVRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVETRWIVDAASRRQK 835

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNA
Sbjct: 836 WIDQAQSLNLYIAGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNA 893

Query: 926 VPVTDPNSS---------------------THSLGIPSSCTSD-TECEVCQ 954
           V      +                      T +  +P +C+ D  +CE CQ
Sbjct: 894 VKPASVEAPVVAAQAVEEKKPEAQVEEDGFTTAAPVPMACSIDNPDCEACQ 944


>gi|294649453|ref|ZP_06726878.1| ribonucleoside-diphosphate reductase alpha subunit [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292824658|gb|EFF83436.1| ribonucleoside-diphosphate reductase alpha subunit [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 944

 Score =  918 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 532/951 (55%), Positives = 680/951 (71%), Gaps = 40/951 (4%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
            +QVIKR G + +F+  KIS AI KAF+AVEG+  + S R+ D I  LTE  +    +  
Sbjct: 10  QLQVIKRTGEIATFNAEKISVAIGKAFLAVEGQQGADSSRIHDRITQLTEMVMNTFNRRL 69

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
            S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R     +       P L+I
Sbjct: 70  PSGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRATARQQTGANH-----HPTLQI 124

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
               G L   +   L   +E A +GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++R
Sbjct: 125 TDAKGQLQPLDLDALTATIETASAGLEGIDVQAIVDETVKNLYNGVKESDVATTMMMATR 184

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T IE+EPNY  VTAR L  +L    L  +              L  +    ++++G++  
Sbjct: 185 TRIEQEPNYTYVTARLLCNELVSTGLEFLGLPTD--------TLEGDALETFLKKGIELD 236

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +++FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MG
Sbjct: 237 LLSPDLLNFDLAKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMG 296

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E  KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA+
Sbjct: 297 LALNEENKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAM 356

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGA
Sbjct: 357 RDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGA 416

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++A WTLF+P E 
Sbjct: 417 VCAYLETWHLDVEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDAEWTLFTPSET 476

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDL G EF   Y +YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD C
Sbjct: 477 PDLHDLTGAEFAERYAHYEAVAKEQNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVC 535

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D +KLA TI+T
Sbjct: 536 NLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGVLDREKLARTIKT 595

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + I Y S  AV+ ADESM
Sbjct: 596 AVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGIAYGSDAAVDFADESM 655

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E IS++AI  S +LA ERGAYS+F+GSLWDQG+ PIDS+ ++A+ R E    ++RT RL 
Sbjct: 656 EVISYYAIQTSSDLALERGAYSTFEGSLWDQGILPIDSLEIVAKSRPERMFEVDRTQRLD 715

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +
Sbjct: 716 WDTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPY 775

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE+D  W++++ASRRQK
Sbjct: 776 LVRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVDTRWIVDAASRRQK 835

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNA
Sbjct: 836 WIDQAQSLNLYIAGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNA 893

Query: 926 VPVTDPNSS---------------------THSLGIPSSCTSD-TECEVCQ 954
           V      +                      T +  +P +C+ D  +CE CQ
Sbjct: 894 VKPASVEAPVVAAQAVEDKKPEAQVEEEGFTTAAPVPMACSIDNPDCEACQ 944


>gi|226953557|ref|ZP_03824021.1| ribonucleoside diphosphate reductase, alpha subunit [Acinetobacter
           sp. ATCC 27244]
 gi|226835694|gb|EEH68077.1| ribonucleoside diphosphate reductase, alpha subunit [Acinetobacter
           sp. ATCC 27244]
          Length = 944

 Score =  918 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 533/951 (56%), Positives = 680/951 (71%), Gaps = 40/951 (4%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
            +QVIKR G + +F+  KIS AI KAF+AVEG+  + S R+ D I  LTE  +    +  
Sbjct: 10  QLQVIKRTGEIATFNAEKISVAIGKAFLAVEGQQGADSSRIHDRITQLTEMVMNTFNRRL 69

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
            S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R     +       P L+I
Sbjct: 70  PSGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRATARQQTGANH-----HPTLQI 124

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
               G L   +   L   +E A +GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++R
Sbjct: 125 TDAKGQLQPLDLDALTATIETASAGLEGIDVQAIVDETVKNLYNGVKESDVATTMMMATR 184

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T IE+EPNY  VTAR L  +L    L  +              L  +    ++++G++  
Sbjct: 185 TRIEQEPNYTYVTARLLCNELVSTGLEFLGLPTD--------TLEGDALETFLKKGIELD 236

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +++FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MG
Sbjct: 237 LLSPDLLNFDLAKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMG 296

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E  KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA+
Sbjct: 297 LALNEENKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAM 356

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGA
Sbjct: 357 RDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGA 416

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++A WTLF+P E 
Sbjct: 417 VCAYLETWHLDVEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDAEWTLFTPSET 476

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDL G EF   Y +YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD C
Sbjct: 477 PDLHDLTGAEFAERYAHYEAVAKEQNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVC 535

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D +KLA TI+T
Sbjct: 536 NLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGVLDREKLARTIKT 595

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + I Y S  AV+ ADESM
Sbjct: 596 AVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGIAYGSDAAVDFADESM 655

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E    ++RT RL 
Sbjct: 656 EVISYYAIQTSSDLALERGAYSTFKGSLWDQGILPIDSLEIVAKSRPERMFEVDRTQRLD 715

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +
Sbjct: 716 WDTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPY 775

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE+D  W++++ASRRQK
Sbjct: 776 LVRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVDTRWIVDAASRRQK 835

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNA
Sbjct: 836 WIDQAQSLNLYIAGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNA 893

Query: 926 VPVTDPNSS---------------------THSLGIPSSCTSD-TECEVCQ 954
           V      +                      T +  +P +C+ D  +CE CQ
Sbjct: 894 VKPASVEAPVVAAQAVEDKKPEAQVEEDGFTTAAPVPMACSIDNPDCEACQ 944


>gi|255318311|ref|ZP_05359546.1| ribonucleoside-diphosphate reductase subunit alpha [Acinetobacter
           radioresistens SK82]
 gi|262379055|ref|ZP_06072211.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           radioresistens SH164]
 gi|255304623|gb|EET83805.1| ribonucleoside-diphosphate reductase subunit alpha [Acinetobacter
           radioresistens SK82]
 gi|262298512|gb|EEY86425.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           radioresistens SH164]
          Length = 942

 Score =  916 bits (2366), Expect = 0.0,   Method: Composition-based stats.
 Identities = 527/958 (55%), Positives = 680/958 (70%), Gaps = 37/958 (3%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           S     P +   +QVIKR G V +FD  KIS AI KAF+AVEG+ ++ S RV D I  LT
Sbjct: 2   SAITSTPGQ---LQVIKRTGEVAAFDAEKISVAIGKAFLAVEGQQSADSSRVHDRITQLT 58

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           E  +    +   S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R       
Sbjct: 59  EMVMNTFKRRLPSGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRNQARQQTGAHH 118

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
                 P L+I    G L   +  +L+  +E+A  GL+ +  + ++ ET KN+Y+G+  S
Sbjct: 119 -----HPTLQITDSKGQLQPLDMSKLQTTLEKASEGLEGIDVQAIIDETVKNLYNGVKAS 173

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           D+ T ++ ++RT IE+EPNY  VTAR L ++L    L  +                 E  
Sbjct: 174 DIATTMMMATRTRIEQEPNYTYVTARLLRDELVATGLAFLGLSEDTPES--------EAL 225

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             ++++G++  LL   ++ FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+
Sbjct: 226 EAFLKKGIELELLDAELLKFDLKKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGIRFEL 285

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRV+MGLA++E ++E RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+
Sbjct: 286 PQLFFMRVSMGLAVQEDDREARAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTI 345

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDLY I+GA+++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAV
Sbjct: 346 SDDLYNIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAV 405

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++
Sbjct: 406 AVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFED 465

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLF+P E  DLHDL G  F   Y  YE  A    + + +KI A  LWRKML+MLFET
Sbjct: 466 GEWTLFTPSETPDLHDLTGSAFAERYAYYESVAKEQNM-LHKKIRAKDLWRKMLSMLFET 524

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H    + 
Sbjct: 525 GHPWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGKL 584

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D +KLA T++TAVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ L + Y S
Sbjct: 585 DREKLARTVKTAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYELGMAYGS 644

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE- 735
             AVE ADESME IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R + 
Sbjct: 645 DAAVEFADESMEVISYYAIQTSSDLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPDR 704

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
              ++RT RL W+ L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN
Sbjct: 705 MFEVDRTQRLDWNTLRTKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSN 764

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTV+N +LV  LK+R LWD  M++DLK+ +GS+  I RIPD+LK I ATAFE++P 
Sbjct: 765 LSGEFTVINPYLVRALKERGLWDSVMVNDLKHFEGSVQKIARIPDELKAIFATAFEVEPR 824

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           W++++ASRRQKWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKS
Sbjct: 825 WIVDAASRRQKWIDQAQSLNLYIAGANGKKLDLTYKMAWLRGLKTTYYLRALGATSAEKS 884

Query: 915 TLKG-----------------VDGKLNAVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
           T+                      +     V + +    +  +P +C+ D  +CE CQ
Sbjct: 885 TINTGALNAVKATAAAPVAAAPVVETKPETVAEEDGFAQAAPVPMACSIDNPDCEACQ 942


>gi|262376781|ref|ZP_06070009.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           lwoffii SH145]
 gi|262308491|gb|EEY89626.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           lwoffii SH145]
          Length = 945

 Score =  915 bits (2364), Expect = 0.0,   Method: Composition-based stats.
 Identities = 527/950 (55%), Positives = 676/950 (71%), Gaps = 37/950 (3%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
            +QVIKR G V +FD  KIS AI KAF+AVEG+ ++ S R+ D I+ LTE  +    +  
Sbjct: 10  QLQVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSADSSRIHDRIEQLTEMVLNTFKRRL 69

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
            S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+RS+ R             P L+I
Sbjct: 70  PSGGTIHIEEIQDQVELALMRTGEQKVARSYVIYREQRSEARKQLGAHH-----HPTLQI 124

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
              +G L   +   L   V +A  GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++R
Sbjct: 125 TDAEGKLKPLDLSALTAHVTKAAEGLEGIDVQAIVDETVKNLYNGVKESDISTTMMMATR 184

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T IE+EPNY  VTAR L + L    L  +           ++         Y+++G++  
Sbjct: 185 TRIEQEPNYTYVTARLLRDDLVATGLKFLGLPVDTVEGDALET--------YLKKGIELE 236

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +++FDL  LA  ++ ER   F YLGLQ L+DRYF+H +G R E+PQ FFMRV+MG
Sbjct: 237 LLSPELLNFDLAKLAAAIQPERSNQFTYLGLQTLFDRYFIHSDGVRFELPQLFFMRVSMG 296

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           L+L E  +E RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA+
Sbjct: 297 LSLNEENREDRAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIDDDLYDIYGAM 356

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGA
Sbjct: 357 RDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGA 416

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++A WTLF+P E 
Sbjct: 417 VCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDAEWTLFTPSET 476

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDL G EF   Y +YE  A    + + +KI A  LWRKML+MLFETGHPWITFKD C
Sbjct: 477 PDLHDLTGAEFAERYAHYEAIAKETNM-LHKKIRAKDLWRKMLSMLFETGHPWITFKDVC 535

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN+S EE AVCNLGSINL+ H      D +KLA T++T
Sbjct: 536 NLRSPQQHVGVVHSSNLCTEITLNTSKEEIAVCNLGSINLVQHVQGGVLDREKLARTVKT 595

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN + + +A+ SN  HR +G+G+MGFQ AL+ +++ Y S  AVE ADESM
Sbjct: 596 AVRMLDNVIDINYYAVPQARNSNLKHRPVGMGIMGFQDALYEMNVAYGSDAAVEFADESM 655

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E IS++AIS S +LA ERG Y +FKGSLWDQG+ PIDS+ L+A+ R E    ++RT RL 
Sbjct: 656 EVISYYAISTSSDLAVERGTYETFKGSLWDQGILPIDSLDLVAKTRPERMFEVDRTQRLD 715

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +
Sbjct: 716 WDTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPY 775

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++  W++++ASRRQK
Sbjct: 776 LVRALKERGLWDAVMVNDLKHFEGSVQKISRIPEELKAIFATAFEVETRWIVDAASRRQK 835

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKG------- 918
           WIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+         
Sbjct: 836 WIDQAQSLNLYIAGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTINTGALNAVK 895

Query: 919 -------------VDGKLNAVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
                        V          +      +  +P +C+ D  +CE CQ
Sbjct: 896 PATVAAPVVAAAPVVEAQKPEAPAEEEGFAQAAPVPMACSIDNPDCEACQ 945


>gi|226940722|ref|YP_002795796.1| NrdA [Laribacter hongkongensis HLHK9]
 gi|226715649|gb|ACO74787.1| NrdA [Laribacter hongkongensis HLHK9]
          Length = 917

 Score =  915 bits (2363), Expect = 0.0,   Method: Composition-based stats.
 Identities = 538/925 (58%), Positives = 673/925 (72%), Gaps = 21/925 (2%)

Query: 32  IKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSAL 91
           I+R G V  F+  KI+ A+ KAF+AV+G+ A +S R++D +  LT+  V  L        
Sbjct: 12  IRRTGDVVPFNADKIALAMRKAFIAVQGESAGQSSRLRDEVARLTQDVVNALTGRRPEGS 71

Query: 92  IVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDD 151
            + IEDIQDQVE +LM+SG H++ R YVLYRE R+       H+       P L +   D
Sbjct: 72  AIAIEDIQDQVELALMRSGEHEVARAYVLYREARAAE-RRARHAALGIDQLPALHVTRPD 130

Query: 152 GTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLI 210
           G+    + +RL   +E AC GL+ D     +L++T KN+YDG++E+++E ALI S+R  I
Sbjct: 131 GSRAPLDIERLGRQLEAACHGLEADTRPAALLADTLKNLYDGVTEAEVERALILSARQWI 190

Query: 211 EKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLH 270
           E++P Y KVTAR LL+ +RREV               +   Y E F + I+ G++A LL 
Sbjct: 191 ERDPAYDKVTARLLLDTIRREVAGG------------VAATYAEVFQQGIQRGMQADLLD 238

Query: 271 ESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLAL 330
             + DFDL  LA  L  ERD  F YLGLQ LYDRYFLH++G RIEMPQ FFMRVAMGLAL
Sbjct: 239 PRLADFDLPRLAAALDGERDRQFGYLGLQTLYDRYFLHVDGRRIEMPQTFFMRVAMGLAL 298

Query: 331 KETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQEN 390
            E +   +A+EFY+LLS F FM STPTLFN+GTRH QLSSC+LTT+ D L GIF A++EN
Sbjct: 299 NEADPTTQAMEFYDLLSRFDFMSSTPTLFNAGTRHSQLSSCYLTTIADSLDGIFDAIKEN 358

Query: 391 AMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCA 450
           A L+K++GGLGNDWTPVR LG+HI GTNG+SQGV+PFLKVANDTAVAVNQGGKRKGAVCA
Sbjct: 359 AQLSKFAGGLGNDWTPVRALGSHIKGTNGQSQGVVPFLKVANDTAVAVNQGGKRKGAVCA 418

Query: 451 YLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDL 510
           YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV +NA WTLFSP +V DL
Sbjct: 419 YLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMQRVMENAEWTLFSPADVPDL 478

Query: 511 HDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIR 570
           HDL G+ F   Y  YE  A    ++  + + AV LWRKMLTMLFETGHPW+T+KD CN+R
Sbjct: 479 HDLTGRAFARRYAEYEAMARADTLRNAKTLRAVDLWRKMLTMLFETGHPWLTWKDACNLR 538

Query: 571 SPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVR 630
           SPQQHVG VHSSNLCTEITLN+S +E AVCNLGS+NL  H      D +KLA T+R A+R
Sbjct: 539 SPQQHVGRVHSSNLCTEITLNTSDDEIAVCNLGSVNLANHLKEGALDQEKLARTVRVAMR 598

Query: 631 VLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFI 690
           +LDNVID+N + +EKA+ +N  HR +GLG+MGFQ  LHLL +PY S  AV  ADESME I
Sbjct: 599 MLDNVIDLNFYPVEKARTANLRHRPVGLGVMGFQDCLHLLRLPYGSQAAVGFADESMELI 658

Query: 691 SFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDEL 749
           ++HA  AS ELA+ RG Y SF+GSLW QG+ P DS+ LLA  R   L ++R+SRL W  +
Sbjct: 659 AYHAYLASTELAEMRGCYPSFEGSLWSQGILPQDSVELLAAERQGYLEVDRSSRLDWTPV 718

Query: 750 KKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNE 809
           ++R+   GMRNSNC+AIAPTATIANI GVS SI+P+Y+NL+VKSN+SG+FTVVN FLV +
Sbjct: 719 RERIARFGMRNSNCLAIAPTATIANIIGVSASIEPTYKNLFVKSNLSGEFTVVNEFLVQD 778

Query: 810 LKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQ 869
           LK+  LWD  M++DLKY DG +  IERIP D+K ++ATAF++DP WL+E+ASRRQKWIDQ
Sbjct: 779 LKRLGLWDAVMLADLKYFDGDLAPIERIPQDIKTLYATAFDVDPGWLVEAASRRQKWIDQ 838

Query: 870 AQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVT 929
           AQSLNLY+   SGKKLD +Y+ AW+ GLKTTYYLR+ +ATS EKST +G  G+LNAVP+ 
Sbjct: 839 AQSLNLYMAGASGKKLDTLYKLAWVRGLKTTYYLRTLAATSAEKSTGRG--GELNAVPIE 896

Query: 930 DPNSSTHSLGIPSSCTSDTECEVCQ 954
               +            + +CE CQ
Sbjct: 897 GGMVAEP----KFCSIDNPDCEACQ 917


>gi|325001022|ref|ZP_08122134.1| ribonucleoside-diphosphate reductase alpha chain [Pseudonocardia
           sp. P1]
          Length = 927

 Score =  912 bits (2357), Expect = 0.0,   Method: Composition-based stats.
 Identities = 543/936 (58%), Positives = 678/936 (72%), Gaps = 18/936 (1%)

Query: 7   VNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI 66
                  A P+   P       ++VI+R+G  TSFD SKIS A+ KAF+AVEG   + S 
Sbjct: 2   TASTAPPASPNGIAPAA-----LRVIRRDGSETSFDASKISVAMTKAFLAVEGGAGASSS 56

Query: 67  RVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERS 126
           R+  +++ LT Q V  L +H     +V +E IQDQVE +LM+  HHK+ R YVLYRE+++
Sbjct: 57  RLHPLVQELTGQVVAALHRH--PTPVVQVEQIQDQVELALMRGEHHKVARSYVLYREQQA 114

Query: 127 DVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETY 186
             RA+   +   +     + +   DGT    +  R+E ++ EA  G+ DV +  VL+E  
Sbjct: 115 QARASGPDAGGASA---TIHVTGPDGTRAPLDRDRVETVLAEALDGIDDVEAAPVLAELD 171

Query: 187 KNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHH 246
           + +YDG++  +L  AL+ ++RTL+E+EP+Y+ V +R L+++LR E ++ +    +     
Sbjct: 172 RTVYDGITADELSQALVMAARTLVEREPDYSLVASRLLMDRLRAEAVSHLSGTRETPDQA 231

Query: 247 EMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYF 306
            M   Y  Y   Y+   +   L+   +  FDL  +   L  ERD    +LGLQ LYDRYF
Sbjct: 232 TMARDYASYTKDYLRHAIAIGLVDAELATFDLDRVTAALHPERDLQIGFLGLQTLYDRYF 291

Query: 307 LHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHP 366
           LH +G+R E+PQAFF+RVAMGLA++E ++E RA+EFY LLSSF FM STPTLFNSGT  P
Sbjct: 292 LHEHGTRFELPQAFFLRVAMGLAVREVDREARAIEFYELLSSFDFMASTPTLFNSGTTRP 351

Query: 367 QLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIP 426
           QLSSCFLTTV DDL  IFG  + NA+LAKYSGGLGNDWTPVRGLGAHI GTNG SQGV+P
Sbjct: 352 QLSSCFLTTVDDDLDSIFGGYRNNALLAKYSGGLGNDWTPVRGLGAHIRGTNGVSQGVVP 411

Query: 427 FLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIP 486
           FLK+A DTAVAVNQGGKRKGA CAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANW+P
Sbjct: 412 FLKIAGDTAVAVNQGGKRKGAACAYLETWHVDIEEFLDLRKNTGDDRRRTHDMNTANWVP 471

Query: 487 DLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALW 546
           D F++RV  +  WTLFSPDEV DLHDLYG EF   Y  YE  A+RGE++V R + AV LW
Sbjct: 472 DEFLRRVEADTTWTLFSPDEVPDLHDLYGLEFAERYRAYEAAAERGELRVHRTVRAVDLW 531

Query: 547 RKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNS------SSEETAVC 600
           R+MLTMLFETGHPW+TFKDPCN+RSPQQH GVVHSSNLCTEITLN+         E AVC
Sbjct: 532 RRMLTMLFETGHPWVTFKDPCNLRSPQQHAGVVHSSNLCTEITLNTRAGHDDDRGEVAVC 591

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGS+NL AH   +  D DKL  T+ TAVR+LDNV+DIN +TI +A++SN  HR +GLG+
Sbjct: 592 NLGSVNLAAHVTRDGLDADKLRRTVTTAVRMLDNVVDINFYTIPEARRSNLRHRPVGLGM 651

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGF  AL L  I   S  AV  AD S E +S+HAI+AS +LA ERG Y+SF+GSLW +GV
Sbjct: 652 MGFSDALFLQRIAPGSEAAVGFADVSAEVLSYHAIAASSDLAAERGRYASFEGSLWSRGV 711

Query: 721 FPIDSIGLLAEVR--DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
            PIDS+ LLA+ R   EL ++R+S L W  L++ V+T GMRNSN +AIAPTATI+NICGV
Sbjct: 712 LPIDSLDLLADARGEGELEIDRSSTLDWASLRETVRTQGMRNSNVLAIAPTATISNICGV 771

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
            QSI+P + NLYVKSNMSGDFTVVN  LV +LK+R LWDE M+SDLKY DGS+  I+R+P
Sbjct: 772 GQSIEPIHLNLYVKSNMSGDFTVVNPHLVRDLKERGLWDEVMVSDLKYFDGSLAEIDRVP 831

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            DLK+++ATAFEI+P WL+E+ASRRQKW+DQAQSLNLYL  PSG+KLD +YR AW  GLK
Sbjct: 832 GDLKELYATAFEIEPRWLVEAASRRQKWLDQAQSLNLYLAGPSGRKLDELYRLAWRSGLK 891

Query: 899 TTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSS 934
           TTYYLR+R+ATSVEKSTLKG DG+L  VP      +
Sbjct: 892 TTYYLRTRAATSVEKSTLKGTDGRLTGVPTGTSGPA 927


>gi|50083945|ref|YP_045455.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           sp. ADP1]
 gi|49529921|emb|CAG67633.1| ribonucleoside diphosphate reductase, alpha subunit [Acinetobacter
           sp. ADP1]
          Length = 941

 Score =  911 bits (2355), Expect = 0.0,   Method: Composition-based stats.
 Identities = 540/948 (56%), Positives = 689/948 (72%), Gaps = 37/948 (3%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
            +QVIKRNG V +FD  KIS AI KAF+AVEG+ ++ S R+ D I  LTE  +    +  
Sbjct: 10  QLQVIKRNGEVATFDAEKISVAIGKAFLAVEGQQSADSSRIHDRISQLTEMVLNTFNRRL 69

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
            S   +HIE+IQDQVE +LM++G HKI R YV+YRE+RS+ R     +       P L+I
Sbjct: 70  PSGGTIHIEEIQDQVELALMRTGEHKIARSYVIYREQRSNARQQSGANH-----HPTLQI 124

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
               G L   +   L+  VE+A  GL+ +  + ++ ET KN+Y+G+  SD+ T ++ ++R
Sbjct: 125 TDAQGQLQPLDLDALKATVEKAAEGLEGIEIQAIVEETVKNLYNGVKVSDIATTMMMATR 184

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T IE EPNY  VTAR L  +L  + L  +      A +  ++         ++++GV+  
Sbjct: 185 TRIEHEPNYTYVTARLLRNELVAKGLEFLGLSEDTAENDALET--------FLKKGVELE 236

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +++FDL  LA  ++ ER   F YLGLQ LYDRYF+H +G R E+PQ FFMRV+MG
Sbjct: 237 LLDPELLNFDLATLAAAIQPERSNQFTYLGLQTLYDRYFIHSDGVRYELPQLFFMRVSMG 296

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA+ E  +E+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA+
Sbjct: 297 LAINEDNREERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYNIYGAI 356

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGA
Sbjct: 357 RDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGA 416

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++  WTLF+P EV
Sbjct: 417 VCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWLPDLFMQRVFEDGEWTLFTPSEV 476

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDL G+EF   Y  YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD C
Sbjct: 477 PDLHDLTGEEFAQRYAYYESIAKEQNL-LHKKVRAQDLWRKMLSMLFETGHPWITFKDVC 535

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGSINL+ H      D DKLA TI+T
Sbjct: 536 NLRSPQQHVGVVHSSNLCTEITLNTSDDEIAVCNLGSINLVQHVQGGVLDRDKLARTIKT 595

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ +++ Y S EAV  ADESM
Sbjct: 596 AVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMNMAYGSDEAVNFADESM 655

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E IS++AI  S +LA ERG YS+FKGSLWDQG+ PIDS+ ++A+ R E    ++RT RL 
Sbjct: 656 EVISYYAIQTSSDLAIERGVYSTFKGSLWDQGILPIDSLDIVAKSRPERMFEVDRTQRLD 715

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +
Sbjct: 716 WDTLRNKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPY 775

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++P W++++ASRRQK
Sbjct: 776 LVRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVEPRWIVDAASRRQK 835

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNA
Sbjct: 836 WIDQAQSLNLYIAGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNA 893

Query: 926 VP------------------VTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
           V                   VT  +  T +  +P +C+ D  +CE CQ
Sbjct: 894 VKPTTVAAPVAAVAQETKPEVTAEDGFTTAAPVPMACSIDNPDCEACQ 941


>gi|94986919|ref|YP_594852.1| ribonucleotide-diphosphate reductase subunit alpha [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731168|emb|CAJ54530.1| Ribonucleotide reductase large subunit [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 916

 Score =  910 bits (2352), Expect = 0.0,   Method: Composition-based stats.
 Identities = 541/931 (58%), Positives = 677/931 (72%), Gaps = 24/931 (2%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLL 84
            +  +QVI+RNG + SF   KI+ A+ KAF+AV+G+ +  S  ++D++ +LTE  ++ L 
Sbjct: 9   SLAAMQVIRRNGDIVSFKSEKIAAALTKAFIAVKGEQSPLSSSLRDVVTHLTETVISALT 68

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
                   +HIEDIQDQVE +LMQSG H + R YVLYRE+R+ +R           +   
Sbjct: 69  HRFPDGGSIHIEDIQDQVERALMQSGEHDVARAYVLYREKRAAMRNTSEKKAVLHLVDK- 127

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIF 204
                  G     +   L  I   AC  L  VSS  + + T K++YDG+S +D+ ++LI 
Sbjct: 128 -------GEKKVLDHTWLMNICHVACKNLTSVSSISIFNNTLKSLYDGMSLADVYSSLIL 180

Query: 205 SSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGV 264
           S+RT+IE EP Y KVTAR L   L  EVL    +       H+++     YF ++IE G+
Sbjct: 181 SARTMIEYEPEYNKVTARLLRLSLAYEVLDQSTELMDL---HQLKIATISYFPKFIELGI 237

Query: 265 KARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRV 324
            A LL   +  F+  YLA  L  ERD  F Y+G+Q LYDRYFLHI   RIE+PQ FFMRV
Sbjct: 238 NAGLLDPRLSTFNYSYLAQALVPERDELFGYIGIQTLYDRYFLHIKKRRIELPQLFFMRV 297

Query: 325 AMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AMGLAL E +KE +A+EFYNLLS+F FM STPTLFNSGT  PQLSSCFLTT+ DDL  IF
Sbjct: 298 AMGLALNEKKKEDKAIEFYNLLSNFDFMSSTPTLFNSGTIRPQLSSCFLTTINDDLENIF 357

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
            +++ENA+L KY+GG+GNDWTPVR LG+ I GTNG+SQGVIPF+KVANDTA+AVNQGGKR
Sbjct: 358 QSIKENALLQKYAGGIGNDWTPVRALGSPIKGTNGQSQGVIPFMKVANDTALAVNQGGKR 417

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVCAYLETWH+D+E+FLDLRKNTGDDRRRTHDMNTANW+PDLFMKRV +N+ WTLFSP
Sbjct: 418 KGAVCAYLETWHLDIEDFLDLRKNTGDDRRRTHDMNTANWVPDLFMKRVLENSDWTLFSP 477

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
           ++V +LH+ +G EFE  Y +YE +   GEI +F+K+SAV LWRKMLTMLFETGHPWITFK
Sbjct: 478 NDVPELHEKFGLEFEKFYTHYEAKTLTGEITLFKKVSAVQLWRKMLTMLFETGHPWITFK 537

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAST 624
           D CN+RSPQQH+GV+HSSNLCTEITLN+S EE AVCNLGSINL +H  N + D +KL+ T
Sbjct: 538 DACNLRSPQQHIGVIHSSNLCTEITLNTSKEEIAVCNLGSINLSSHLINGEVDQNKLSQT 597

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           I TA+R+LDNVIDIN +   KA  +N  HR IG+G+MGF   L+ L IPYAS +AVE AD
Sbjct: 598 IATALRMLDNVIDINYYNSPKASYANLQHRPIGIGIMGFADCLYKLGIPYASHQAVEFAD 657

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDEL-AMNRTSR 743
            SME + ++   AS ELA+ERGAYS+F GSLWD+ + P+DS+ LL + R     ++R+SR
Sbjct: 658 RSMEIVCYYTYWASTELAKERGAYSTFPGSLWDRKILPLDSLDLLLKERGGFLEVDRSSR 717

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           L WD LK R+   GMRNSNC+++APTATI+NI GVSQ I+P+YQNLYVKSNMSG+FT+VN
Sbjct: 718 LDWDALKDRIAKYGMRNSNCVSLAPTATISNIIGVSQGIEPAYQNLYVKSNMSGEFTIVN 777

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
            +LVN+LK+ +LWDEAM++DLKY DGS+  I+R+PD LKK++ATAFEIDP+WLIE+ASRR
Sbjct: 778 EYLVNDLKKLNLWDEAMVADLKYFDGSVAYIDRVPDSLKKLYATAFEIDPVWLIEAASRR 837

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKL 923
           QKWIDQAQSLNLYLD PSGKK+D IY+ AWL GLKTTYYLRS  A+ VEK          
Sbjct: 838 QKWIDQAQSLNLYLDTPSGKKMDEIYKLAWLRGLKTTYYLRSLGASQVEK---------- 887

Query: 924 NAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             V     +       + +    D ECE CQ
Sbjct: 888 --VGTNSQSVLKKDTVLRACSIDDPECEACQ 916


>gi|262280151|ref|ZP_06057936.1| ribonucleotide reductase [Acinetobacter calcoaceticus RUH2202]
 gi|262260502|gb|EEY79235.1| ribonucleotide reductase [Acinetobacter calcoaceticus RUH2202]
          Length = 943

 Score =  910 bits (2351), Expect = 0.0,   Method: Composition-based stats.
 Identities = 532/961 (55%), Positives = 685/961 (71%), Gaps = 42/961 (4%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           S+    P +I   QVIKR G V +FD  KIS AI KAF+AVEG+ +S S R+ D I  LT
Sbjct: 2   SVITSTPGQI---QVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSSDSSRIHDRITQLT 58

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           E  +    +   S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R   + + 
Sbjct: 59  EMVLNTFTRRLPSGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRTTARQQTNSNH 118

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
                 P L++   +G L   +   L+  + +A  GL+ +  + ++ ET KN+Y+G+ E+
Sbjct: 119 -----HPTLQVTDANGQLQPLDLSALQATIAKAAEGLEGIDVQAIVDETVKNLYNGVKET 173

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           D+ T ++ ++RT IE+EPNY  VTAR L  +L    L  +        +  ++       
Sbjct: 174 DIATTMMMATRTRIEQEPNYTYVTARLLSSELVSTGLAFLGLPTDTPENTALE------- 226

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             ++++GV+  LL   ++DFDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+
Sbjct: 227 -AFLKKGVELDLLSPDLLDFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFEL 285

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRV+MGL L E  KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+
Sbjct: 286 PQLFFMRVSMGLTLNEQNKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTI 345

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDLY I+GA+++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAV
Sbjct: 346 GDDLYDIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAV 405

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++
Sbjct: 406 AVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFED 465

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLF+P E  DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFET
Sbjct: 466 GEWTLFTPSETPDLHDLTGAEFAERYAYYESVAKETNM-LHKKVRAKDLWRKMLSMLFET 524

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      
Sbjct: 525 GHPWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGVL 584

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D +KLA TI+TAVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ ++I Y S
Sbjct: 585 DREKLARTIKTAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMNIAYGS 644

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE- 735
             A++ ADESME IS++AI  S  LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E 
Sbjct: 645 DAAIDFADESMEVISYYAIETSSNLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPER 704

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
              ++RT RL WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN
Sbjct: 705 MFEVDRTQRLDWDTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSN 764

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTV+N +LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE+D  
Sbjct: 765 LSGEFTVINPYLVRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVDTR 824

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           W++++ASRRQKWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKS
Sbjct: 825 WIVDAASRRQKWIDQAQSLNLYIAGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKS 884

Query: 915 TLKGVDGKLNAVPVTDPNSST--------------------HSLGIPSSCTSD-TECEVC 953
           T+    G LNAV      ++                      +  +P +C+ D  +CE C
Sbjct: 885 TIN--TGALNAVKPATVEAAPVAAPVVEAKKPEAVEEDGFTQAAPVPMACSIDNPDCEAC 942

Query: 954 Q 954
           Q
Sbjct: 943 Q 943


>gi|325121076|gb|ADY80599.1| ribonucleoside diphosphate reductase, alpha subunit [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 944

 Score =  908 bits (2345), Expect = 0.0,   Method: Composition-based stats.
 Identities = 533/960 (55%), Positives = 681/960 (70%), Gaps = 39/960 (4%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           S+    P +I   QVIKR G V +FD  KIS AI KAF+AVEG+ +S S R+ D I  LT
Sbjct: 2   SVITSTPGQI---QVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSSDSSRIHDRITQLT 58

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           E  +    +   S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R   + + 
Sbjct: 59  EMVLNTFTRRLPSGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRASARQQTNSNH 118

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
                 P L++   +G L   +   L+  V +A  GL+ +  + ++ ET KN+Y+G+ ES
Sbjct: 119 -----HPTLQVTDTNGQLQPLDLSALQATVSKAAEGLEGIDVQAIVDETVKNLYNGVKES 173

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           D+ T ++ ++RT IE+EPNY  VTAR L  +L    LT +        +           
Sbjct: 174 DIATTMMMATRTRIEQEPNYTYVTARLLCNELVSTGLTFLGLSTDTPEN--------NAL 225

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             ++++GV+  LL   ++DFDL  L+  ++ ER   F YLGLQ L+DRYF+H NG R E+
Sbjct: 226 EAFLKKGVELDLLSPDLLDFDLEKLSAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFEL 285

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRV+MGLAL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+
Sbjct: 286 PQLFFMRVSMGLALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTI 345

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDLY I+GA+++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAV
Sbjct: 346 GDDLYDIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAV 405

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++
Sbjct: 406 AVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFED 465

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLF+P E  DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFET
Sbjct: 466 GEWTLFTPSETPDLHDLTGAEFAERYAYYESVAKETNM-LHKKVRAKDLWRKMLSMLFET 524

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      
Sbjct: 525 GHPWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGVL 584

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D +KLA TI+TAVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + I Y S
Sbjct: 585 DREKLARTIKTAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGIAYGS 644

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE- 735
             AV+ ADESME IS++AI  S  LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E 
Sbjct: 645 DAAVDFADESMEVISYYAIETSSNLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPER 704

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
              ++RT RL WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN
Sbjct: 705 MFEVDRTQRLDWDTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSN 764

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTV+N +LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE+D  
Sbjct: 765 LSGEFTVINPYLVRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVDTR 824

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           W++++ASRRQKWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKS
Sbjct: 825 WIVDAASRRQKWIDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKS 884

Query: 915 TLKG-------------------VDGKLNAVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
           T+                     V          +    T +  +P +C+ D  +CE CQ
Sbjct: 885 TINTGALNAVKPATVEAAAVAAPVVEAKKPEAAVEEEGFTQAAPVPMACSIDNPDCEACQ 944


>gi|293609144|ref|ZP_06691447.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829717|gb|EFF88079.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 944

 Score =  908 bits (2345), Expect = 0.0,   Method: Composition-based stats.
 Identities = 533/960 (55%), Positives = 681/960 (70%), Gaps = 39/960 (4%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           S+    P +I   QVIKR G V +FD  KIS AI KAF+AVEG+ +S S R+ D I  LT
Sbjct: 2   SVITSTPGQI---QVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSSDSSRIHDRITQLT 58

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           E  +    +   S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R   + + 
Sbjct: 59  EMVLNTFTRRLPSGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRASARQQTNSNH 118

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
                 P L++   +G L   +   L+  V +A  GL+ +  + ++ ET KN+Y+G+ ES
Sbjct: 119 -----HPTLQVTDTNGQLQPLDLSALQATVSKAAEGLEGIDVQAIVDETVKNLYNGVKES 173

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           D+ T ++ ++RT IE+EPNY  VTAR L  +L    LT +        +           
Sbjct: 174 DIATTMMMATRTRIEQEPNYTYVTARLLCNELVSTGLTFLGLSTDTPEN--------NAL 225

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             ++++GV+  LL   ++DFDL  L+  ++ ER   F YLGLQ L+DRYF+H NG R E+
Sbjct: 226 EAFLKKGVELDLLSPDLLDFDLEKLSAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFEL 285

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRV+MGLAL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+
Sbjct: 286 PQLFFMRVSMGLALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTI 345

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDLY I+GA+++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAV
Sbjct: 346 GDDLYDIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAV 405

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++
Sbjct: 406 AVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFED 465

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLF+P E  DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFET
Sbjct: 466 GEWTLFTPSETPDLHDLTGAEFAERYAYYESVAKETNM-LHKKVRAKDLWRKMLSMLFET 524

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      
Sbjct: 525 GHPWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGVL 584

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D +KLA TI+TAVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + I Y S
Sbjct: 585 DREKLARTIKTAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGIAYGS 644

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE- 735
             AV+ ADESME IS++AI  S  LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E 
Sbjct: 645 DAAVDFADESMEVISYYAIETSSNLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPER 704

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
              ++RT RL WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN
Sbjct: 705 MFEVDRTQRLDWDTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSN 764

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTV+N +LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE+D  
Sbjct: 765 LSGEFTVINPYLVRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVDTR 824

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           W++++ASRRQKWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKS
Sbjct: 825 WIVDAASRRQKWIDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKS 884

Query: 915 TLKG-------------------VDGKLNAVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
           T+                     V          +    T +  +P +C+ D  +CE CQ
Sbjct: 885 TINTGALNAVKPATVEAAAVAAPVVEVKKPEAAVEEEGFTQAAPVPMACSIDNPDCEACQ 944


>gi|299771425|ref|YP_003733451.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           sp. DR1]
 gi|298701513|gb|ADI92078.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           sp. DR1]
          Length = 943

 Score =  906 bits (2342), Expect = 0.0,   Method: Composition-based stats.
 Identities = 535/961 (55%), Positives = 685/961 (71%), Gaps = 42/961 (4%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           S+    P +I   QVIKR G V +FD  KIS AI KAF+AVEG+ +S S R+ D I  LT
Sbjct: 2   SVITSTPGQI---QVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSSDSSRIHDRITQLT 58

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           E  +    +   S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R   + + 
Sbjct: 59  EMVLNTFTRRLPSGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRTTARQQTNSNH 118

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
                 P L++   +G L   +   L+  V +A  GL+ +  + ++ ET KN+Y+G+ ES
Sbjct: 119 -----HPTLQVTDANGQLQPLDLSALQATVAKAAEGLEGIDVQAIVDETVKNLYNGVKES 173

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           D+ T ++ ++RT IE+EPNY  VTAR L  +L    L  +        +           
Sbjct: 174 DIATTMMMATRTRIEQEPNYTYVTARLLSSELVSTGLAFLGLPTDTPEN--------NAL 225

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             ++++GV+  LL   ++DFDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+
Sbjct: 226 EAFLKKGVELDLLSPDLLDFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFEL 285

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRV+MGLAL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+
Sbjct: 286 PQLFFMRVSMGLALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTI 345

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDLY I+GA+++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAV
Sbjct: 346 GDDLYDIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAV 405

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++
Sbjct: 406 AVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFED 465

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLF+P E  DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFET
Sbjct: 466 GEWTLFTPSETPDLHDLTGAEFAERYAYYESVAKETNM-LHKKVRAKDLWRKMLSMLFET 524

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      
Sbjct: 525 GHPWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGVL 584

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D +KLA TI+TAVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ ++I Y S
Sbjct: 585 DREKLARTIKTAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMNIAYGS 644

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE- 735
             A++ ADESME IS++AI  S  LA ERG+YS+FKGSLWDQG+ PIDS+ ++A+ R E 
Sbjct: 645 DAAIDFADESMEVISYYAIETSSNLAVERGSYSTFKGSLWDQGILPIDSLEIVAKSRPER 704

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
              ++RT RL WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN
Sbjct: 705 MFEVDRTQRLDWDTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSN 764

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTV+N +LV  LK R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE+D  
Sbjct: 765 LSGEFTVINPYLVRALKDRGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVDTR 824

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           W++++ASRRQKWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKS
Sbjct: 825 WIVDAASRRQKWIDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKS 884

Query: 915 TLKGVDGKLNAVP--------------------VTDPNSSTHSLGIPSSCTSD-TECEVC 953
           T+    G LNAV                       + +  T +  +P +C+ D  +CE C
Sbjct: 885 TIN--TGALNAVKPATVEAAAVAAPVVEAKKPEAVEEDGFTQAAPVPMACSIDNPDCEAC 942

Query: 954 Q 954
           Q
Sbjct: 943 Q 943


>gi|268316002|ref|YP_003289721.1| ribonucleoside-diphosphate reductase, alpha subunit [Rhodothermus
           marinus DSM 4252]
 gi|262333536|gb|ACY47333.1| ribonucleoside-diphosphate reductase, alpha subunit [Rhodothermus
           marinus DSM 4252]
          Length = 926

 Score =  902 bits (2330), Expect = 0.0,   Method: Composition-based stats.
 Identities = 519/933 (55%), Positives = 654/933 (70%), Gaps = 30/933 (3%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR--SIRVQDIIKNLTEQTVTRLLQHNK 88
           V+KR+G   SFD  +I RA+ KAF A     A    S  + + I+ LT   V    +  +
Sbjct: 15  VVKRDGRRVSFDAERIRRALEKAFRATLELPADAPLSAELSEEIEALTGAVV----RWCR 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
               V +E+IQD+VE +LM++G + + R Y+LY             ++++A    +L   
Sbjct: 71  DRAEVSVEEIQDEVERTLMRAGRYAVARRYILY-----------REARAEARRRQQLTYR 119

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             DGT   F  + L   +E AC GL DV  ++V  E  + +Y G+ E +L+ ALI ++RT
Sbjct: 120 RADGTEAPFPHEALRARIEAACDGLDDVDPELVREELLRTVYPGIPEDELDRALILAART 179

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EP+Y  V AR LL+ L REV        ++A            F  Y+E GV+   
Sbjct: 180 HIEREPDYTYVAARLLLDALYREVFGRPIPPSEQA------EACRAGFRAYLEHGVRLGR 233

Query: 269 LHESM-MDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLH-INGSRIEMPQAFFMRVAM 326
           L E +   FD+  LA  L  ERD  F +LGLQ LYDRY LH   G R E+PQ  +MRVAM
Sbjct: 234 LDERLLRTFDIDRLAAALHPERDRRFTFLGLQTLYDRYLLHEPEGRRFELPQYLWMRVAM 293

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLAL E +   RA++FY LLSSF FM STPTLFN+GT HPQLSSC+LTTV DDL  IF A
Sbjct: 294 GLALAEDDPTARAIQFYELLSSFRFMNSTPTLFNAGTPHPQLSSCYLTTVQDDLGAIFKA 353

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           +++NA+L+K++GGLGNDWTPVR LGAHI GTNG+SQGVIPFLK+ NDTAVAVNQGGKRKG
Sbjct: 354 IRDNALLSKWAGGLGNDWTPVRALGAHIRGTNGRSQGVIPFLKIVNDTAVAVNQGGKRKG 413

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLE WH+D+EEFL+LR+NTGD+RRRTHDMNTA WIPDLFM+RV +   WTLFSPDE
Sbjct: 414 AVCAYLEVWHLDIEEFLELRRNTGDERRRTHDMNTACWIPDLFMQRVRERKHWTLFSPDE 473

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
           V DLHDLYG+ F   YE+YER+A+ G I+ +R+I AVALWRKML+MLFETGHPW+TFKDP
Sbjct: 474 VPDLHDLYGRAFRERYEHYEREAEAGRIRNWRRIEAVALWRKMLSMLFETGHPWLTFKDP 533

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINL-LAHFANNQFDYDKLASTI 625
           CNIRSPQ HVGVVHSSNLCTEITLN+S EE AVCNLGSINL        + D +KL  TI
Sbjct: 534 CNIRSPQDHVGVVHSSNLCTEITLNTSPEEVAVCNLGSINLVAHVDEQGELDREKLRDTI 593

Query: 626 RTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADE 685
           RTAVR+LDNVID+N + I +A+ SN  HR IGLGLMGFQ  L+   + YAS  AVE+ADE
Sbjct: 594 RTAVRMLDNVIDLNFYPIPEARTSNLRHRPIGLGLMGFQDVLYRRGLSYASEAAVELADE 653

Query: 686 SMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRL 744
            MEFI++ A  AS +LA ERGAY +FKGS WD+G+ P+D++ LL   R   + + RT+RL
Sbjct: 654 FMEFIAYCAYEASSDLAAERGAYPTFKGSKWDRGLLPLDTLDLLEAERGEPVPVPRTARL 713

Query: 745 PWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNS 804
            WD L+++++  GMRNSN +AIAPTATIANICGVS SI+P+Y+NLYVKSN+SG+FT +N 
Sbjct: 714 DWDALREKIRRQGMRNSNVLAIAPTATIANICGVSPSIEPTYKNLYVKSNLSGEFTQLNP 773

Query: 805 FLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQ 864
           +LV +LK R LWD+ M+ DLKY+DGS+  I+RIP +LK  + TAFEI+P WLIE A+RRQ
Sbjct: 774 YLVRDLKARGLWDKEMLDDLKYYDGSVQEIDRIPPELKARYRTAFEIEPRWLIECAARRQ 833

Query: 865 KWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLN 924
           KWIDQ+QSLNLYL EPSG+KL  +Y+ AW +GLKTTYYLR+ +AT +EKSTL      + 
Sbjct: 834 KWIDQSQSLNLYLAEPSGRKLSEMYQLAWQLGLKTTYYLRALAATQIEKSTLDINRRGIQ 893

Query: 925 AVPVTDPNSSTH---SLGIPSSCTSDTECEVCQ 954
              +   + S+        P+    D  CE CQ
Sbjct: 894 PRWMKSRSPSSDIVVRRDGPACSPDDESCEACQ 926


>gi|189219088|ref|YP_001939729.1| Oxygen-sensitive ribonucleotide reductase, alpha subunit fused to
           ATP-cone domains [Methylacidiphilum infernorum V4]
 gi|189185946|gb|ACD83131.1| Oxygen-sensitive ribonucleotide reductase, alpha subunit fused to
           ATP-cone domains [Methylacidiphilum infernorum V4]
          Length = 942

 Score =  900 bits (2326), Expect = 0.0,   Method: Composition-based stats.
 Identities = 512/945 (54%), Positives = 658/945 (69%), Gaps = 23/945 (2%)

Query: 21  PFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG--ASRSIRVQDIIKNLTEQ 78
            F   +  + ++KR+G V  FDP +I  A+ KAF A  GK    + S   +  I+ +T  
Sbjct: 10  EFDAHLSALSIVKRDGRVVPFDPHRIRAAVEKAFRADRGKNVGEALSSEDRAAIEEITSA 69

Query: 79  TVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSD 138
            V++          + +E IQD VE +LM+ G+H + + Y+LYR +R   R  ++     
Sbjct: 70  VVSKSAALAGRGERLEVERIQDLVELTLMELGYHTVAKRYILYRADRGRARTIKNREGV- 128

Query: 139 APIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESD 197
                 + ++   G  +  +   +   + EAC GL++  S + +  ET + +YD + E D
Sbjct: 129 -----SIHMIDKQGRKVPLDLAWIHRTLMEACRGLEESCSWRELAEETVRGLYDEIKEED 183

Query: 198 LETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFC 257
           +  A+I ++R+ +EKEP Y  V AR +L K+  E L+         + HE    +  YF 
Sbjct: 184 VVQAMILTARSWVEKEPAYTYVAARLMLGKIYEEALS------LVPSIHETAEYHKAYFP 237

Query: 258 RYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMP 317
            YI+ GVK   L   +++F+L  LA  L+ ERD  F YLGLQILYDRY LH    RIE P
Sbjct: 238 SYIDFGVKIGRLSPRLLEFNLEKLAQALRLERDRQFSYLGLQILYDRYLLHHEERRIETP 297

Query: 318 QAFFMRVAMGLALKET-EKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           Q F+MRVAMGLAL E  ++E  A+ FY+ LS F FM STPTLFNS T HPQLSSC+L TV
Sbjct: 298 QYFWMRVAMGLALNEKEDRELWAIRFYDTLSRFLFMASTPTLFNSATIHPQLSSCYLLTV 357

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDL GIF  + +NA L+K++GGLGNDWT VR  G+ I GTNGKSQGVIPFLKVANDTAV
Sbjct: 358 EDDLDGIFKVISDNARLSKWAGGLGNDWTNVRATGSLIRGTNGKSQGVIPFLKVANDTAV 417

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGA+CAYLETWH+D+E+FL+LRKNTGD+RRRTHDMNTANWIPDLFMKRV QN
Sbjct: 418 AVNQGGKRKGALCAYLETWHLDIEDFLELRKNTGDERRRTHDMNTANWIPDLFMKRVLQN 477

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLFSP +V DLH LYGK+FE  Y  YE+ ADRGEIK+F+++SAV LWRKMLT+LFET
Sbjct: 478 GSWTLFSPSDVPDLHHLYGKDFEKRYVEYEQMADRGEIKLFKRVSAVDLWRKMLTLLFET 537

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAH-FANNQ 615
           GHPWITFKDP NIRSPQ HVGV++SSNLCTEI LN+S EE AVCNLGSINL AH   + +
Sbjct: 538 GHPWITFKDPSNIRSPQDHVGVINSSNLCTEILLNTSPEEVAVCNLGSINLAAHLDESGE 597

Query: 616 FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA 675
            D  KL  TIR AVR+LDNVIDIN + I +A+ +N  HR +GLG+MGFQ  L++  IPY 
Sbjct: 598 IDEKKLQETIRIAVRMLDNVIDINFYPIPEARNANLRHRPVGLGIMGFQDVLYIKKIPYG 657

Query: 676 SPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-D 734
           S +AVE+AD  ME +S+HAI +S ELA+ERG+YS+FKGS WD+G+ PID+I LL E R  
Sbjct: 658 SEKAVEVADRLMEMVSYHAILSSCELAKERGSYSTFKGSKWDRGLLPIDTIDLLEEQREG 717

Query: 735 ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
            + ++R+    WD ++K++K  G+RNS  +AIAPTATI+NI GV QSI+PSY+NLYVKSN
Sbjct: 718 FVEVDRSQTKDWDYVRKKIKEQGLRNSCLLAIAPTATISNITGVCQSIEPSYKNLYVKSN 777

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SGDF  +N +LV +LK+ +LWD+ MI DLKY+DGS+  IERIP +LK+++ATAFEIDP 
Sbjct: 778 LSGDFISINPYLVADLKKLNLWDQEMIDDLKYYDGSVKPIERIPQELKELYATAFEIDPY 837

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           ++IE ASRRQKWID  QSLNLY+DEPSG K+  +Y   W  GLKTTYYLRSR+AT+VEKS
Sbjct: 838 FIIECASRRQKWIDMGQSLNLYVDEPSGWKISQMYILCWKKGLKTTYYLRSRAATTVEKS 897

Query: 915 TLKGV-----DGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           TL           + +   +       +    ++C+ D ECE CQ
Sbjct: 898 TLDVNARGIQPRWMKSKSPSANIRVERNEKEKNACSLDPECESCQ 942


>gi|87311396|ref|ZP_01093516.1| ribonucleotide-diphosphate reductase alpha subunit [Blastopirellula
           marina DSM 3645]
 gi|87285808|gb|EAQ77722.1| ribonucleotide-diphosphate reductase alpha subunit [Blastopirellula
           marina DSM 3645]
          Length = 973

 Score =  886 bits (2289), Expect = 0.0,   Method: Composition-based stats.
 Identities = 504/972 (51%), Positives = 666/972 (68%), Gaps = 29/972 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P ++      D   ++  P       ++V KR+G + SFD  +I  AI KAF A  G  
Sbjct: 12  QPVQEEPFEGADVMTTVTSPA----VALEVRKRDGRIISFDVGRIHYAIGKAFRAEIGVA 67

Query: 62  ASRSIR--VQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYV 119
             + +   ++D +K+++E  + ++     S   V +E IQD VE  LM+ GH  + R Y+
Sbjct: 68  DGQELENSLEDQVKSISEAVIDQIESRPFSRDGVDVESIQDAVEIQLMRHGHFSVARRYI 127

Query: 120 LYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSS 178
           LYREE + +RA ++       I P++ +  +DG    F++ RL   V  A  GL+ + S+
Sbjct: 128 LYREEHAKLRALRAADSDGNLIPPRINVKQEDGAKEPFDATRLRRRVYSAVRGLEQNCSA 187

Query: 179 KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYK 238
           + ++ ETY+++YDG++  ++  A+I +SR+ IE++P+Y KV AR +L  +  E +  ++ 
Sbjct: 188 EELVEETYRSLYDGITPQEIYRAMILASRSRIERDPDYDKVAARLMLMVIYNEAIGRLHP 247

Query: 239 KPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGL 298
           K       ++  +    F  YI  G++A  L E + DFDL  ++  L+ ERD AF YLGL
Sbjct: 248 K------EDIAEVTRREFSTYISTGIEAGRLAERLRDFDLEKISAALRPERDAAFPYLGL 301

Query: 299 QILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTL 358
           Q +YDRY LHI+G RIE PQ F+MRVAMGLA  E  KE+RA+EFYN+LS+F F  +TPTL
Sbjct: 302 QTIYDRYLLHIDGRRIETPQYFWMRVAMGLAWNEENKEERAIEFYNILSTFRFTSATPTL 361

Query: 359 FNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTN 418
           FNSGT HPQLSSC+L+TV DDL  IF  + +NAML+K++GGLGNDWT +R   AHI GTN
Sbjct: 362 FNSGTLHPQLSSCYLSTVDDDLEHIFKVVSDNAMLSKWAGGLGNDWTNIRATNAHIKGTN 421

Query: 419 GKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHD 478
           G+SQGVIPFLKV NDTA+AVNQGGKRKGAVC+YLE+WH+DVEEFLDLRKNTGDDRRRTHD
Sbjct: 422 GQSQGVIPFLKVVNDTAIAVNQGGKRKGAVCSYLESWHLDVEEFLDLRKNTGDDRRRTHD 481

Query: 479 MNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFR 538
           M+TANWIPDLFMKRV +NA WTLFSPDE  DLHDL G +F+  YE YE+ AD G++++FR
Sbjct: 482 MHTANWIPDLFMKRVRENADWTLFSPDETPDLHDLCGSKFQARYEEYEKLADEGKMRLFR 541

Query: 539 KISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA 598
           ++ A  LWRKMLT LFETGHPWIT+KDP N+RSPQ HVGVVHSSNLCTEI LN+S +E A
Sbjct: 542 RLPANELWRKMLTRLFETGHPWITWKDPSNVRSPQDHVGVVHSSNLCTEILLNTSKDEIA 601

Query: 599 VCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGL 658
           VCNLGSINL+AH  N + D +KL  T+ TA R+LDNVIDIN +   +AK SN  HR +G+
Sbjct: 602 VCNLGSINLVAHIRNGELDLEKLQETVTTAARMLDNVIDINYYPTGEAKTSNARHRPVGM 661

Query: 659 GLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQ 718
           GLMGFQ AL  L + YAS EAVE AD SME IS+ AI AS +LA ERG Y ++ GS WD+
Sbjct: 662 GLMGFQDALSSLGVSYASQEAVEFADRSMEAISYFAILASSQLAAERGTYETYAGSKWDR 721

Query: 719 GVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICG 777
           G+ PIDS+ +L + R   + ++R+S L W  ++  V+  GMRNSN MAIAPTATI+ I G
Sbjct: 722 GILPIDSLDILEQERGLPIEVDRSSTLDWQVVRDSVREHGMRNSNVMAIAPTATISTIVG 781

Query: 778 VSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERI 837
           VSQSI+P+Y+NL+VKSN+SG+F  +N  +V +LK   LWD  M+  +KY+DG +  I+R+
Sbjct: 782 VSQSIEPTYKNLFVKSNLSGEFPQLNIRMVQDLKAEGLWDSDMVEAIKYYDGELTEIDRV 841

Query: 838 PDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGL 897
           PD LK  + TAFE+D  WLIE  +RRQKWID  QSLNLY+ +PSG+KL  +Y  AW +GL
Sbjct: 842 PDHLKLRYLTAFEVDSKWLIECGARRQKWIDMGQSLNLYMAQPSGRKLHDMYMLAWNVGL 901

Query: 898 KTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTH---------------SLGIPS 942
           KTTYYLR+ SAT VEKST+      +    + + ++S                     P 
Sbjct: 902 KTTYYLRTLSATQVEKSTIDVNRFGIQPRWMKNASASADIRVDRGDAAEILDELPPEQPK 961

Query: 943 SCTSDTECEVCQ 954
           +C  D +CE CQ
Sbjct: 962 ACNLDGDCESCQ 973


>gi|241589541|ref|YP_002979566.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           pickettii 12D]
 gi|240868253|gb|ACS65912.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           pickettii 12D]
          Length = 949

 Score =  870 bits (2247), Expect = 0.0,   Method: Composition-based stats.
 Identities = 517/954 (54%), Positives = 661/954 (69%), Gaps = 39/954 (4%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMA------VEGKGASRSIRVQDIIKNLTEQTVT 81
              VI+RNG    FD SKI+ A+ KAF+             S S   ++ ++ LT+    
Sbjct: 8   AYMVIRRNGETVPFDASKIASALAKAFLYDAHGNLYRPGVVSLSAAQRERVEQLTQAVCD 67

Query: 82  RLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPI 141
            L +  +S+   HIE +QDQVE +LM++G H++ R YVLYRE  S  RA    +     I
Sbjct: 68  ALGRRGESSA-FHIEALQDQVELALMRAGEHEVARGYVLYREMASQKRAPAPVAGRYDHI 126

Query: 142 APKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETA 201
                  M +G +  F+      IVE   +GL+ VS+  +  E  +N+Y+   E ++E A
Sbjct: 127 K---SYRMRNGGVAPFDPSFWIAIVESVVAGLESVSAADLFEEAVRNLYNNAKEEEIENA 183

Query: 202 LIFSSRTLIEKEPNYAKVTARF-LLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYI 260
           LI ++RT IE EP Y K  AR  L  +L  +V        +  T  E+   Y E F R I
Sbjct: 184 LILAARTKIEMEPAYTKAAARLVLALQLGHDVFG------KAITFDELASSYGEAFARGI 237

Query: 261 EEGVKARLLHESMMD-FDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQA 319
           +E V A LL + M   FDL  LAN ++ ERD  ++YLG+Q LYDRY LHI+G RIE+PQA
Sbjct: 238 KEAVSAELLADDMTRGFDLQRLANAIRPERDCLWDYLGMQTLYDRYLLHIDGKRIELPQA 297

Query: 320 FFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDD 379
           F MRVAMGLA  E E+E RA+EFY +LS+F +M STPTLFN+G+   QLSSC+LTT+ DD
Sbjct: 298 FLMRVAMGLARNEVEREVRAIEFYEVLSTFDYMASTPTLFNTGSLRSQLSSCYLTTISDD 357

Query: 380 LYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVN 439
           L GI+  L+ENA+L+K++GGLGNDWT VR LG++I GTNGKSQG++PFLKV NDTAVAVN
Sbjct: 358 LEGIYDGLKENALLSKFAGGLGNDWTRVRALGSYIKGTNGKSQGIVPFLKVVNDTAVAVN 417

Query: 440 QGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGW 499
           QGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A W
Sbjct: 418 QGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVHEGADW 477

Query: 500 TLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHP 559
           TLFSP++V DLHDLYG +FE  Y++YE  AD G +K F++  AV LWRKML +LFETGHP
Sbjct: 478 TLFSPNDVPDLHDLYGSKFEERYKHYEALADAGTLKHFKRAPAVDLWRKMLGLLFETGHP 537

Query: 560 WITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF--- 616
           WITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH         
Sbjct: 538 WITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLVKQADGSV 597

Query: 617 --DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPY 674
             D+ KL  TIR A+R+LDNVID+N + + KA+ SN  HR +GLG+MG+Q AL++L IP+
Sbjct: 598 ALDHVKLRRTIRIAMRMLDNVIDMNFYAVSKARTSNMRHRPVGLGMMGYQDALYVLGIPF 657

Query: 675 ASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR- 733
            S  AVE +D SME I ++A  AS +LA ERG Y S+ GSLW +G+ P DSI LL + R 
Sbjct: 658 GSEAAVEFSDRSMEAICYYAYEASSDLAVERGVYPSYNGSLWSKGILPFDSIDLLVQERG 717

Query: 734 -DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVK 792
              L ++R+S + WD L++++   GMRNSNC+AIAPTATI+NI GVS S +P +QNLYVK
Sbjct: 718 EGYLDVDRSSSMDWDALREKIGRQGMRNSNCVAIAPTATISNIVGVSASNEPQFQNLYVK 777

Query: 793 SNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEID 852
           SN+SG+FT+VN +LV +LK+  +WDE M+SDLK++DGS+  I+R+P D+K  +ATAFEI+
Sbjct: 778 SNLSGEFTLVNEYLVADLKKLGIWDEVMLSDLKFYDGSVQKIDRVPADIKARYATAFEIE 837

Query: 853 PMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVE 912
           P W +E+ +RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +ATSVE
Sbjct: 838 PSWSVEAGARRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRTIAATSVE 897

Query: 913 KSTLKGVDGKLNAVPVTDP------NSSTHSLGIPSSCTSDT------ECEVCQ 954
           KST+    G LNAV  +          S+        C           C+ CQ
Sbjct: 898 KSTV--PLGTLNAVAPSSQMATQQTTQSSEPDVEGRVCMFRPGDPDFEGCQACQ 949


>gi|149173740|ref|ZP_01852369.1| ribonucleotide-diphosphate reductase alpha subunit [Planctomyces
           maris DSM 8797]
 gi|148847270|gb|EDL61604.1| ribonucleotide-diphosphate reductase alpha subunit [Planctomyces
           maris DSM 8797]
          Length = 949

 Score =  869 bits (2245), Expect = 0.0,   Method: Composition-based stats.
 Identities = 501/945 (53%), Positives = 644/945 (68%), Gaps = 26/945 (2%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA--SRSIRVQDIIKNLTEQTVTRLLQHNK 88
           V KR G    FD S I RAI  AF A             ++  I  + E     +     
Sbjct: 10  VTKRGGRTAPFDASLIGRAISNAFRAELNLADNQPLDDEIRMEIPEMVESVANEIASAAS 69

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ------SHSKSDAPIA 142
           +   V +E IQD VE  LM+ GH++I R Y++YR ER+ +RA +        S+S     
Sbjct: 70  TDAGVEVEKIQDVVEMMLMRRGHYRIARRYIVYRAERAKLRALRGSSDLVEESESIKSTT 129

Query: 143 PKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETA 201
           P+  +++ DGT + F+  R+   + +AC GL+ D S++ +L E  ++++DG+S  +L  A
Sbjct: 130 PRFHVVLTDGTKVPFDEARILARLSDACRGLEGDCSAEALLEEVMRSIFDGISVEELYRA 189

Query: 202 LIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIE 261
           +I ++RT IE++P Y  V +R +L+ +  + L         +  +E+  LY + F +++E
Sbjct: 190 MILAARTRIERDPAYDTVASRLMLKIIYNDALGN-----APSDVNELNQLYVDRFPKFLE 244

Query: 262 EGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFF 321
           +G+ A+ L   +  FDL  +A  L+ +RD  F+YLGLQ ++DRY LHI G RIE PQ F+
Sbjct: 245 DGIAAKRLTPDLHKFDLNRIALALEPKRDHLFQYLGLQAIFDRYLLHIGGRRIETPQYFW 304

Query: 322 MRVAMGLALKETEK-EKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDL 380
           MRV+MGLA++E      RA+EFYN+LSSF F  +TPTLFNS T HPQLSSC+L+TV DDL
Sbjct: 305 MRVSMGLAIQEEGDATGRAIEFYNILSSFRFTSATPTLFNSATLHPQLSSCYLSTVNDDL 364

Query: 381 YGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQ 440
             IF  + +NA L+K++GGLGNDWT +R   +HI GTNG+SQGVIPFLKV NDTAVAVNQ
Sbjct: 365 DHIFKCVADNAKLSKWAGGLGNDWTQIRATNSHISGTNGQSQGVIPFLKVVNDTAVAVNQ 424

Query: 441 GGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
           GGKRKGAVC+YLETWH+DVEEFLDLRKNTGDDRRRTHDM+TANWIPDLFM+RV ++A WT
Sbjct: 425 GGKRKGAVCSYLETWHMDVEEFLDLRKNTGDDRRRTHDMHTANWIPDLFMRRVREDAEWT 484

Query: 501 LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
           LFSP++V DLHDLYG +FE  Y  YER  + GEIK+FR+ISAV LWRKMLT LFETGHPW
Sbjct: 485 LFSPNDVPDLHDLYGHDFEKRYAEYERMTETGEIKLFRRISAVELWRKMLTRLFETGHPW 544

Query: 561 ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDK 620
           IT+KD  N+RSPQ HVGVVHSSNLCTEI LN+S +ETAVCNLGS+NL  H  + Q D   
Sbjct: 545 ITWKDASNLRSPQDHVGVVHSSNLCTEILLNTSRDETAVCNLGSVNLKLHIVDGQLDLGM 604

Query: 621 LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
           L  T+RTA+R+LDNVIDIN +   +A+ SN  HR +GLG+MGFQ AL    I YAS +AV
Sbjct: 605 LEETVRTAMRMLDNVIDINYYPTPEARNSNTKHRPVGLGIMGFQDALLAQGISYASMQAV 664

Query: 681 EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMN 739
           E AD SME IS+ AI AS ELA ERG Y S+ GS WD+G+ PID++ L  + R   + ++
Sbjct: 665 EFADASMEAISYFAILASSELAGERGRYGSYTGSKWDRGLLPIDTLDLYEKERGIPVEVD 724

Query: 740 RTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDF 799
           R +RL W  ++  +   GMRNSN MAIAPTATI+ I GVSQSI+PSY++LYVKSN+SG+F
Sbjct: 725 RQARLDWQVVRNSIAANGMRNSNVMAIAPTATISTIIGVSQSIEPSYKHLYVKSNLSGEF 784

Query: 800 TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
           T VN  LV++LK  DLWD  M+  LKY+DGS+  IERIPD+LK  + TAFE++P W IE 
Sbjct: 785 TQVNRQLVDDLKAVDLWDADMLESLKYYDGSVQEIERIPDELKARYLTAFEVEPKWTIEC 844

Query: 860 ASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGV 919
           A+ RQKWID  QSLNLYL EPSGKKL  +Y  AW  GLKTTYYLR+ +AT VEKST+   
Sbjct: 845 AAHRQKWIDMGQSLNLYLAEPSGKKLHEMYMLAWERGLKTTYYLRTLAATQVEKSTVDVN 904

Query: 920 D----------GKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
                         +     D   +   +    SC  D +CE CQ
Sbjct: 905 KFGIQPRWMKNASASGDIQVDREPAATMVTPGESCNLDGDCEACQ 949


>gi|282890381|ref|ZP_06298909.1| hypothetical protein pah_c016o113 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499763|gb|EFB42054.1| hypothetical protein pah_c016o113 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 921

 Score =  868 bits (2243), Expect = 0.0,   Method: Composition-based stats.
 Identities = 508/927 (54%), Positives = 652/927 (70%), Gaps = 19/927 (2%)

Query: 40  SFDPSKISRAIMKAFMA--VEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIED 97
           SFD  +I  AI KAF A  + G   +    +Q +   +T   ++ +L        V IE 
Sbjct: 2   SFDGERIRLAITKAFRAELLLGADQALPEEIQKVTNGITSAVISSIL-SLTRDEPVPIEK 60

Query: 98  IQDQVECSLMQSGHHKITREYVLYREERSDVRA-AQSHSKSDAPIAPKLKIMMDDGTLIS 156
           IQD VE  LMQ G+H++ R Y+LYREER   RA  ++   ++  +   L +   DGT   
Sbjct: 61  IQDLVEKELMQEGYHQVARGYILYREERKRARAFKETAIPANEQVKSTLYVTYPDGTKSP 120

Query: 157 FNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPN 215
            N+++++  +E AC+  +++ + + ++ E  K++YDG+   +L  + IFS+R+ IEKEP 
Sbjct: 121 LNTQKMQSKMEHACADFKELCNPQELIEEMLKHLYDGVLFKELNESAIFSARSKIEKEPA 180

Query: 216 YAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMD 275
           Y  V AR LL+ +  EV         +    E+  L+  +F +YI +GV A+ L   +  
Sbjct: 181 YNYVAARLLLQDIYNEVFEQ------ECHPSEVANLHVSHFEQYIRKGVMAKRLTPELFG 234

Query: 276 FDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKET-E 334
           +DL  LA +L   RD  F Y+G+Q LYDRY +H+   RIE PQ F+MRVAMGLAL E   
Sbjct: 235 YDLEKLAQNLDSSRDKLFTYIGVQTLYDRYLIHVKNDRIETPQYFWMRVAMGLALNEKEN 294

Query: 335 KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLA 394
           +E+RA+EFYN+LS FHF+ STPTLFNSG+ HPQLSSC+L+TV DDL  IF  + +NA L+
Sbjct: 295 REERAIEFYNVLSQFHFISSTPTLFNSGSLHPQLSSCYLSTVQDDLVNIFKVIADNASLS 354

Query: 395 KYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLET 454
           K+SGG+GNDWT +R  GA IHGTNG +QGV+PFLKVANDTAVAVNQGGKRKGAVCAYLET
Sbjct: 355 KWSGGIGNDWTNIRATGATIHGTNGLTQGVVPFLKVANDTAVAVNQGGKRKGAVCAYLET 414

Query: 455 WHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLY 514
           WH+D+E+F++LRKNTGD+RRRTHDMNTANWIPDLFMKRV + + WTLF+P +  DLHDLY
Sbjct: 415 WHLDIEDFVELRKNTGDERRRTHDMNTANWIPDLFMKRVREQSVWTLFNPSDTPDLHDLY 474

Query: 515 GKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQ 574
           G EFE  Y  YER A  G+IK+F+ I A+ LWRKM+TMLFETGHPW+TFKDP NIRSPQ 
Sbjct: 475 GIEFEKRYCEYERLAQEGKIKLFKVIPAMDLWRKMITMLFETGHPWMTFKDPSNIRSPQS 534

Query: 575 HVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDN 634
           H GVVHSSNLCTEI LN+S  ETAVCNLGSINL AH   +  D   LA TIRTA+R+LDN
Sbjct: 535 HAGVVHSSNLCTEILLNTSENETAVCNLGSINLAAHIKGDFLDEQFLAKTIRTAMRMLDN 594

Query: 635 VIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHA 694
           VIDIN +  ++A++SN  HR +GLGLMGFQ AL+   I Y S EAVE AD SME IS+HA
Sbjct: 595 VIDINYYPTKEARESNLRHRPVGLGLMGFQDALYHFRIAYDSQEAVEFADASMEMISYHA 654

Query: 695 ISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRV 753
           I AS ELA+ERG YSS++GS W QG+ PIDSI LL   R   L M+RTS+  W  ++K +
Sbjct: 655 ILASTELAKERGVYSSYRGSKWSQGILPIDSIALLDNERKGYLHMDRTSKKDWSVVRKEI 714

Query: 754 KTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQR 813
           +  GMRN N MAIAPTATIA+I G+SQSI+P++  LYVKSN+SG+F V+N +LV +LK+R
Sbjct: 715 QKHGMRNCNTMAIAPTATIAHISGLSQSIEPTFSLLYVKSNLSGEFAVLNEWLVKDLKER 774

Query: 814 DLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSL 873
           DLW++ M+ +LKY+DGS+  IE+ P+DLK ++ TAFEI+P WLIE ASRRQKWID  QSL
Sbjct: 775 DLWNQDMLDELKYYDGSVQEIEQFPEDLKGLYKTAFEIEPKWLIECASRRQKWIDMGQSL 834

Query: 874 NLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNS 933
           NLY++ P G+KL  +Y  AW  GLKTTYYLRS++AT VEKSTL      +    +   ++
Sbjct: 835 NLYVNAPDGRKLSDMYLLAWEKGLKTTYYLRSKAATQVEKSTLDINKKGIQPRWMKSRSA 894

Query: 934 S-----THSLGIPSSCTS-DTECEVCQ 954
           S          IP SC+    ECE CQ
Sbjct: 895 SGSIRVERDSSIPKSCSLSGDECESCQ 921


>gi|297621806|ref|YP_003709943.1| ribonucleoside-diphosphate reductase alpha subunit [Waddlia
           chondrophila WSU 86-1044]
 gi|297377107|gb|ADI38937.1| ribonucleoside-diphosphate reductase alpha subunit [Waddlia
           chondrophila WSU 86-1044]
          Length = 918

 Score =  860 bits (2222), Expect = 0.0,   Method: Composition-based stats.
 Identities = 474/933 (50%), Positives = 636/933 (68%), Gaps = 27/933 (2%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII--KNLTEQTVTRLL 84
           + + V KR+  +T F+P +I  AI  AF  V    +  ++     +    + E  + ++ 
Sbjct: 8   QKISVRKRDKQITPFNPERIKNAISSAFRDVWNLQSYHTLDKAQQVIIGQVFEAVIEKIR 67

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
                   + +E IQD VE  LM+  H+K+ + Y+LYRE R+  R  +         AP 
Sbjct: 68  CEKPFDTPIDVERIQDYVELILMRQEHYKVAKSYILYRENRAKARQQKEEE------APA 121

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALI 203
           +++ + +G  ++++ ++L++ ++ +C   + + SS+ ++      ++D +S   +  A I
Sbjct: 122 IRVKLINGDSVAYSQEKLKLSLKRSCQDFEPLCSSEELMKAIEPQLFDRISSEQIRQAAI 181

Query: 204 FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
            ++++LIEKEP Y KV A  LL+K+ RE+ +  +                  F  YI++G
Sbjct: 182 LAAKSLIEKEPAYDKVAANILLQKIYREIESLPFSN----------------FSSYIQKG 225

Query: 264 VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMR 323
           V+A+ LH  ++ FD   L   +++ERD  F Y GLQ LYDRY + I+    E+PQ F+MR
Sbjct: 226 VEAKRLHSDLLGFDHRLLEEAMEHERDRQFSYQGLQTLYDRYLIRISEQVAELPQFFWMR 285

Query: 324 VAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGI 383
           V+MGLAL ET+K  +AVEFY++LSSF ++ STPTLFNSGT HPQLSSC+L+TV DDL  I
Sbjct: 286 VSMGLALNETDKNSKAVEFYHVLSSFDYISSTPTLFNSGTCHPQLSSCYLSTVQDDLNDI 345

Query: 384 FGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGK 443
           F  + ++A L+K++GG+GNDWT VR   AHI+GTNGKSQGVIPFLKV NDTAVAVNQGGK
Sbjct: 346 FRVISDDAKLSKWAGGIGNDWTNVRATQAHINGTNGKSQGVIPFLKVVNDTAVAVNQGGK 405

Query: 444 RKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFS 503
           RKGA+C YLETWH+D+ EFLDLRKNTGDDRRRTHDM+TANWIPDLFMKRV ++  WTLFS
Sbjct: 406 RKGAICCYLETWHLDLPEFLDLRKNTGDDRRRTHDMHTANWIPDLFMKRVEEDGEWTLFS 465

Query: 504 PDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITF 563
           PDEV DLHDLYG+ F+  YE+YER+A  G+IK +R   A+ LWRKML+ LFETGHPWIT+
Sbjct: 466 PDEVPDLHDLYGRAFDKRYEHYEREAKAGKIKQYRTFKAIDLWRKMLSRLFETGHPWITW 525

Query: 564 KDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAS 623
           KDP NIR  Q+H GV+HSSNLCTEI L +S EETAVCNLGS+NL  H    + D   L  
Sbjct: 526 KDPSNIRGNQKHAGVIHSSNLCTEILLPTSKEETAVCNLGSVNLRNHIKEGKLDVSHLEK 585

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           TI TA+R+LDNVIDIN +   +A++SN  HR IGLG+MGFQ AL+L+ IPY S EA+  A
Sbjct: 586 TIATAIRMLDNVIDINFYPTPEARESNLRHRPIGLGMMGFQDALYLMEIPYCSQEAIAFA 645

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTS 742
           D SME IS+ AI AS  LA+ERG+Y SFKGS WD G+FP  ++ LL E R  ++ +++ S
Sbjct: 646 DSSMETISYFAIKASSLLAKERGSYPSFKGSNWDLGLFPHQTMALLEEERGIKIPIDQCS 705

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
              W  L + ++  GMRNS+ +AIAPTATI+ I GVSQSI+P Y NL+ KSN+SG+FT V
Sbjct: 706 SRDWKTLLEIIRQNGMRNSHVLAIAPTATISQIVGVSQSIEPQYTNLFTKSNLSGEFTSV 765

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV  LK  +LWD+ M+ +LKYHDGS+  I RIP ++++   TAFE+   WLI  A+ 
Sbjct: 766 NHYLVETLKSLNLWDQEMLDELKYHDGSVQAIPRIPQEVRERFRTAFEVGAEWLIRCAAA 825

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWID  QSLNLYL EPSG+KLD +YR AW +GLKTTYYLR+R+AT VEKSTL      
Sbjct: 826 RQKWIDMGQSLNLYLTEPSGRKLDEMYRLAWKLGLKTTYYLRTRAATQVEKSTLDINKFD 885

Query: 923 LNAVPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           +    + + ++S+        C+  D  CE CQ
Sbjct: 886 IQPKWMKNKSASSSIAPRQGQCSIDDPTCEACQ 918


>gi|325110862|ref|YP_004271930.1| ribonucleoside-diphosphate reductase, subunit alpha [Planctomyces
           brasiliensis DSM 5305]
 gi|324971130|gb|ADY61908.1| ribonucleoside-diphosphate reductase, alpha subunit [Planctomyces
           brasiliensis DSM 5305]
          Length = 953

 Score =  856 bits (2210), Expect = 0.0,   Method: Composition-based stats.
 Identities = 496/950 (52%), Positives = 660/950 (69%), Gaps = 32/950 (3%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQ--DIIKNLTEQTVTRLLQHNK 88
           V KR+G + SFD ++I RA+  AF A      S+ +      +I+ ++++   ++     
Sbjct: 10  VRKRDGRIASFDMNRIGRAMENAFRAELNLADSQPLDEDVISVIRQISDEVGNQIAPSAS 69

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS--KSDAPIAPKLK 146
           S   V +E++QD VE  LM+ GH+++ R Y++YR E + +RA +       + P   +  
Sbjct: 70  SRQGVDVEELQDAVEMLLMKHGHYRVARRYIVYRAEHAKLRALRGEEGFADEGPERVQTN 129

Query: 147 IMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALIFS 205
           + +DDGTL+ F+  R+   ++ AC GL+D+ S++ +  E  K++YDG++  ++  A+I +
Sbjct: 130 VTLDDGTLVPFDPNRIMTKLQLACRGLEDICSAEDLHEEVLKSIYDGITTKEIYRAMILA 189

Query: 206 SRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVK 265
           SR+ IE++P Y KV  R +L+ +  + L +        +  ++  +Y   F  YI +G+ 
Sbjct: 190 SRSRIERDPAYDKVAGRLMLDVIYHDALGS------APSPKKLASVYRHQFEHYIIDGIA 243

Query: 266 ARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVA 325
           A  L   + DF+L  +A+ L+  RD  F+YLGLQ +YDRY +HI+G RIE PQ F+MRVA
Sbjct: 244 AERLSPGLRDFNLTQIADALEPSRDALFQYLGLQTIYDRYLIHIDGRRIEAPQFFWMRVA 303

Query: 326 MGLALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           MGLA+ E  +KE+RA++FYN+LSSF F  +TPTLFNS T HPQLSSC+L+TV DDL  IF
Sbjct: 304 MGLAVNEGEQKEERAIQFYNMLSSFRFTSATPTLFNSATLHPQLSSCYLSTVSDDLEHIF 363

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
             + +NA L+K++GGLGNDWT +R   AHIHGTNG+SQGVIPFLKV NDTAVAVNQGGKR
Sbjct: 364 KVISDNAKLSKWAGGLGNDWTNIRATNAHIHGTNGQSQGVIPFLKVVNDTAVAVNQGGKR 423

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDM+TANWIPDLFMKRV  N  WTLFSP
Sbjct: 424 KGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMHTANWIPDLFMKRVEANDEWTLFSP 483

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
           DEV DLHDL GKEFE  Y  YE+ A+ GE+ + RK++AV LWRKMLT LFETGHPWIT+K
Sbjct: 484 DEVPDLHDLTGKEFENRYLEYEKMAEDGEMGLTRKVNAVELWRKMLTRLFETGHPWITWK 543

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAST 624
           DP N+RSPQ H GVVHSSNLCTEI LN+S  ETAVCNLGSINL  H  +   +   L  T
Sbjct: 544 DPSNVRSPQDHCGVVHSSNLCTEILLNTSPTETAVCNLGSINLKTHIVDGALNLQMLEET 603

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           + TA+R+LDNVIDIN +  E+A  +N  HR +G+GLMGFQ AL  + + Y  PEAVE AD
Sbjct: 604 VFTAMRMLDNVIDINYYPTEEAANANKRHRPVGMGLMGFQDALLAMDLSYTCPEAVEFAD 663

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSR 743
            SME IS+ AI AS +LA ERG YSS++GS WD+G+ PID++ LL E R   + ++R+S 
Sbjct: 664 RSMEAISYFAILASSQLAAERGRYSSYEGSKWDRGLLPIDTLDLLEEARGQAIEVDRSSS 723

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           L WD ++K V   GMRNSNCMAIAPTATI+ I GVSQSI+PSY++LYVKSN+SG+FT VN
Sbjct: 724 LDWDVVRKSVAENGMRNSNCMAIAPTATISTIIGVSQSIEPSYKHLYVKSNLSGEFTQVN 783

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
           S LV ELK R LWD  M+  LKY+DG++ +I+R+P D+K+ + TAFE+DP WL+E A+RR
Sbjct: 784 SVLVTELKSRGLWDSDMLDALKYYDGTLADIDRVPADIKERYQTAFEVDPYWLVECAARR 843

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD--- 920
           QKW+D  QSLNLY+  P+GK+L  +Y  AW  GLKTTYYLR+ +AT VEKST+       
Sbjct: 844 QKWLDMGQSLNLYMQAPNGKRLHDMYFDAWKKGLKTTYYLRTLAATQVEKSTVDVNKFGI 903

Query: 921 ----------------GKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
                            + +   + + N    S+   +   ++ +CE CQ
Sbjct: 904 QPRWMKNKSNSSDIRVDRAHRDVIEETNDLPASMANATCDPNNPDCEACQ 953


>gi|237805180|ref|YP_002889334.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis B/TZ1A828/OT]
 gi|231273480|emb|CAX10396.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis B/TZ1A828/OT]
          Length = 1047

 Score =  855 bits (2208), Expect = 0.0,   Method: Composition-based stats.
 Identities = 487/938 (51%), Positives = 627/938 (66%), Gaps = 16/938 (1%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  + + 
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 87   NKSA-LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP--IAP 143
                   + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S        
Sbjct: 176  CPQQDRRIDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTIAEE 235

Query: 144  KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETAL 202
             ++++  DG+  +    +L   +  ACS   +   + ++    + N Y G+ ES++  A 
Sbjct: 236  AIEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLAC 295

Query: 203  IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
            I ++R  IEKEP+YA V A  L++ + +E L             +++  + ++F RYI E
Sbjct: 296  IMAARANIEKEPDYAFVAAELLIDVVYKEALGKSK------YAEDLEQAHRDHFKRYIAE 349

Query: 263  GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
            G   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H  G R+E PQ F+M
Sbjct: 350  GDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCRLETPQIFWM 409

Query: 323  RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            RVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D+L  
Sbjct: 410  RVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDNLVN 469

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NAML+K++GG+GNDWT +R  GA I GTNG+SQGVIPF+KV NDTAVAVNQGG
Sbjct: 470  IYKVIADNAMLSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGG 529

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   WTLF
Sbjct: 530  KRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGTWTLF 589

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGHPW+T
Sbjct: 590  SPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGHPWMT 649

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D +KL+
Sbjct: 650  FKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKLS 709

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS EAVE 
Sbjct: 710  ETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEF 769

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L M+ 
Sbjct: 770  ADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANLQMDT 829

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT
Sbjct: 830  SSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFT 889

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+IE A
Sbjct: 890  IPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIECA 949

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK--- 917
            SRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS +    
Sbjct: 950  SRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINK 1009

Query: 918  -GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             G+  +                     C+ +  CE CQ
Sbjct: 1010 RGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score =  119 bits (299), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 100/255 (39%), Gaps = 25/255 (9%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA--SRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++KRNG    FD ++I +A+  AF               ++  I+++T Q V  ++Q   
Sbjct: 11  IVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVVQKIT 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
              +V +E IQD VE  L  +G   + R+Y++YR++R   R               L ++
Sbjct: 71  DGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQ---------SLSVV 121

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              GT++ FN  ++   +E+A             ++  + M       ++          
Sbjct: 122 RRCGTVVHFNPMKISAALEKAFR----------ATDKTEGMTPSSVREEINALTQNIVAE 171

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           + E  P   +   R  +EK++ +++             +   LY E   R  +   +   
Sbjct: 172 IEECCPQQDR---RIDIEKIQ-DIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGS 227

Query: 269 LHESMMDFDLVYLAN 283
             +++ +  +  L+ 
Sbjct: 228 TEKTIAEEAIEVLSK 242


>gi|296436382|gb|ADH18556.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis G/9768]
 gi|296438241|gb|ADH20402.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis G/11074]
 gi|297140742|gb|ADH97500.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis G/9301]
          Length = 1047

 Score =  854 bits (2207), Expect = 0.0,   Method: Composition-based stats.
 Identities = 488/938 (52%), Positives = 627/938 (66%), Gaps = 16/938 (1%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  + + 
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 87   NKSA-LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP--IAP 143
                   + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S        
Sbjct: 176  CPQQDRRIDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTIAEE 235

Query: 144  KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETAL 202
             ++++  DG+  +    +L   +  ACS   +   + ++    + N Y G+ ES++  A 
Sbjct: 236  AVEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLAC 295

Query: 203  IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
            I ++R  IEKEP+YA V A  LL+ + +E L             +++  + ++F RYI E
Sbjct: 296  IMAARANIEKEPDYAFVAAELLLDVVYKEALGKSK------YAEDLEQAHRDHFKRYIAE 349

Query: 263  GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
            G   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H  G R+E PQ F+M
Sbjct: 350  GDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCRLETPQIFWM 409

Query: 323  RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            RVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D+L  
Sbjct: 410  RVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDNLVN 469

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NAML+K++GG+GNDWT +R  GA I GTNG+SQGVIPF+KV NDTAVAVNQGG
Sbjct: 470  IYKVIADNAMLSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGG 529

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   WTLF
Sbjct: 530  KRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGTWTLF 589

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGHPW+T
Sbjct: 590  SPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGHPWMT 649

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D +KL+
Sbjct: 650  FKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKLS 709

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS EAVE 
Sbjct: 710  ETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEF 769

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L M+ 
Sbjct: 770  ADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANLQMDT 829

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT
Sbjct: 830  SSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFT 889

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+IE A
Sbjct: 890  IPNVYLIEKLKKLGVWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIECA 949

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK--- 917
            SRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS +    
Sbjct: 950  SRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINK 1009

Query: 918  -GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             G+  +                     C+ +  CE CQ
Sbjct: 1010 RGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score =  119 bits (297), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 100/255 (39%), Gaps = 25/255 (9%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA--SRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++KRNG    FD ++I +A+  AF               ++  I+++T Q V  ++Q   
Sbjct: 11  IVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVVQKIT 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
              +V +E IQD VE  L  +G   + R+Y++YR++R   R               L ++
Sbjct: 71  DGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQ---------SLSVV 121

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              GT++ FN  ++   +E+A             ++  + M       ++          
Sbjct: 122 RRCGTVVHFNPMKISAALEKAFR----------ATDKTEGMTPSSVREEINALTQNIVAE 171

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           + E  P   +   R  +EK++ +++             +   LY E   R  +   +   
Sbjct: 172 IEECCPQQDR---RIDIEKIQ-DIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGS 227

Query: 269 LHESMMDFDLVYLAN 283
             +++ +  +  L+ 
Sbjct: 228 TEKTIAEEAVEVLSK 242


>gi|15605562|ref|NP_220348.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis D/UW-3/CX]
 gi|237803259|ref|YP_002888453.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis B/Jali20/OT]
 gi|255311667|ref|ZP_05354237.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis 6276]
 gi|255317968|ref|ZP_05359214.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis 6276s]
 gi|7388066|sp|O84834|RIR1_CHLTR RecName: Full=Ribonucleoside-diphosphate reductase subunit alpha;
            AltName: Full=Ribonucleotide reductase
 gi|6578115|gb|AAC68424.2| Ribonucleoside Reductase, Large Chain [Chlamydia trachomatis
            D/UW-3/CX]
 gi|231274493|emb|CAX11289.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis B/Jali20/OT]
 gi|296437313|gb|ADH19483.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis G/11222]
          Length = 1047

 Score =  854 bits (2207), Expect = 0.0,   Method: Composition-based stats.
 Identities = 488/938 (52%), Positives = 627/938 (66%), Gaps = 16/938 (1%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  + + 
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 87   NKSA-LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP--IAP 143
                   + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S        
Sbjct: 176  CPQQDRRIDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTIAEE 235

Query: 144  KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETAL 202
             ++++  DG+  +    +L   +  ACS   +   + ++    + N Y G+ ES++  A 
Sbjct: 236  AVEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLAC 295

Query: 203  IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
            I ++R  IEKEP+YA V A  LL+ + +E L             +++  + ++F RYI E
Sbjct: 296  IMAARANIEKEPDYAFVAAELLLDVVYKEALGKSK------YAEDLEQAHRDHFKRYIAE 349

Query: 263  GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
            G   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H  G R+E PQ F+M
Sbjct: 350  GDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCRLETPQIFWM 409

Query: 323  RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            RVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D+L  
Sbjct: 410  RVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDNLVN 469

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NAML+K++GG+GNDWT +R  GA I GTNG+SQGVIPF+KV NDTAVAVNQGG
Sbjct: 470  IYKVIADNAMLSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGG 529

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   WTLF
Sbjct: 530  KRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGTWTLF 589

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGHPW+T
Sbjct: 590  SPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGHPWMT 649

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D +KL+
Sbjct: 650  FKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKLS 709

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS EAVE 
Sbjct: 710  ETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEF 769

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L M+ 
Sbjct: 770  ADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANLQMDT 829

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT
Sbjct: 830  SSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFT 889

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+IE A
Sbjct: 890  IPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIECA 949

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK--- 917
            SRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS +    
Sbjct: 950  SRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINK 1009

Query: 918  -GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             G+  +                     C+ +  CE CQ
Sbjct: 1010 RGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score =  119 bits (297), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 100/255 (39%), Gaps = 25/255 (9%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA--SRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++KRNG    FD ++I +A+  AF               ++  I+++T Q V  ++Q   
Sbjct: 11  IVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVVQKIT 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
              +V +E IQD VE  L  +G   + R+Y++YR++R   R               L ++
Sbjct: 71  DGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQ---------SLSVV 121

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              GT++ FN  ++   +E+A             ++  + M       ++          
Sbjct: 122 RRCGTVVHFNPMKISAALEKAFR----------ATDKTEGMTPSSVREEINALTQNIVAE 171

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           + E  P   +   R  +EK++ +++             +   LY E   R  +   +   
Sbjct: 172 IEECCPQQDR---RIDIEKIQ-DIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGS 227

Query: 269 LHESMMDFDLVYLAN 283
             +++ +  +  L+ 
Sbjct: 228 TEKTIAEEAVEVLSK 242


>gi|297748956|gb|ADI51502.1| Ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis D-EC]
 gi|297749836|gb|ADI52514.1| Ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis D-LC]
          Length = 1053

 Score =  854 bits (2207), Expect = 0.0,   Method: Composition-based stats.
 Identities = 488/938 (52%), Positives = 627/938 (66%), Gaps = 16/938 (1%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  + + 
Sbjct: 122  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 181

Query: 87   NKSA-LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP--IAP 143
                   + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S        
Sbjct: 182  CPQQDRRIDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTIAEE 241

Query: 144  KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETAL 202
             ++++  DG+  +    +L   +  ACS   +   + ++    + N Y G+ ES++  A 
Sbjct: 242  AVEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLAC 301

Query: 203  IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
            I ++R  IEKEP+YA V A  LL+ + +E L             +++  + ++F RYI E
Sbjct: 302  IMAARANIEKEPDYAFVAAELLLDVVYKEALGKSK------YAEDLEQAHRDHFKRYIAE 355

Query: 263  GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
            G   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H  G R+E PQ F+M
Sbjct: 356  GDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCRLETPQIFWM 415

Query: 323  RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            RVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D+L  
Sbjct: 416  RVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDNLVN 475

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NAML+K++GG+GNDWT +R  GA I GTNG+SQGVIPF+KV NDTAVAVNQGG
Sbjct: 476  IYKVIADNAMLSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGG 535

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   WTLF
Sbjct: 536  KRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGTWTLF 595

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGHPW+T
Sbjct: 596  SPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGHPWMT 655

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D +KL+
Sbjct: 656  FKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKLS 715

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS EAVE 
Sbjct: 716  ETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEF 775

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L M+ 
Sbjct: 776  ADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANLQMDT 835

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT
Sbjct: 836  SSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFT 895

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+IE A
Sbjct: 896  IPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIECA 955

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK--- 917
            SRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS +    
Sbjct: 956  SRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINK 1015

Query: 918  -GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             G+  +                     C+ +  CE CQ
Sbjct: 1016 RGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1053



 Score =  119 bits (297), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 100/255 (39%), Gaps = 25/255 (9%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA--SRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++KRNG    FD ++I +A+  AF               ++  I+++T Q V  ++Q   
Sbjct: 17  IVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVVQKIT 76

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
              +V +E IQD VE  L  +G   + R+Y++YR++R   R               L ++
Sbjct: 77  DGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQ---------SLSVV 127

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              GT++ FN  ++   +E+A             ++  + M       ++          
Sbjct: 128 RRCGTVVHFNPMKISAALEKAFR----------ATDKTEGMTPSSVREEINALTQNIVAE 177

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           + E  P   +   R  +EK++ +++             +   LY E   R  +   +   
Sbjct: 178 IEECCPQQDR---RIDIEKIQ-DIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGS 233

Query: 269 LHESMMDFDLVYLAN 283
             +++ +  +  L+ 
Sbjct: 234 TEKTIAEEAVEVLSK 248


>gi|76789572|ref|YP_328658.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis A/HAR-13]
 gi|76168102|gb|AAX51110.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis A/HAR-13]
          Length = 1047

 Score =  854 bits (2206), Expect = 0.0,   Method: Composition-based stats.
 Identities = 487/938 (51%), Positives = 627/938 (66%), Gaps = 16/938 (1%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  + + 
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 87   NKSA-LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP--IAP 143
                   + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S        
Sbjct: 176  CPQQDRRIDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTIAEE 235

Query: 144  KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETAL 202
             ++++  DG+  +    +L   +  ACS   +   + ++    + N Y G+ ES++  A 
Sbjct: 236  AVEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLAC 295

Query: 203  IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
            I ++R  IEKEP+YA V A  L++ + +E L             +++  + ++F RYI E
Sbjct: 296  IMAARANIEKEPDYAFVAAELLIDVVYKEALGKSK------YAEDLEQAHRDHFKRYIAE 349

Query: 263  GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
            G   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H  G R+E PQ F+M
Sbjct: 350  GDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCRLETPQIFWM 409

Query: 323  RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            RVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D+L  
Sbjct: 410  RVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDNLVN 469

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NAML+K++GG+GNDWT +R  GA I GTNG+SQGVIPF+KV NDTAVAVNQGG
Sbjct: 470  IYKVIADNAMLSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGG 529

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   WTLF
Sbjct: 530  KRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGTWTLF 589

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGHPW+T
Sbjct: 590  SPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGHPWMT 649

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D +KL+
Sbjct: 650  FKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKLS 709

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS EAVE 
Sbjct: 710  ETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEF 769

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L M+ 
Sbjct: 770  ADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANLQMDT 829

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT
Sbjct: 830  SSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFT 889

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+IE A
Sbjct: 890  IPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIECA 949

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK--- 917
            SRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS +    
Sbjct: 950  SRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINK 1009

Query: 918  -GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             G+  +                     C+ +  CE CQ
Sbjct: 1010 RGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score =  119 bits (297), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 100/255 (39%), Gaps = 25/255 (9%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA--SRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++KRNG    FD ++I +A+  AF               ++  I+++T Q V  ++Q   
Sbjct: 11  IVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVVQKIT 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
              +V +E IQD VE  L  +G   + R+Y++YR++R   R               L ++
Sbjct: 71  DGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQ---------SLSVV 121

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              GT++ FN  ++   +E+A             ++  + M       ++          
Sbjct: 122 RRCGTVVHFNPMKISAALEKAFR----------ATDKTEGMTPSSVREEINALTQNIVAE 171

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           + E  P   +   R  +EK++ +++             +   LY E   R  +   +   
Sbjct: 172 IEECCPQQDR---RIDIEKIQ-DIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGS 227

Query: 269 LHESMMDFDLVYLAN 283
             +++ +  +  L+ 
Sbjct: 228 TEKTIAEEAVEVLSK 242


>gi|255507449|ref|ZP_05383088.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis D(s)2923]
 gi|289525873|emb|CBJ15355.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis Sweden2]
 gi|296435458|gb|ADH17636.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis E/150]
 gi|296439175|gb|ADH21328.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis E/11023]
          Length = 1047

 Score =  853 bits (2203), Expect = 0.0,   Method: Composition-based stats.
 Identities = 488/938 (52%), Positives = 626/938 (66%), Gaps = 16/938 (1%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  + + 
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 87   NKSA-LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP--IAP 143
                   + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S        
Sbjct: 176  CPQQDRRIDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTIAEE 235

Query: 144  KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETAL 202
             ++++  DG+  +    +L   +  ACS   +   + ++    + N Y G+ ES++  A 
Sbjct: 236  AVEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLAC 295

Query: 203  IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
            I ++R  IEKEP+YA V A  LL+ + +E L             +++  + ++F RYI E
Sbjct: 296  IMAARANIEKEPDYAFVAAELLLDVVYKEALGKSK------YAEDLEQAHRDHFKRYIAE 349

Query: 263  GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
            G   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H    R+E PQ F+M
Sbjct: 350  GDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEDCRLETPQIFWM 409

Query: 323  RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            RVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D+L  
Sbjct: 410  RVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDNLVN 469

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NAML+K++GG+GNDWT VR  GA I GTNG+SQGVIPF+KV NDTAVAVNQGG
Sbjct: 470  IYKVIADNAMLSKWAGGIGNDWTAVRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGG 529

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   WTLF
Sbjct: 530  KRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGTWTLF 589

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGHPW+T
Sbjct: 590  SPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGHPWMT 649

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D +KL+
Sbjct: 650  FKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKLS 709

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS EAVE 
Sbjct: 710  ETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEF 769

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L M+ 
Sbjct: 770  ADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANLQMDT 829

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT
Sbjct: 830  SSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFT 889

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+IE A
Sbjct: 890  IPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIECA 949

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK--- 917
            SRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS +    
Sbjct: 950  SRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINK 1009

Query: 918  -GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             G+  +                     C+ +  CE CQ
Sbjct: 1010 RGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score =  119 bits (297), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 100/255 (39%), Gaps = 25/255 (9%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA--SRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++KRNG    FD ++I +A+  AF               ++  I+++T Q V  ++Q   
Sbjct: 11  IVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVVQKIT 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
              +V +E IQD VE  L  +G   + R+Y++YR++R   R               L ++
Sbjct: 71  DGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQ---------SLSVV 121

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              GT++ FN  ++   +E+A             ++  + M       ++          
Sbjct: 122 RRCGTVVHFNPMKISAALEKAFR----------ATDKTEGMTPSSVREEINALTQNIVAE 171

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           + E  P   +   R  +EK++ +++             +   LY E   R  +   +   
Sbjct: 172 IEECCPQQDR---RIDIEKIQ-DIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGS 227

Query: 269 LHESMMDFDLVYLAN 283
             +++ +  +  L+ 
Sbjct: 228 TEKTIAEEAVEVLSK 242


>gi|255349231|ref|ZP_05381238.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis 70]
 gi|255503768|ref|ZP_05382158.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis 70s]
          Length = 1047

 Score =  853 bits (2203), Expect = 0.0,   Method: Composition-based stats.
 Identities = 487/938 (51%), Positives = 626/938 (66%), Gaps = 16/938 (1%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  + + 
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 87   NKSA-LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP--IAP 143
                   + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S        
Sbjct: 176  CPQQDRRIDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTIAEE 235

Query: 144  KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETAL 202
             ++++  DG+  +    +L   +  ACS   +   + ++    + N Y G+ ES++  A 
Sbjct: 236  AVEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLAC 295

Query: 203  IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
            I ++R  IEKEP+YA V A  LL+ + +E L             +++  + ++F RYI E
Sbjct: 296  IMAARANIEKEPDYAFVAAELLLDVVYKEALGKSK------YAEDLEQAHRDHFKRYIAE 349

Query: 263  GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
            G   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H    R+E PQ F+M
Sbjct: 350  GDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEDCRLETPQIFWM 409

Query: 323  RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            RVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D+L  
Sbjct: 410  RVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDNLVN 469

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NAML+K++GG+GNDWT VR  GA I GTNG+SQGVIPF+KV NDTAVAVNQGG
Sbjct: 470  IYKVIADNAMLSKWAGGIGNDWTAVRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGG 529

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   WTLF
Sbjct: 530  KRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGTWTLF 589

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGHPW+T
Sbjct: 590  SPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGHPWMT 649

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D +KL+
Sbjct: 650  FKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKLS 709

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS EA+E 
Sbjct: 710  ETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAIEF 769

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L M+ 
Sbjct: 770  ADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANLQMDT 829

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT
Sbjct: 830  SSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFT 889

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+IE A
Sbjct: 890  IPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIECA 949

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK--- 917
            SRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS +    
Sbjct: 950  SRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINK 1009

Query: 918  -GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             G+  +                     C+ +  CE CQ
Sbjct: 1010 RGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score =  119 bits (297), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 100/255 (39%), Gaps = 25/255 (9%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA--SRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++KRNG    FD ++I +A+  AF               ++  I+++T Q V  ++Q   
Sbjct: 11  IVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVVQKIT 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
              +V +E IQD VE  L  +G   + R+Y++YR++R   R               L ++
Sbjct: 71  DGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQ---------SLSVV 121

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              GT++ FN  ++   +E+A             ++  + M       ++          
Sbjct: 122 RRCGTVVHFNPMKISAALEKAFR----------ATDKTEGMTPSSVREEINALTQNIVAE 171

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           + E  P   +   R  +EK++ +++             +   LY E   R  +   +   
Sbjct: 172 IEECCPQQDR---RIDIEKIQ-DIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGS 227

Query: 269 LHESMMDFDLVYLAN 283
             +++ +  +  L+ 
Sbjct: 228 TEKTIAEEAVEVLSK 242


>gi|126640805|ref|YP_001083789.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii ATCC 17978]
          Length = 885

 Score =  850 bits (2196), Expect = 0.0,   Method: Composition-based stats.
 Identities = 504/900 (56%), Positives = 649/900 (72%), Gaps = 40/900 (4%)

Query: 79  TVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSD 138
            +    +   S   +HIE+IQDQVE +LM++G HK+ R YV+YR++R+  R   + +   
Sbjct: 2   VLNTFTRRLPSGGTIHIEEIQDQVELALMRTGEHKVARAYVIYRDQRASARKDTNSNH-- 59

Query: 139 APIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDL 198
               P L++   +G L   +   L+  V  A  GL+ +  + ++ ET KN+Y+G+ ESD+
Sbjct: 60  ---HPTLQVTDANGQLQPLDLSALQATVNRAAEGLEGIDVQAIIDETVKNLYNGVKESDI 116

Query: 199 ETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCR 258
            T ++ ++RT IE+EPNY  VTAR L ++L    L  +      A +             
Sbjct: 117 ATTMMMATRTRIEQEPNYTYVTARLLRDELVSTGLAFLGLPADTAEN--------NALEA 168

Query: 259 YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
           ++++GV+  LL   ++ FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ
Sbjct: 169 FLKKGVELDLLSPDLLKFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQ 228

Query: 319 AFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPD 378
            FFMRV+MGLAL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ D
Sbjct: 229 LFFMRVSMGLALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGD 288

Query: 379 DLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
           DLY I+GA+++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAV
Sbjct: 289 DLYDIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAV 348

Query: 439 NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
           NQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++  
Sbjct: 349 NQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDGE 408

Query: 499 WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
           WTLF+P E  DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFETGH
Sbjct: 409 WTLFTPSETPDLHDLTGAEFAERYAYYESVAKEQNM-LHKKVRAKDLWRKMLSMLFETGH 467

Query: 559 PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDY 618
           PWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D 
Sbjct: 468 PWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVKGGVLDR 527

Query: 619 DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
           +KLA T++TAVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + + Y S E
Sbjct: 528 EKLARTVKTAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGMAYGSDE 587

Query: 679 AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--L 736
           AV  ADESME IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E   
Sbjct: 588 AVNFADESMEVISYYAIQTSSDLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPERMF 647

Query: 737 AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
            ++RT RL WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+S
Sbjct: 648 EVDRTQRLDWDSLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLS 707

Query: 797 GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
           G+FTV+N +LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++P W+
Sbjct: 708 GEFTVINPYLVRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVEPRWI 767

Query: 857 IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
           +++ASRRQKWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+
Sbjct: 768 VDAASRRQKWIDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTI 827

Query: 917 KGVDGKLNAVP---------------------VTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
               G LNAV                        + +  T +  +P +C+ D  +CE CQ
Sbjct: 828 N--TGALNAVKPATVEAAAPAAAPVVEAKKPEAVEEDGFTQAAPVPMACSIDNPDCEACQ 885


>gi|166154171|ref|YP_001654289.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis 434/Bu]
 gi|166155046|ref|YP_001653301.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis L2b/UCH-1/proctitis]
 gi|301335415|ref|ZP_07223659.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis L2tet1]
 gi|165930159|emb|CAP03643.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis 434/Bu]
 gi|165931034|emb|CAP06597.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis L2b/UCH-1/proctitis]
          Length = 1047

 Score =  850 bits (2195), Expect = 0.0,   Method: Composition-based stats.
 Identities = 490/938 (52%), Positives = 627/938 (66%), Gaps = 16/938 (1%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  + + 
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 87   NKSA-LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP--IAP 143
                   + IE IQD VE  LM  GH+ I + Y+LYRE R+ VR  +    S        
Sbjct: 176  CSQQDRRIDIEKIQDIVEQQLMVVGHYAIAKNYILYREARARVRDNREEDGSTEKTIAEE 235

Query: 144  KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETAL 202
              +++  DG+  +    +L   +  ACS   +   + ++    + N Y G+ ES++  A 
Sbjct: 236  AFEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLAC 295

Query: 203  IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
            I ++R  IEKEP+YA V A  LL+ + +E L             +++  + ++F RYI E
Sbjct: 296  IMAARANIEKEPDYALVAAELLLDVVYKEALGKSK------YAEDLEQAHRDHFKRYIAE 349

Query: 263  GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
            G   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H  G R+E PQ F+M
Sbjct: 350  GDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCRLETPQIFWM 409

Query: 323  RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            RVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  
Sbjct: 410  RVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLVN 469

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NAML+K++GG+GNDWT +R  GA I GTNG+SQGVIPF+KV NDTAVAVNQGG
Sbjct: 470  IYKVIADNAMLSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGG 529

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+NTA+WIPDLF KR+ Q   WTLF
Sbjct: 530  KRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNTASWIPDLFFKRLQQKGTWTLF 589

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+M+FETGHPW+T
Sbjct: 590  SPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMVFETGHPWMT 649

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D +KL+
Sbjct: 650  FKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKLS 709

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS EAVE 
Sbjct: 710  ETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEF 769

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L M+ 
Sbjct: 770  ADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANLQMDT 829

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT
Sbjct: 830  SSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFT 889

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+IE A
Sbjct: 890  IPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIECA 949

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK--- 917
            SRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS +    
Sbjct: 950  SRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINK 1009

Query: 918  -GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             G+  +                     C+ +  CE CQ
Sbjct: 1010 RGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score =  118 bits (295), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 37/141 (26%), Positives = 67/141 (47%), Gaps = 11/141 (7%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA--SRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++KRNG    FD ++I +A+  AF               ++  I+++T Q V  ++Q   
Sbjct: 11  IVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVVQKIT 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
              +V +E IQD VE  L  +G   + R+Y++YR++R   R               L ++
Sbjct: 71  DGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQ---------SLSVV 121

Query: 149 MDDGTLISFNSKRLEMIVEEA 169
              GT++ FN  ++   +E+A
Sbjct: 122 RRCGTVVHFNPMKISAALEKA 142


>gi|15834834|ref|NP_296593.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            muridarum Nigg]
 gi|270285000|ref|ZP_06194394.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            muridarum Nigg]
 gi|270289023|ref|ZP_06195325.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            muridarum Weiss]
 gi|301336398|ref|ZP_07224600.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            muridarum MopnTet14]
 gi|14195148|sp|Q9PL93|RIR1_CHLMU RecName: Full=Ribonucleoside-diphosphate reductase subunit alpha;
            AltName: Full=Ribonucleotide reductase
 gi|7190252|gb|AAF39086.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydia
            muridarum Nigg]
          Length = 1047

 Score =  848 bits (2190), Expect = 0.0,   Method: Composition-based stats.
 Identities = 488/938 (52%), Positives = 631/938 (67%), Gaps = 16/938 (1%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
            + + VI+R G    F+P KIS A+ KAF A +         V++ +  LT++ V  + + 
Sbjct: 116  QSLSVIRRCGTTVHFNPMKISAALEKAFRATDRIEGMTPDFVREEVNALTQKIVAEIEER 175

Query: 87   NKSALI-VHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ--SHSKSDAPIAP 143
                   + IE IQD VE  LM  GH+   + Y+LYRE R+ VR  +       +AP   
Sbjct: 176  CSQQDSRIDIEQIQDIVEQQLMVVGHYATAKNYILYREARARVRDNRVEDQIVEEAPSEE 235

Query: 144  KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETAL 202
              +++  DG+       +L   +  ACS   +   + ++    + N Y G+ ES++  A 
Sbjct: 236  TFEVLSKDGSTYMITHSQLLARLARACSRFPETTDAALLTDMAFSNFYSGIKESEVVLAC 295

Query: 203  IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
            I ++R  IEKEP+YA V A  LL+ + +E L             +++ +Y ++F RYI E
Sbjct: 296  IMAARANIEKEPDYAFVAAELLLDVVYKEALDRSRGD------EDLEQVYRDHFKRYIME 349

Query: 263  GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
            G   RL  E    FDL  LAN +   RD  F Y+G+Q LYDRYF H +G R+E PQ F+M
Sbjct: 350  GDSYRLNPELKNLFDLDALANAMDLSRDLQFSYMGIQNLYDRYFNHDDGRRLETPQIFWM 409

Query: 323  RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            RVAMGLALKE +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  
Sbjct: 410  RVAMGLALKEQDKTYWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLVN 469

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NAML+K++GG+GNDWT +R  GA I GTNGKSQGVIPF+KV NDTAVAVNQGG
Sbjct: 470  IYKVISDNAMLSKWAGGIGNDWTAIRATGALIKGTNGKSQGVIPFIKVTNDTAVAVNQGG 529

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGAVC YLE WH+D E+FL+LRKNTGDDRRR HD+NTA+WIPDLF KR+ Q   WTLF
Sbjct: 530  KRKGAVCVYLEVWHLDYEDFLELRKNTGDDRRRAHDVNTASWIPDLFFKRLQQKGSWTLF 589

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LHD YG+EFE  YE YER+ D GEI++++K+ A  LWRKML+MLFETGHPW+T
Sbjct: 590  SPDDVPGLHDAYGEEFERLYEEYERKVDSGEIRLYKKVEAEDLWRKMLSMLFETGHPWMT 649

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGS+NL+ H  ++  D +KL+
Sbjct: 650  FKDPSNIRSAQDHTGVVRCSNLCTEILLNCSETETAVCNLGSVNLVQHILDDGLDEEKLS 709

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS EAVE 
Sbjct: 710  ETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEF 769

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R +  L M+ 
Sbjct: 770  ADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGKDNLQMDT 829

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            + R  W+ ++  ++  GMRN   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT
Sbjct: 830  SVRKDWEPIRSLIREHGMRNCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFT 889

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N +L+ +LK+  +WD  M+ DLKY DGS+  IER+PD +K I  TAFEI+P W++E A
Sbjct: 890  IPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERVPDHIKHIFLTAFEIEPEWILECA 949

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK--- 917
            SRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS +    
Sbjct: 950  SRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINK 1009

Query: 918  -GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             G+  +                     C+ +  CEVCQ
Sbjct: 1010 RGIQPRWMKNKSASAGIVVERASKTPVCSLEEGCEVCQ 1047



 Score =  122 bits (305), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 52/255 (20%), Positives = 105/255 (41%), Gaps = 25/255 (9%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA--SRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++KRNG    FD ++I +A+  AF               +++ I+++T Q V  ++Q   
Sbjct: 11  IVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLENSIRSITHQVVKEVVQKIT 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
              +V +E IQD VE  L  +G   + R+YV+YR++R   R               L ++
Sbjct: 71  DGQVVTVERIQDMVESQLYINGLQDVARDYVVYRDDRKAHREKSWQ---------SLSVI 121

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              GT + FN  ++   +E+A             ++  + M       ++          
Sbjct: 122 RRCGTTVHFNPMKISAALEKAFR----------ATDRIEGMTPDFVREEVNALTQKIVAE 171

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           + E+    ++  +R  +E+++  V   +      AT  +   LY E   R  +  V+ ++
Sbjct: 172 IEERC---SQQDSRIDIEQIQDIVEQQLMVVGHYAT-AKNYILYREARARVRDNRVEDQI 227

Query: 269 LHESMMDFDLVYLAN 283
           + E+  +     L+ 
Sbjct: 228 VEEAPSEETFEVLSK 242


>gi|29840534|ref|NP_829640.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            caviae GPIC]
 gi|29834883|gb|AAP05518.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila
            caviae GPIC]
          Length = 1044

 Score =  847 bits (2187), Expect = 0.0,   Method: Composition-based stats.
 Identities = 474/932 (50%), Positives = 623/932 (66%), Gaps = 15/932 (1%)

Query: 31   VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA 90
            V +R+G    F+P KIS A+ KAF A +    +        I +LT + V  +L      
Sbjct: 120  VRRRDGNAVKFNPMKISAALEKAFRATQKNTDTPFQETLAEINDLTNKIVEEILVVCSQE 179

Query: 91   LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMD 150
              V IE IQD VE  LM  GH+ + + Y+LYRE RS +R ++ +  +   I     ++ +
Sbjct: 180  KTVDIEVIQDIVEKQLMVVGHYDVAKNYILYREARSRIRESKENVATQESIEEVYDVVRE 239

Query: 151  DGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
            DG+    N  +L      AC    +  + + + S  + N Y G+ E+++  A I ++R  
Sbjct: 240  DGSTYQINKAQLTDKFIWACQRFPETTNPQTLASMAFANFYSGIKEAEIVKACIMAARAN 299

Query: 210  IEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
            IEKEP+YA V A  L + + +E +       + AT  ++     + F  YI  G +   L
Sbjct: 300  IEKEPDYAYVAAELLTDVVYQETMG------KSATDSDLAEAQKQCFKNYILNG-EEYRL 352

Query: 270  HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLA 329
            +  + ++DL  LA  L   RD  F Y+G+Q LYDRYF    G R+E  Q F+MR++MGLA
Sbjct: 353  NPRLKEYDLDALAEALDISRDRQFSYMGVQNLYDRYFNQHEGRRLETAQIFWMRISMGLA 412

Query: 330  LKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
            L E  +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  I+  + 
Sbjct: 413  LNEGEDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLAHIYKVIS 472

Query: 389  ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
            +NAML+K++GG+GNDWT VR +G+ I GTNGKSQGVIPF+KVANDTA+AVNQGGKRKGA+
Sbjct: 473  DNAMLSKWAGGIGNDWTGVRAIGSLIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRKGAM 532

Query: 449  CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
            C YLE WH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ Q   WTLFSPD+V 
Sbjct: 533  CVYLEIWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLDQKGTWTLFSPDDVP 592

Query: 509  DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
             LH+ YG EF+  YE YER+ D GEIK+++KI A  LWRKML+ML+ETGHPW+TFKDP N
Sbjct: 593  GLHEAYGFEFDKLYEEYERKIDNGEIKLYKKIPAEDLWRKMLSMLYETGHPWLTFKDPSN 652

Query: 569  IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
            IR  Q H GVV  SNLCTEI LN S  ETAVCNLGS+NL+ H  N   +  KLA TI  A
Sbjct: 653  IRGAQDHAGVVRCSNLCTEILLNCSENETAVCNLGSVNLVEHIENGDINEKKLAETISIA 712

Query: 629  VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
            +R+LDN+ID+N +   +A  +N +HRA+GLG MGFQ AL+ L+I YAS EAVE AD+S E
Sbjct: 713  IRILDNIIDLNFYPTPEAANANLSHRAVGLGQMGFQDALYKLNISYASQEAVEFADKSAE 772

Query: 689  FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
             I+++AI +S  LA+ERG YSS+KGS WD+G  P+D++ LL E R E  + M+ + R  W
Sbjct: 773  LIAYYAILSSSLLAKERGTYSSYKGSKWDRGYLPLDTVELLKEYRGEENVLMDTSCRKDW 832

Query: 747  DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
              +++ +K  GMRNS+ MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT+ N +L
Sbjct: 833  TPVREAIKAYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFTIPNVYL 892

Query: 807  VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
            + +LK+  +WD  M+ DLKY DGS+  IERIPDDLKKI  TAFEI+P WLIE ASRRQKW
Sbjct: 893  IEQLKKLGIWDADMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEWLIECASRRQKW 952

Query: 867  IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK----GVDGK 922
            ID  QSLNLYL EP+GKKL  +Y  AW  GLKTTYYLRS +ATSVEKS       G+  +
Sbjct: 953  IDMGQSLNLYLSEPNGKKLSAMYLTAWKKGLKTTYYLRSLAATSVEKSFTDVNKRGIQPR 1012

Query: 923  LNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
                     +           C+ +  CE CQ
Sbjct: 1013 WMKNKSASTSIVVERTKSTPVCSLEEGCESCQ 1044



 Score =  123 bits (308), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/147 (25%), Positives = 69/147 (46%), Gaps = 11/147 (7%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEG--KGASRSIRVQDIIKNLTEQTVTR 82
           K K   ++KRNG    F+  +IS+A+  AF         +     +++ I ++T + V  
Sbjct: 5   KEKNYTIVKRNGMFVPFNQDRISQALEAAFRDTRSLENNSPLPEDLENSISDITHRVVNE 64

Query: 83  LLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA 142
           ++Q  +   +V +E IQD VE  L  +G   + R+Y++YR++  + R    H        
Sbjct: 65  VMQKIREGQVVTVERIQDMVENQLYVNGLQDVARDYIVYRDQHKEQREGSWHCVL----- 119

Query: 143 PKLKIMMDDGTLISFNSKRLEMIVEEA 169
               +   DG  + FN  ++   +E+A
Sbjct: 120 ----VRRRDGNAVKFNPMKISAALEKA 142


>gi|329943119|ref|ZP_08291893.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila
            psittaci Cal10]
 gi|332287702|ref|YP_004422603.1| ribonucleoside-diphosphate reductase subunit alpha [Chlamydophila
            psittaci 6BC]
 gi|313848276|emb|CBY17277.1| putative ribonucleotide reductase large subunit [Chlamydophila
            psittaci RD1]
 gi|325507258|gb|ADZ18896.1| ribonucleoside-diphosphate reductase subunit alpha [Chlamydophila
            psittaci 6BC]
 gi|328814666|gb|EGF84656.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila
            psittaci Cal10]
 gi|328914954|gb|AEB55787.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila
            psittaci 6BC]
          Length = 1045

 Score =  846 bits (2186), Expect = 0.0,   Method: Composition-based stats.
 Identities = 479/935 (51%), Positives = 627/935 (67%), Gaps = 16/935 (1%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
            V VI+R+G    F+P KIS A+ KAF A +         +   I  LT + V  +L    
Sbjct: 118  VSVIRRDGSTVKFNPMKISAALEKAFRATQKITDVSIQEILSEINGLTNKIVEEILGVCS 177

Query: 89   SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS-KSDAPIAPKLKI 147
                + IE IQD VE  LM  GH+ + + Y+LYRE RS +R  +        P+     +
Sbjct: 178  PEKTIDIEVIQDIVEKQLMVVGHYDVAKNYILYREARSRIRENKQQIDAQKDPVEEVYDV 237

Query: 148  MMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALIFSS 206
            +  DGT  S N  +L      AC    +     ++    + N Y G+ ES++  A I ++
Sbjct: 238  VKSDGTTYSINKSQLIDKFIWACQRFPETTDPHVLADMAFANFYSGIKESEIALACIMAA 297

Query: 207  RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
            R  IEKEP+YA V A  L++ + +E +       + AT  ++     + F  YI  G + 
Sbjct: 298  RANIEKEPDYAYVAAELLMDVVYQETMG------KTATDSDLAEAQKQCFKNYILNG-ET 350

Query: 267  RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
              L+  + ++DL  LA  L   RD  F Y+G+Q LYDRYF    G R+E  Q F+MRV+M
Sbjct: 351  YRLNPRLKEYDLDALAEALDISRDQKFSYMGVQNLYDRYFNQHEGLRVETAQIFWMRVSM 410

Query: 327  GLALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFG 385
            GLAL E  +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  I+ 
Sbjct: 411  GLALNEGDDKTFWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLAHIYK 470

Query: 386  ALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRK 445
             + +NAML+K++GG+GNDWT VR  G+ I GTNGKSQGVIPF+KVANDTA+AVNQGGKRK
Sbjct: 471  VISDNAMLSKWAGGIGNDWTGVRATGSLIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRK 530

Query: 446  GAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPD 505
            GA   YLETWH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ Q   WTLFSPD
Sbjct: 531  GATSVYLETWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEQQGMWTLFSPD 590

Query: 506  EVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKD 565
            +V  LH+ YG EF+  YE YE + D GEIK+++KI A  LWRKML+ML+ETGHPW+TFKD
Sbjct: 591  DVPGLHEAYGIEFDKLYEEYESKIDTGEIKLYKKIPAADLWRKMLSMLYETGHPWMTFKD 650

Query: 566  PCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTI 625
            P NIR+ Q HVGVV  SNLCTEI LN S  ETAVCNLGS+NL+ H  N   +  KL  TI
Sbjct: 651  PSNIRAVQDHVGVVRCSNLCTEILLNCSENETAVCNLGSVNLVEHIENGDINEKKLGETI 710

Query: 626  RTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADE 685
              A+R+LDNVID+N +  ++A  +N +HRA+GLG+MGFQ AL+ L+I YASPEAVE AD+
Sbjct: 711  SIAIRILDNVIDLNFYPTQEAANANLSHRAVGLGIMGFQDALYKLNISYASPEAVEFADK 770

Query: 686  SMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSR 743
            S E ++++AI +S  LA+ERG YSS+KGS WD+G  P+D+I LL E R E  + M+ + R
Sbjct: 771  SSELVAYYAILSSSLLAKERGTYSSYKGSKWDRGYLPLDTIELLKEYRGEQNVLMDTSCR 830

Query: 744  LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
              W+ +++ +K+ GMRNS+ MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT+ N
Sbjct: 831  KDWNPVREAIKSYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFTIPN 890

Query: 804  SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
             +L+N+LK+  +WD+ M+ DLKY DGS+  IERIPDDLKKI  TAFEI+P WLIE ASRR
Sbjct: 891  VYLINKLKELGIWDDDMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEWLIECASRR 950

Query: 864  QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK----GV 919
            QKW+D  QSLNLYL EP+GKKL  +Y  AW  GLKTTYYLRS +ATSVEKS +     G+
Sbjct: 951  QKWVDMGQSLNLYLSEPNGKKLSAMYLTAWKKGLKTTYYLRSLAATSVEKSFIDINKRGI 1010

Query: 920  DGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
              +         +           C+ +  CE CQ
Sbjct: 1011 QPRWMKNKSASTSIVVDRAKKTPVCSFEEGCESCQ 1045



 Score =  132 bits (332), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 96/237 (40%), Gaps = 27/237 (11%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEG--KGASRSIRVQDIIKNLTEQTVTR 82
           K K   ++KRNG    F+  +I +A+  AF         +     +++ I ++T + V  
Sbjct: 5   KEKHYTIVKRNGMFVPFNQERIFQALEAAFRDTRSLENDSPLPKDLENAISDITHRVVNE 64

Query: 83  LLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA 142
            +Q  +   +V +E IQD VE  L  +G   + R+Y++YR++  + R             
Sbjct: 65  AVQKIREGQVVTVERIQDMVENQLYVNGLQDVARDYIIYRDQHKEQRE---------GSW 115

Query: 143 PKLKIMMDDGTLISFNSKRLEMIVE---EACSGLQDVSSKIVLSETYKNMYDGL------ 193
             + ++  DG+ + FN  ++   +E    A   + DVS + +LSE    + + +      
Sbjct: 116 HCVSVIRRDGSTVKFNPMKISAALEKAFRATQKITDVSIQEILSEI-NGLTNKIVEEILG 174

Query: 194 ---SESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHE 247
               E  ++  +I            +  V        L RE  + + +  Q+    +
Sbjct: 175 VCSPEKTIDIEVIQDIVEKQLMVVGHYDVAKN---YILYREARSRIRENKQQIDAQK 228


>gi|89898044|ref|YP_515154.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            felis Fe/C-56]
 gi|89331416|dbj|BAE81009.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydophila felis
            Fe/C-56]
          Length = 1045

 Score =  842 bits (2175), Expect = 0.0,   Method: Composition-based stats.
 Identities = 486/940 (51%), Positives = 625/940 (66%), Gaps = 16/940 (1%)

Query: 24   EKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRL 83
                 V V++R+G +  F+P KIS A+ KAF A           +   I NLT + V   
Sbjct: 113  GSWHSVSVMRRDGNLVRFNPMKISAALEKAFRATLKITDVLLQEILSEINNLTNKIVEET 172

Query: 84   LQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAP 143
            L        + IE IQD VE  LM +GH+ + + Y+LYRE RS +R  +        I  
Sbjct: 173  LAKCSREQTIDIEAIQDIVETQLMIAGHYDVAKNYILYREARSRIREHKQEIAVQEEIVE 232

Query: 144  KLK-IMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETA 201
            ++  ++  DGT    N  +L      AC       +   +    + N Y G+ ES++  A
Sbjct: 233  EVYDVVKSDGTTYQINKAQLTEKFVWACRRFPKTTNPHTLADMAFANFYSGIKESEIVLA 292

Query: 202  LIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIE 261
             I ++R  IEKEP+YA V A  LL+ + +E +       +     ++   + +YF +YI 
Sbjct: 293  CIMAARANIEKEPDYAYVAAELLLDVVCQEAIG------KSIMDADLVEAHKQYFKQYIL 346

Query: 262  EGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFF 321
            +G     L+  + ++DL  LA  L   RD  F Y+G+Q LYDRY     G R+E  Q F+
Sbjct: 347  DG-DQYRLNPRLKEYDLDALAEALDISRDHQFSYMGVQTLYDRYLNQYEGRRLETTQIFW 405

Query: 322  MRVAMGLALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDL 380
            MRV+MGLAL E  +K   A+ FYNLLSSF +  +TPTLFNSG RH QLSSC+L+TV DDL
Sbjct: 406  MRVSMGLALNEGEDKTSWAITFYNLLSSFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDL 465

Query: 381  YGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQ 440
              I+  + +NAML+K++GG+GNDWT VR  G+ I GTNGKS GVIPF+KVANDTAVAVNQ
Sbjct: 466  AHIYKVISDNAMLSKWAGGIGNDWTGVRATGSLIKGTNGKSHGVIPFIKVANDTAVAVNQ 525

Query: 441  GGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
            GGKRKGA C YLETWH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ Q   WT
Sbjct: 526  GGKRKGATCVYLETWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEQKGTWT 585

Query: 501  LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
            LFSPD+V  LH+ YG EF+  YE YER+ D GEIK+++KI A  LWRKML+ML+ETGHPW
Sbjct: 586  LFSPDDVPGLHEAYGFEFDKLYEEYERKVDTGEIKLYKKIPAEDLWRKMLSMLYETGHPW 645

Query: 561  ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDK 620
            ITFKDP NIRS Q H GVV  SNLCTEI LNSS  ETAVCNLGS+NL+ H  N   D + 
Sbjct: 646  ITFKDPSNIRSAQDHAGVVRCSNLCTEILLNSSESETAVCNLGSVNLVEHIKNGDIDEEM 705

Query: 621  LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
            L  TI  A+R+LDNVIDIN +  ++A  +N THRA+GLG+MGFQ AL+ L+I YASPEAV
Sbjct: 706  LGETISIAIRILDNVIDINFYPTQEAANANLTHRAVGLGMMGFQDALYKLNISYASPEAV 765

Query: 681  EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAM 738
            E AD+S E I+++A+ +S  LA+ERG YSS+KGS WD+G  PID+I LL E R E  L M
Sbjct: 766  EFADKSSELIAYYALLSSSLLAKERGTYSSYKGSKWDRGYLPIDTIELLKEYRGEDKLLM 825

Query: 739  NRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGD 798
            + + R  W  +++ +K+ GMRNS+ MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+
Sbjct: 826  DTSCRKDWAPVREAIKSYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGE 885

Query: 799  FTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIE 858
            FT+ N +L+ +LKQ  LWD  M+ DLKY DGS+  IERIPDDLKKI  TAFEI+P WLIE
Sbjct: 886  FTIPNVYLIEKLKQLGLWDADMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEWLIE 945

Query: 859  SASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK- 917
             ASRRQKW+D  QS+NLYL EP+GKKL  +Y  AW  GLKTTYYLRS +ATSVEKS +  
Sbjct: 946  CASRRQKWLDMGQSVNLYLSEPNGKKLSAMYLTAWKKGLKTTYYLRSLAATSVEKSFIDI 1005

Query: 918  ---GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
               G+  +         +           C+ +  CE CQ
Sbjct: 1006 NKRGIQPRWMKNKSASTSIVVERTRETPVCSLEEGCESCQ 1045



 Score =  127 bits (319), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 48/193 (24%), Positives = 84/193 (43%), Gaps = 19/193 (9%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEG--KGASRSIRVQDIIKNLTEQTVTR 82
           K +   ++KRNG    F+  +I +A+  AF         +     ++  I ++T Q V  
Sbjct: 5   KEQHYTIVKRNGMFVPFNQDRIFQALEAAFRDTRSLEDTSPLPKDLEKSISSITRQVVNE 64

Query: 83  LLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA 142
           ++Q  +   +V +E IQD VE  L  SG   + R Y++YR++  + R             
Sbjct: 65  VVQKIREGQVVTVERIQDMVENQLYVSGMQDVARNYIIYRDQHKERRK---------GSW 115

Query: 143 PKLKIMMDDGTLISFNSKRLEMIVE---EACSGLQDVSSKIVLSETYKNMYDGLSESDLE 199
             + +M  DG L+ FN  ++   +E    A   + DV  + +LSE   N+ + +    +E
Sbjct: 116 HSVSVMRRDGNLVRFNPMKISAALEKAFRATLKITDVLLQEILSEI-NNLTNKI----VE 170

Query: 200 TALIFSSRTLIEK 212
             L   SR     
Sbjct: 171 ETLAKCSREQTID 183


>gi|283779061|ref|YP_003369816.1| ribonucleoside-diphosphate reductase, alpha subunit [Pirellula
           staleyi DSM 6068]
 gi|283437514|gb|ADB15956.1| ribonucleoside-diphosphate reductase, alpha subunit [Pirellula
           staleyi DSM 6068]
          Length = 945

 Score =  835 bits (2157), Expect = 0.0,   Method: Composition-based stats.
 Identities = 484/952 (50%), Positives = 634/952 (66%), Gaps = 24/952 (2%)

Query: 14  AFPSLAYPFPEKIKGV-QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           +FP       +   G+ QV KR+G +  FD ++I  AI KA  A  G  A+  +     +
Sbjct: 7   SFPQALATSSDSSAGLKQVRKRDGRLARFDLARIGTAITKAVTAELGAAAAHELPAH--V 64

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
                    R+ +       + +E IQD+VE  LM +G H++ R YVLYRE ++  R A 
Sbjct: 65  AQSITDYTERVARWCDLQEQLAVESIQDEVERVLMTAGEHRVARRYVLYRESQAHKRKAS 124

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYD 191
           +            ++ +  G L +     LE  + +AC    Q   +  + ++  +++  
Sbjct: 125 AT-----------QVRLASGELTALPINALEHWIAQACELHGQAPQAAAITADIVRSLPT 173

Query: 192 GLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ--KATHHEMQ 249
            ++ + L  A I + R+ +E EP +  V A+ LL++   ++L   +        +  E +
Sbjct: 174 EVTPTQLFDATILALRSRVELEPVFTYVAAKLLLDRSDSQLLQNHHGAAILTPLSPSERR 233

Query: 250 CLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHI 309
             Y  YF  Y+   V    LHESM+D++L  +A  +  ERD    YLG+Q LYDRYFL  
Sbjct: 234 AGYQRYFPEYVRAAVARGQLHESMLDYNLEAIAAFIVPERDSLLAYLGVQTLYDRYFLAH 293

Query: 310 NGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLS 369
            G R+E+PQ F+MR+AMGLAL E  K +R  EFY+LLS  HF  +TPTLFN+GT HPQLS
Sbjct: 294 EGLRVELPQIFWMRIAMGLALGEQNKLERVKEFYDLLSQLHFTSATPTLFNAGTCHPQLS 353

Query: 370 SCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLK 429
           SC+L+TV DDL GIF A+Q+NA+L+K++GGLGNDWT +R LGA I GT GKSQG++PFLK
Sbjct: 354 SCYLSTVEDDLVGIFKAIQDNAILSKWAGGLGNDWTNIRALGATIRGTGGKSQGIVPFLK 413

Query: 430 VANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLF 489
           V +D AVAVNQGGKRKGAVCAYLETWH+D+EEFL+LR+ TGD+RRRTHD++TANWIPDLF
Sbjct: 414 VVSDAAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRRTTGDERRRTHDLHTANWIPDLF 473

Query: 490 MKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKM 549
           MKRV     WTLFSP+EV DLH  YG+ FE  Y +YE+ AD G IK+FR++SAV LWRKM
Sbjct: 474 MKRVLARDTWTLFSPNEVPDLHHTYGRAFEQKYLDYEQAADEGRIKLFRRVSAVDLWRKM 533

Query: 550 LTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLA 609
           LT+LFETGHPW+T+KDP NIRSPQ HVGVVH+SNLCTEI LN+S+EETAVCNLGS+NL A
Sbjct: 534 LTLLFETGHPWVTWKDPSNIRSPQDHVGVVHNSNLCTEILLNNSAEETAVCNLGSVNLGA 593

Query: 610 HFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHL 669
           H  +   D   L  TIRTAVR+LDNVID+N +   +A  +N  HR IGLGLMGFQ AL+ 
Sbjct: 594 HITDGVLDLAMLERTIRTAVRMLDNVIDLNFYPTPEAANANLRHRPIGLGLMGFQDALYA 653

Query: 670 LHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLL 729
           + I YAS  AV+ ADESME IS+ A+ AS ELA+ERG Y+SF GS WD+G  PID+I L+
Sbjct: 654 MQISYASDRAVQFADESMEAISYFALLASSELARERGKYASFAGSKWDRGYLPIDTIDLV 713

Query: 730 AEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQN 788
            + R  ++ + RT++L W+ +++ ++  G+RNSN +AIAPTATI+NI GVSQSI+P+Y+N
Sbjct: 714 EQERGIKIDVPRTAQLNWEVVRRAIREQGLRNSNVLAIAPTATISNIAGVSQSIEPTYRN 773

Query: 789 LYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATA 848
           LYVKSN+SG+FT VN +LV ELK   LW E M+  LKY+DG +  I  IP ++K+ + TA
Sbjct: 774 LYVKSNLSGEFTQVNEWLVEELKGLGLWSEEMLDQLKYYDGELAPIAEIPAEVKERYRTA 833

Query: 849 FEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSA 908
           FEI+P WLIE A+RRQKWID  QSLNLYL  PSG+KLD +Y  AW +GLKTTYYLR+ +A
Sbjct: 834 FEIEPRWLIECAARRQKWIDMGQSLNLYLAAPSGRKLDEMYFLAWKLGLKTTYYLRTLAA 893

Query: 909 TSVEKSTLK------GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           T VEKST+             N     D          P  C    +CE CQ
Sbjct: 894 TQVEKSTIDVNRFGIQPRWMKNKSASGDIQIDRTLASAPEVCNLGGDCEACQ 945


>gi|221124254|ref|XP_002159508.1| PREDICTED: similar to Ribonucleoside-diphosphate reductase large
           subunit [Hydra magnipapillata]
          Length = 846

 Score =  833 bits (2152), Expect = 0.0,   Method: Composition-based stats.
 Identities = 495/845 (58%), Positives = 625/845 (73%), Gaps = 11/845 (1%)

Query: 107 MQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIV 166
           M+ GHH+I R YVLYRE R+  RA      ++AP AP + ++ D+G  +  +  +L+  +
Sbjct: 1   MRGGHHEIARAYVLYRERRTQERA--KQVATEAPAAPVIHVI-DNGQRVPLDLAQLQFRI 57

Query: 167 EEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLL 225
           E ACSGL  DV +  +L+ET +N+YDG+   ++  A I ++RTLIEK+P+Y   TAR L 
Sbjct: 58  ETACSGLGADVKAAPILAETMRNLYDGVPLDEVYKAAILAARTLIEKDPDYTYATARLLF 117

Query: 226 EKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDL 285
             + REVL       +     +MQ  Y +YF  +I+ G+ A LL E +  FDL  L + L
Sbjct: 118 HTISREVLG------RDVAQADMQEAYADYFPGFIKRGIAAELLDEKLQQFDLKRLGSAL 171

Query: 286 KYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNL 345
           K  RD  F+YLGLQ LYDRYFLH   +RIE+PQAFFMRVAMGL+L E ++E RA+EFY +
Sbjct: 172 KAGRDLQFDYLGLQTLYDRYFLHEGKTRIELPQAFFMRVAMGLSLNEIDREARAIEFYEV 231

Query: 346 LSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWT 405
           LSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT
Sbjct: 232 LSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWT 291

Query: 406 PVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDL 465
            VR LG+HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+L
Sbjct: 292 RVRALGSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLEL 351

Query: 466 RKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENY 525
           RKNTGDDRRRTHDMNTANWIPDLFM+RV +   WTLFSP  V DLHDL+G EFE AY  Y
Sbjct: 352 RKNTGDDRRRTHDMNTANWIPDLFMRRVMEKGTWTLFSPSNVPDLHDLFGAEFEKAYVAY 411

Query: 526 ERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLC 585
           E +A RGEIK  R + A  LWRKMLTMLFETGHPWITFKD CN+RSPQQH GVVHSSNLC
Sbjct: 412 EEKAARGEIKPSRTVQASDLWRKMLTMLFETGHPWITFKDACNVRSPQQHAGVVHSSNLC 471

Query: 586 TEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEK 645
           TEITLN+S  ETAVCNLGS+NLL H  +   D++KL  TI TA+R+LDNVIDIN + ++K
Sbjct: 472 TEITLNTSDTETAVCNLGSVNLLQHLKDGALDHNKLKRTISTAMRMLDNVIDINYYAVKK 531

Query: 646 AKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQER 705
           A+ SN  HR +GLGLM FQ +L+ L IPYAS  AVE AD+SME IS++A  AS +LA+ER
Sbjct: 532 ARDSNMRHRPVGLGLMAFQDSLYELRIPYASDAAVEFADQSMEAISYYAYWASTDLARER 591

Query: 706 GAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCM 764
           G Y S+KGSLWD+GV P D++ +LA  R   + ++R+S L W+ L+ ++   GMRNSNC+
Sbjct: 592 GKYHSYKGSLWDKGVLPPDTLDMLANARGGYVEVDRSSTLDWNALRNKIAADGMRNSNCV 651

Query: 765 AIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDL 824
           AIAPTATI+NI GV  SI+P + NL VKSN+SG+FTV+NS+LV +LK+  LWD+ M+ DL
Sbjct: 652 AIAPTATISNIIGVDASIEPCFGNLSVKSNLSGEFTVINSYLVRDLKRLGLWDDVMVMDL 711

Query: 825 KYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKK 884
           K+ DGS+  I+R+P ++K+++ATAFE++  WL+E+A+RRQKWIDQAQSLN+Y+   SGKK
Sbjct: 712 KHFDGSLSPIDRVPQEIKQLYATAFEVETRWLVEAAARRQKWIDQAQSLNIYMAGASGKK 771

Query: 885 LDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSC 944
           LD  Y+ AWL GLKTTYYLR+ SAT  EKST+      L      D +          + 
Sbjct: 772 LDETYKLAWLRGLKTTYYLRTMSATHAEKSTVTAGLDALQFRHRPDQSVEAGKPSSVDAR 831

Query: 945 TSDTE 949
               +
Sbjct: 832 IQGGD 836


>gi|62185357|ref|YP_220142.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            abortus S26/3]
 gi|62148424|emb|CAH64192.1| putative ribonucleotide reductase large subunit [Chlamydophila
            abortus S26/3]
          Length = 1045

 Score =  830 bits (2143), Expect = 0.0,   Method: Composition-based stats.
 Identities = 480/935 (51%), Positives = 629/935 (67%), Gaps = 16/935 (1%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
            V VI+R+G    F+P KIS A+ KAF A +         +   I  LT + V  +L    
Sbjct: 118  VSVIRRDGSTVKFNPMKISAALEKAFRATQKITDVSIQEILSEINGLTNKIVEEILGVCS 177

Query: 89   SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLK-I 147
                + IE IQD VE  LM  GH+ + + Y+LYRE RS +R  +    +   +  ++  +
Sbjct: 178  PEKTIDIEVIQDIVEKQLMVVGHYDVAKNYILYREARSRIRENKQQIDAQKDLVEEVYDV 237

Query: 148  MMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALIFSS 206
            +  DGT  S N  +L      AC    +    +++    + N Y G+ ES++  A I ++
Sbjct: 238  VKSDGTTYSINKSQLIDKFIWACQRFPETTDPQVLADMAFANFYSGIKESEIALACIMAA 297

Query: 207  RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
            R  IEKEP+YA V A  L++ + +E +       + AT  ++     + F  YI  G + 
Sbjct: 298  RANIEKEPDYAYVAAELLMDVVYQEAMG------KTATDSDLAEAQKQCFKNYILNG-ET 350

Query: 267  RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
              L+  + ++DL  LA  L   RD  F Y+G+Q LYDRYF    G R+E  Q F+MRV+M
Sbjct: 351  YRLNPRLKEYDLDALAEALDISRDQKFSYMGVQNLYDRYFNQHEGLRVETAQIFWMRVSM 410

Query: 327  GLALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFG 385
            GLAL E  +K   A+ FYNLLS+F +  +TPTLFNSGTRH QLSSC+L+T+ DDL  I+ 
Sbjct: 411  GLALNEGDDKTFWAITFYNLLSTFRYTPATPTLFNSGTRHSQLSSCYLSTIQDDLAHIYK 470

Query: 386  ALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRK 445
             + +NAML+K++GG+GNDWT VR  G+ I GTNGKSQGVIPF+KVANDTA+AVNQGGKRK
Sbjct: 471  VISDNAMLSKWAGGIGNDWTGVRATGSLIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRK 530

Query: 446  GAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPD 505
            GA   YLETWH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ Q   WTLFSPD
Sbjct: 531  GATSVYLETWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEQQGMWTLFSPD 590

Query: 506  EVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKD 565
            +V  LH+ YG EF+  YE YE + D GEIK+++KI A  LWRKML+ML+ETGHPW+TFKD
Sbjct: 591  DVPGLHEAYGTEFDKLYEEYESKIDTGEIKLYKKIPAADLWRKMLSMLYETGHPWMTFKD 650

Query: 566  PCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTI 625
            P NIR+ Q HVGVV  SNLCTEI LN S  ETAVCNLGS+NL+ H  N   +  KL  TI
Sbjct: 651  PSNIRAVQDHVGVVRCSNLCTEILLNCSENETAVCNLGSVNLVEHIENGDINEKKLEETI 710

Query: 626  RTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADE 685
              A+R+LDNVID+N +  ++A  +N +HRAIGLG+MGFQ AL+ L+I YASPEAVE AD+
Sbjct: 711  SIAIRILDNVIDLNFYPTQEAANANLSHRAIGLGIMGFQDALYKLNISYASPEAVEFADK 770

Query: 686  SMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSR 743
            S E ++++AI +S  LA+ERG YSS+KGS WD+G  P+D+I LL E R E  + M+ + R
Sbjct: 771  SSELVAYYAILSSSLLAKERGTYSSYKGSKWDRGYLPLDTIELLKEYRGEENVLMDTSCR 830

Query: 744  LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
              W  +++ +K+ GMRNS+ MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT+ N
Sbjct: 831  KDWTPVREAIKSYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFTIPN 890

Query: 804  SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
             +L+++LK+  LWD+ M+ DLKY DGS+  IERIPDDLKKI  TAFEI+P WLIE ASRR
Sbjct: 891  VYLISKLKELGLWDDDMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEWLIECASRR 950

Query: 864  QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK----GV 919
            QKWID  QSLNLYL EP+GKKL  +Y  AW  GLKTTYYLRS +ATSVEKS       G+
Sbjct: 951  QKWIDMGQSLNLYLSEPNGKKLSAMYLTAWKKGLKTTYYLRSSAATSVEKSFTDINKRGI 1010

Query: 920  DGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
              +         +           C+ +  CE CQ
Sbjct: 1011 QPRWMKNKSASTSIVVDRAKKTPVCSFEEGCESCQ 1045



 Score =  132 bits (332), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 96/237 (40%), Gaps = 27/237 (11%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEG--KGASRSIRVQDIIKNLTEQTVTR 82
           K K   V+KRNG    F+  +I +A+  AF         +     +++ I ++T + V  
Sbjct: 5   KEKHYTVVKRNGMFVPFNQERIFQALEAAFRDTRSLENDSPLPKDLENAISDITHRVVNE 64

Query: 83  LLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA 142
           ++Q  +   +V +E IQD VE  L  +G   + R+Y++YR+   + R             
Sbjct: 65  VIQKIREGQVVTVERIQDMVENQLYVNGLQDVARDYIIYRDHHKEQRE---------GSW 115

Query: 143 PKLKIMMDDGTLISFNSKRLEMIVE---EACSGLQDVSSKIVLSETYKNMYDGL------ 193
             + ++  DG+ + FN  ++   +E    A   + DVS + +LSE    + + +      
Sbjct: 116 HCVSVIRRDGSTVKFNPMKISAALEKAFRATQKITDVSIQEILSEI-NGLTNKIVEEILG 174

Query: 194 ---SESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHE 247
               E  ++  +I            +  V        L RE  + + +  Q+    +
Sbjct: 175 VCSPEKTIDIEVIQDIVEKQLMVVGHYDVAKN---YILYREARSRIRENKQQIDAQK 228


>gi|330443802|ref|YP_004376788.1| ribonucleoside-diphosphate reductase subunit alpha [Chlamydophila
            pecorum E58]
 gi|328806912|gb|AEB41085.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila
            pecorum E58]
          Length = 1047

 Score =  825 bits (2130), Expect = 0.0,   Method: Composition-based stats.
 Identities = 484/939 (51%), Positives = 633/939 (67%), Gaps = 18/939 (1%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLL-Q 85
            +GV +I+R+G    F+P KIS A+ KAF A               I  LT + V  ++ Q
Sbjct: 116  RGVLIIRRDGTSVKFNPMKISAALEKAFRATLQINGITPSPTVLEINELTLKIVEEIMAQ 175

Query: 86   HNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDA--PIAP 143
            H   A  +HIE IQD VE  LM +G + + + Y+LYRE R   R  +    +        
Sbjct: 176  HVGKAHGIHIEAIQDIVEKQLMIAGFYDVAKSYILYREARMRARENKVSEVNSECFVEDE 235

Query: 144  KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETAL 202
              +++ +D T    N   LE     AC+   +  SSK +    + N++ G+ ES++ +A 
Sbjct: 236  VYRVVREDQTEYLLNKAELEKRFTWACARFPETTSSKTLADMAFANLFSGVKESEVVSAC 295

Query: 203  IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
            I ++R  IEKEP+YA V A  L E + +E +         A   ++   +  YF +YI E
Sbjct: 296  IMAARANIEKEPDYAFVAADLLHEVVYQETVG------LSAVSSKLTDAHRRYFKQYILE 349

Query: 263  GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
            G +   L+  + ++DL  LA  L   RD  F Y+G+Q L+DRYF    G R+E  Q F+M
Sbjct: 350  G-ENYRLNPQLKEYDLDALAEVLDLTRDRKFSYMGVQNLFDRYFNQHEGKRLETAQIFWM 408

Query: 323  RVAMGLALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLY 381
            RV+MGLAL E  EK   A+ FY+LLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL 
Sbjct: 409  RVSMGLALNEGKEKTSWAITFYHLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVKDDLQ 468

Query: 382  GIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQG 441
             I+  + +NA+L+K++GG+GNDWT VR  GA I GTNGKSQGVIPF+KVANDTAVAVNQG
Sbjct: 469  HIYKVISDNALLSKWAGGIGNDWTDVRARGAKIKGTNGKSQGVIPFIKVANDTAVAVNQG 528

Query: 442  GKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTL 501
            GKRKGA C YLE+WH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ Q   WTL
Sbjct: 529  GKRKGAACVYLESWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLKQKGIWTL 588

Query: 502  FSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWI 561
            FSPD+V  LH+ YG EFE  YE YE++ + GEI+++RK+ A  LWRKML+ML+ETGHPW+
Sbjct: 589  FSPDDVPGLHEAYGLEFEKLYEEYEQKIETGEIQLYRKVEAEVLWRKMLSMLYETGHPWL 648

Query: 562  TFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKL 621
            TFKDP NIR+ Q HVGVV  SNLCTEI LNSS  ETAVCNLGS+NL+ H  N + +  KL
Sbjct: 649  TFKDPSNIRAAQDHVGVVRCSNLCTEILLNSSESETAVCNLGSLNLVEHLENGEINEAKL 708

Query: 622  ASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVE 681
            A TIR AVR+LDNVID+N + I +A ++N THRA+GLG MGFQ AL+  +I YAS EAVE
Sbjct: 709  AETIRIAVRILDNVIDLNFYPIPEAAQANLTHRAVGLGCMGFQDALYEKNISYASQEAVE 768

Query: 682  IADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAM--N 739
             ADE  E I++HAI +S ELA+ERG Y+S+KGS WD+G+ PID+I LL + R E  +  +
Sbjct: 769  FADEVAEIIAYHAILSSTELAKERGVYASYKGSKWDRGLLPIDTIDLLKQARGEQYVLMD 828

Query: 740  RTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDF 799
             + R  W+ +++ V+  GMRNS+ M IAPTATI+NI G++QSI+P+Y+NL+VKSN+SG+F
Sbjct: 829  TSCRKDWEPVREAVRKYGMRNSHLMTIAPTATISNIIGITQSIEPTYKNLFVKSNLSGEF 888

Query: 800  TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
            T+ N +L+ +LK   LWDE M+ DLKY DGS+  IERIP++LKK+  TAFEI+P WLIE 
Sbjct: 889  TIPNVYLIRKLKSLGLWDEDMLDDLKYFDGSLSEIERIPENLKKVFVTAFEIEPEWLIEC 948

Query: 860  ASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK-- 917
            ASRRQKWID  QSLNLYL EP+GKKL  +Y  AW  GLKTTYYLRS +ATSVEKS     
Sbjct: 949  ASRRQKWIDMGQSLNLYLAEPNGKKLSTMYLTAWEKGLKTTYYLRSLAATSVEKSFTDIN 1008

Query: 918  --GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
              G+  +         +         + C+ +  CE CQ
Sbjct: 1009 KRGIQPRWMKNMSASTSIIVERTAKNAVCSMEEGCESCQ 1047



 Score =  124 bits (312), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 37/191 (19%), Positives = 78/191 (40%), Gaps = 21/191 (10%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEG--KGASRSIRVQDIIKNLTEQTVTR 82
           K K   ++KRNG    F+  +I +A+  AF       + A     ++  I ++T + V  
Sbjct: 5   KEKHYTIVKRNGMFVPFNQDRIFQALEAAFRDTRSLEEDAPLPKDLEKSISDITSKVVGE 64

Query: 83  LLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA 142
           +++      +V +E IQD VE  L  +G   + R+Y++YR++  + R             
Sbjct: 65  VIEKISQGQVVTVERIQDIVESQLYVNGLQDVARDYIVYRDQHKEQRE---------SPW 115

Query: 143 PKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETAL 202
             + I+  DGT + FN  ++   +E+A             +     +    +  ++    
Sbjct: 116 RGVLIIRRDGTSVKFNPMKISAALEKAFR----------ATLQINGITPSPTVLEINELT 165

Query: 203 IFSSRTLIEKE 213
           +     ++ + 
Sbjct: 166 LKIVEEIMAQH 176


>gi|254444373|ref|ZP_05057849.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
            [Verrucomicrobiae bacterium DG1235]
 gi|198258681|gb|EDY82989.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
            [Verrucomicrobiae bacterium DG1235]
          Length = 1062

 Score =  821 bits (2120), Expect = 0.0,   Method: Composition-based stats.
 Identities = 430/938 (45%), Positives = 591/938 (63%), Gaps = 35/938 (3%)

Query: 26   IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQ 85
            +K V++I+R+  V  +   KI  A+ +AF+++E           ++   +TE+       
Sbjct: 151  LKNVRLIRRDRKVVPWKQEKIEIAVRRAFLSLEQNSDPAV----EVAAIVTERIQAT--- 203

Query: 86   HNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKL 145
                   V IE++QD V+  LM+ GH K+   YVLYRE+R   R  ++   +       +
Sbjct: 204  ---GQAFVEIEEVQDIVQEELMKQGHFKVAAHYVLYREQRRAHREQEALQLATDTEQDSM 260

Query: 146  KIMMD-DGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALI 203
             ++   DG+   ++   L+  +E A  GL   ++   +  E  ++++D +SE+DLE  + 
Sbjct: 261  VVVKKTDGSTYFWDGIDLKKRIEFASIGLDLCLNHDEIEIELRRSIFDEISEADLEKTIT 320

Query: 204  FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
             ++RTLIE++ ++AK  AR  L  + +E L     +        ++  + + F  Y+  G
Sbjct: 321  LNARTLIEQDADFAKFAARIKLSYMYQETLGWDIVRDG---IGAIKTFHQKKFKEYVRHG 377

Query: 264  VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYF----LHINGSRIEMPQA 319
            +    L+  + ++D+  LA  L    D  F+YLG+Q LYDRY           RIE PQ 
Sbjct: 378  IMIGRLNPKLKEYDINKLAKQLDPSADLEFDYLGIQTLYDRYLIIDKTQKQQRRIETPQF 437

Query: 320  FFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDD 379
            F+MRVAMGL   E E+E +A   Y L  S  F  STPTLFN+GT H QLSSC+L  V D 
Sbjct: 438  FWMRVAMGLFHAEEERELKAKTLYKLYKSRRFCSSTPTLFNAGTCHSQLSSCYLYYVDDS 497

Query: 380  LYGIF-GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
            + GI    + +NA L+K++GGLG  WT VRG G++I GTNG+SQG++PFLK+ ND  +AV
Sbjct: 498  IEGIMQRGIADNAYLSKWAGGLGGSWTSVRGTGSYIKGTNGESQGIVPFLKLHNDLLIAV 557

Query: 439  NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
            NQGGKR+G+ CAYLETWH D+ +FL+LRKNTGDDRRR HDMNTANW+PDLFMKR+     
Sbjct: 558  NQGGKRRGSGCAYLETWHNDLYDFLELRKNTGDDRRRCHDMNTANWVPDLFMKRMEARQM 617

Query: 499  WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
            W+ F   EV DLHD YG +FE  Y  YE +A +GEI   +++ A+ +W++ML+M+FETGH
Sbjct: 618  WSFFRTSEVPDLHDSYGADFEKKYTEYEAKAAKGEIW-SKEVPAIEVWKRMLSMIFETGH 676

Query: 559  PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAH-FANNQFD 617
            PWITFKDPCN+RSPQ H GVVHSSNLCTEITLN+S EETAVCNLGSI L  H   +   D
Sbjct: 677  PWITFKDPCNVRSPQDHCGVVHSSNLCTEITLNTSKEETAVCNLGSIVLDQHLDKDGNID 736

Query: 618  YDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASP 677
            +DKL  T++TA+R LDNVIDIN +  E AK +N  HR IGLG+MG Q+ L+L   P+AS 
Sbjct: 737  HDKLRETVQTAIRALDNVIDINFYPTEAAKLANSRHRPIGLGIMGLQNCLYLRDTPFASQ 796

Query: 678  EAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-EL 736
            EAVE  DE ME ++++AI AS +LA ERG Y S+KGS WD+G+ P D++ LL + R  E+
Sbjct: 797  EAVEFNDEIMEAVAYYAIEASSDLAAERGTYKSYKGSKWDRGLLPQDTVDLLEKERGVEV 856

Query: 737  AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
             + R  +L W  ++++V   GMRNSN MAIAPTATI+NI G S  I+P Y+NL+VKSN+S
Sbjct: 857  DVPRGGKLDWTPIREKVTKHGMRNSNVMAIAPTATISNITGTSPCIEPGYKNLFVKSNLS 916

Query: 797  GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
            G+F ++N  LV +LK R LW+  M  +LKY DG +  I+ IP DLK  + TAF +D  WL
Sbjct: 917  GEFIILNQHLVRDLKARGLWNAEMRDNLKYFDGELEEIDSIPADLKAKYKTAFSVDYSWL 976

Query: 857  IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
            + +A+RRQKWIDQ+QS+NL+L  P  K L  +YR AW  GLKTTYYLR+  A+++EK+T+
Sbjct: 977  VLAAARRQKWIDQSQSVNLFLASPDMKTLSHMYRAAWKHGLKTTYYLRTLGASNIEKATV 1036

Query: 917  KGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
                     V                       CE CQ
Sbjct: 1037 GAKKELRGIVGGKAAPPEP------------EVCESCQ 1062



 Score = 46.0 bits (107), Expect = 0.032,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 55/151 (36%), Gaps = 13/151 (8%)

Query: 41  FDPSKISRAIMKAFMAV---EGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA--LIVHI 95
           FD S+I   I  A   V   +      +   +  +  +  Q V +L   +       V +
Sbjct: 53  FDLSEIVDTIGNALANVLLSKNNTEVFTDENRQWVCTVARQVVDKLESKSPETLESRVGL 112

Query: 96  EDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLI 155
            ++ D +E +L+ +  + + +  ++ R         +            ++++  D  ++
Sbjct: 113 SELYDLIENTLVDNNAYDVAKSMLINR--------QRKLVADKTIGLKNVRLIRRDRKVV 164

Query: 156 SFNSKRLEMIVEEACSGLQDVSSKIVLSETY 186
            +  +++E+ V  A   L+  S   V     
Sbjct: 165 PWKQEKIEIAVRRAFLSLEQNSDPAVEVAAI 195


>gi|294055009|ref|YP_003548667.1| ribonucleoside-diphosphate reductase, alpha subunit [Coraliomargarita
            akajimensis DSM 45221]
 gi|293614342|gb|ADE54497.1| ribonucleoside-diphosphate reductase, alpha subunit [Coraliomargarita
            akajimensis DSM 45221]
          Length = 1080

 Score =  820 bits (2117), Expect = 0.0,   Method: Composition-based stats.
 Identities = 425/942 (45%), Positives = 593/942 (62%), Gaps = 29/942 (3%)

Query: 28   GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
             +++I+RNG V  +  SKI  A+ K+F+++           + +   L          +N
Sbjct: 153  SIRLIRRNGQVVPWSESKIEIAVRKSFLSLHLDSGPAMDVARAVTDRL----------NN 202

Query: 88   KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKL-K 146
                 ++IED+QD V+  LM+ GH K+   Y+LYR  R+ +R     ++ D      +  
Sbjct: 203  SGQAFINIEDVQDTVQEELMRQGHFKVAESYILYRAHRTRLRDESGETEVDETQQESMIV 262

Query: 147  IMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALIFS 205
            +  ++G    ++   L+  +E A  GL+  +S+  + +E  +++Y  +   DL+  +I +
Sbjct: 263  VTEENGENTFWDGVDLKRRIEFATIGLELTLSNDEIETELRRSLYPEMKREDLQKTIILN 322

Query: 206  SRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVK 265
            ++ LIE++ ++A+   R LL  +  EVL     +       +++  +      Y++  V+
Sbjct: 323  AKALIERDADFARFAGRVLLSYIYEEVLDWDIVRDG---VEQLKEAHRRGLKTYLKRAVE 379

Query: 266  ARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYF----LHINGSRIEMPQAFF 321
               +H  ++++DL  L+  L    D  F+YLG+Q LYDRY           R+E+PQ F+
Sbjct: 380  IERVHPKLLEYDLKRLSEALDPSADLDFDYLGVQTLYDRYLIVDKTAKKHRRLEVPQFFW 439

Query: 322  MRVAMGLALKET-EKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDL 380
            +RVAMGL   E  ++E   +  YNL  S  F  STPTLFNSGT H QLSSC+L  V D +
Sbjct: 440  IRVAMGLFHAEKEDREGYVISLYNLYKSRRFCSSTPTLFNSGTLHSQLSSCYLYKVDDSI 499

Query: 381  YG-IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVN 439
               +   + +NA L+K++GGLG  WT VRG G  I GTNG+SQGVIPFLK+ ND  VAVN
Sbjct: 500  ESIMHRGIADNAFLSKWAGGLGGSWTAVRGTGGFIKGTNGESQGVIPFLKLHNDQLVAVN 559

Query: 440  QGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGW 499
            QGGKR+G+ CAYLETWH D+ +FL+LRKNTGDDRRRTHDMNTANWIPDLFMKR+     W
Sbjct: 560  QGGKRRGSGCAYLETWHNDIHDFLELRKNTGDDRRRTHDMNTANWIPDLFMKRMEARQDW 619

Query: 500  TLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHP 559
            TLF  +E  DLHDLYGK FE  Y  YE  A+RGE+   +K+ A+ LW+ ML M+FETGHP
Sbjct: 620  TLFRSNETPDLHDLYGKAFEDRYCEYEAMAERGEL-FGKKVPAIELWKSMLRMIFETGHP 678

Query: 560  WITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINL-LAHFANNQFDY 618
            WITFKDPCN+RSPQ H GV+HSSNLCTEITLN+S EETAVCNLGS+ L      +   D+
Sbjct: 679  WITFKDPCNVRSPQDHAGVIHSSNLCTEITLNTSDEETAVCNLGSVVLDSHLDKDGNLDH 738

Query: 619  DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
            +KL  T+  AVR LDNVIDIN +  E AK +N  HR IGLG+MG Q+AL +  I +AS  
Sbjct: 739  EKLRETVSIAVRALDNVIDINFYPTEAAKTANSRHRPIGLGVMGLQNALFVKDIAFASQA 798

Query: 679  AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LA 737
            AVE  DE ME I+++A  AS +LA E G YS++KGS WD+G+ P D++ +L   R E + 
Sbjct: 799  AVEFNDEFMEAIAYYAYEASSDLAAEHGTYSTYKGSKWDRGLMPQDTLDMLQSERGEEVV 858

Query: 738  MNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG 797
            + R  ++ W+ L+ ++   GMRNSN +AIAPTATI+NI G S  I+P+Y+NL+VKSN+SG
Sbjct: 859  VPRAGKMDWNPLRAKIAKQGMRNSNVLAIAPTATISNIMGTSPCIEPTYKNLFVKSNLSG 918

Query: 798  DFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLI 857
            DF V+N  LV +LK R LWD+ M+  LKY DG +  I+ IP DL++ + TAF I+  + I
Sbjct: 919  DFIVLNGHLVRDLKSRGLWDQDMLDQLKYFDGELNAIDGIPADLREKYKTAFTIEYQYFI 978

Query: 858  ESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
            ++A+RRQKWIDQ+QS+NL+L EP  K L  +YR AW  GLKTTYYLR+  A+++EK+T+ 
Sbjct: 979  DAAARRQKWIDQSQSVNLFLAEPDIKTLSHMYRDAWRKGLKTTYYLRTLGASNIEKATVS 1038

Query: 918  GVDGKLNAVPVTDPNSSTHSLGIPSSCTSD-----TECEVCQ 954
                         P    ++     +C+ +      ECE CQ
Sbjct: 1039 VKKEVRGRAGDATPAKKEYTDAEVKACSLEAMMNGGECEACQ 1080


>gi|269302785|gb|ACZ32885.1| ribonucleoside-diphosphate reductase alpha subunit [Chlamydophila
            pneumoniae LPCoLN]
          Length = 1044

 Score =  814 bits (2102), Expect = 0.0,   Method: Composition-based stats.
 Identities = 470/933 (50%), Positives = 622/933 (66%), Gaps = 17/933 (1%)

Query: 31   VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA 90
            +I+R+GG   F+P KIS A+ KAF A               I +LT + V  +L      
Sbjct: 120  IIRRDGGSAKFNPMKISAALEKAFRATLQINGMTPPATLSEINDLTLRIVEDVL-SLHGE 178

Query: 91   LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDA--PIAPKLKIM 148
              +++E+IQD VE  LM +G++ + + Y+LYRE R+  RA +     +   P      + 
Sbjct: 179  GAINLEEIQDIVEKQLMVAGYYDVAKNYILYREARARARANKDQDGQEEFVPQEETYVVQ 238

Query: 149  MDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALIFSSR 207
             +DGT        LE     AC        S+++    + N+Y G+ E ++ TA I ++R
Sbjct: 239  KEDGTTYLLRKTDLEKRFSWACKRFPKTTDSQLLADMAFMNLYSGIKEEEVTTACIMAAR 298

Query: 208  TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
              IE+EP+YA + A  L   L  E L    + P       +  ++ ++F  YI  G +  
Sbjct: 299  ANIEREPDYAFIAAELLTSSLYEETLGCNSQDP------NLSEIHKKHFKEYILNG-EEY 351

Query: 268  LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
             L+  + D+DL  L+  L   RD  F Y+G+Q LYDRYF    G R+E  Q F+MRV+MG
Sbjct: 352  RLNPQLKDYDLDALSEVLDLSRDQQFSYMGVQNLYDRYFNLHEGRRLETAQIFWMRVSMG 411

Query: 328  LALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
            LAL E  +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  I+  
Sbjct: 412  LALNEGEQKNFWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVKDDLSHIYKV 471

Query: 387  LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
            + +NA+L+K++GG+GNDWT VR  GA I GTNGKSQGVIPF+KVANDTA+AVNQGGKRKG
Sbjct: 472  ISDNALLSKWAGGIGNDWTDVRATGAVIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRKG 531

Query: 447  AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
            A+C YLE WH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ +   WTLFSPD+
Sbjct: 532  AMCVYLENWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEKKGMWTLFSPDD 591

Query: 507  VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
            V  LH+ YG EFE  YE YER+ + GEI++++K+ A  LWRKML+ML+ETGHPWITFKDP
Sbjct: 592  VPGLHEAYGLEFEKLYEEYERKVESGEIRLYKKVEAEVLWRKMLSMLYETGHPWITFKDP 651

Query: 567  CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
             NIRS Q HVGVV  SNLCTEI LN S  ETAVCNLGSINL+ H  N + D +KL  TI 
Sbjct: 652  SNIRSNQDHVGVVRCSNLCTEILLNCSESETAVCNLGSINLVEHIRNGKLDEEKLKETIS 711

Query: 627  TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
             A+R+LDNVID+N +   +AK++N THRA+GLG+MGFQ  L+ L+I YAS EAVE +DE 
Sbjct: 712  IAIRILDNVIDLNFYPTPEAKQANLTHRAVGLGVMGFQDVLYELNISYASQEAVEFSDEC 771

Query: 687  MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELA--MNRTSRL 744
             E I+++AI AS  LA+ERG Y+S+ GS WD+G  P+D+I LL E R E    ++ +S+ 
Sbjct: 772  SEIIAYYAILASSLLAKERGTYASYSGSKWDRGYLPLDTIELLKETRGEHNVLVDTSSKK 831

Query: 745  PWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNS 804
             W  ++  ++  GMRNS  MAIAPTATI+NI GV+QSI+P Y++L+VKSN+SG+FT+ N+
Sbjct: 832  DWTPVRDTIQKYGMRNSQVMAIAPTATISNIIGVTQSIEPMYKHLFVKSNLSGEFTIPNT 891

Query: 805  FLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQ 864
            +L+ +LK+  LWD  M+ DLKY DGS+  IERIP+ LKK+  TAFEI+P W+IE  SRRQ
Sbjct: 892  YLIKKLKELGLWDAEMLDDLKYFDGSLLEIERIPNHLKKLFLTAFEIEPEWIIECTSRRQ 951

Query: 865  KWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLN 924
            KWID   SLNLYL EP GKKL  +Y  AW  GLKTTYYLRS++ATSVEKS +      + 
Sbjct: 952  KWIDMGVSLNLYLAEPDGKKLSNMYLMAWKKGLKTTYYLRSQAATSVEKSFIDINKRGIQ 1011

Query: 925  AVPVTDPNSSTH---SLGIPSSCTSDTECEVCQ 954
               + + ++ST           C+ +  CE CQ
Sbjct: 1012 PRWMKNKSASTSIVVERKTTPVCSMEEGCESCQ 1044



 Score =  126 bits (316), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/236 (19%), Positives = 82/236 (34%), Gaps = 37/236 (15%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEG--KGASRSIRVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    F+  +I +A+  AF         +     +++ I  +T + V  +L
Sbjct: 7   KHYTIVKRNGMFVPFNQDRIFQALEAAFRDTRSLETSSPLPKDLEESIAQITHKVVKEVL 66

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
                  +V +E IQD VE  L  SG   + R+Y++YR++R   R            +  
Sbjct: 67  AKISEGQVVTVERIQDLVESQLYISGLQDVARDYIVYRDQRKAER---------GNSSSI 117

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIF 204
           + I+  DG    FN  ++   +E+A             +     M    + S++    + 
Sbjct: 118 IAIIRRDGGSAKFNPMKISAALEKAFR----------ATLQINGMTPPATLSEINDLTLR 167

Query: 205 SSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYI 260
                               +  L  E    + +         M   Y +    YI
Sbjct: 168 IVED----------------VLSLHGEGAINLEEIQDIVEKQLMVAGYYDVAKNYI 207


>gi|15618892|ref|NP_225178.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            pneumoniae CWL029]
 gi|15836515|ref|NP_301039.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            pneumoniae J138]
 gi|16752044|ref|NP_445410.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            pneumoniae AR39]
 gi|33242352|ref|NP_877293.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            pneumoniae TW-183]
 gi|7388068|sp|Q9Z6S5|RIR1_CHLPN RecName: Full=Ribonucleoside-diphosphate reductase subunit alpha;
            AltName: Full=Ribonucleotide reductase
 gi|4377312|gb|AAD19121.1| Ribonucleoside Reductase, Large Chain [Chlamydophila pneumoniae
            CWL029]
 gi|7189784|gb|AAF38661.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila
            pneumoniae AR39]
 gi|8979357|dbj|BAA99191.1| ribonucleoside reductase, large chain [Chlamydophila pneumoniae J138]
 gi|33236863|gb|AAP98950.1| ribonucleoside reductase large chain [Chlamydophila pneumoniae
            TW-183]
          Length = 1044

 Score =  811 bits (2094), Expect = 0.0,   Method: Composition-based stats.
 Identities = 470/933 (50%), Positives = 623/933 (66%), Gaps = 17/933 (1%)

Query: 31   VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA 90
            +I+R+GG   F+P KIS A+ KAF A               I +LT + V  +L      
Sbjct: 120  IIRRDGGSAKFNPMKISAALEKAFRATLQINGMTPPATLSEINDLTLRIVEDVL-SLHGE 178

Query: 91   LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDA--PIAPKLKIM 148
              +++E+IQD VE  LM +G++ + + Y+LYRE R+  RA +     +   P      + 
Sbjct: 179  EAINLEEIQDIVEKQLMVAGYYDVAKNYILYREARARARANKDQDGQEEFVPQEETYVVQ 238

Query: 149  MDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALIFSSR 207
             +DGT        LE     AC        S+++    + N+Y G+ E ++ TA I ++R
Sbjct: 239  KEDGTTYLLRKTDLEKRFSWACKRFPKTTDSQLLADMAFMNLYSGIKEDEVTTACIMAAR 298

Query: 208  TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
              IE+EP+YA + A  L   L  E L    + P       +  ++ ++F  YI  G +  
Sbjct: 299  ANIEREPDYAFIAAELLTSSLYEETLGCSSQDP------NLSEIHKKHFKEYILNG-EEY 351

Query: 268  LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
             L+  + D+DL  L+  L   RD  F Y+G+Q LYDRYF    G R+E  Q F+MRV+MG
Sbjct: 352  RLNPQLKDYDLDALSEVLDLSRDQQFSYMGVQNLYDRYFNLHEGRRLETAQIFWMRVSMG 411

Query: 328  LALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
            LAL E  +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  I+  
Sbjct: 412  LALNEGEQKNFWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVKDDLSHIYKV 471

Query: 387  LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
            + +NA+L+K++GG+GNDWT VR  GA I GTNGKSQGVIPF+KVANDTA+AVNQGGKRKG
Sbjct: 472  ISDNALLSKWAGGIGNDWTDVRATGAVIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRKG 531

Query: 447  AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
            A+C YLE WH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ +   WTLFSPD+
Sbjct: 532  AMCVYLENWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEKKGMWTLFSPDD 591

Query: 507  VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
            V  LH+ YG EFE  YE YER+ + GEI++++K+ A  LWRKML+ML+ETGHPWITFKDP
Sbjct: 592  VPGLHEAYGLEFEKLYEEYERKVESGEIRLYKKVEAEVLWRKMLSMLYETGHPWITFKDP 651

Query: 567  CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
             NIRS Q HVGVV  SNLCTEI LN S  ETAVCNLGSINL+ H  N++ D +KL  TI 
Sbjct: 652  SNIRSNQDHVGVVRCSNLCTEILLNCSESETAVCNLGSINLVEHIRNDKLDEEKLKETIS 711

Query: 627  TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
             A+R+LDNVID+N +   +AK++N THRA+GLG+MGFQ  L+ L+I YAS EAVE +DE 
Sbjct: 712  IAIRILDNVIDLNFYPTPEAKQANLTHRAVGLGVMGFQDVLYELNISYASQEAVEFSDEC 771

Query: 687  MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELA--MNRTSRL 744
             E I+++AI AS  LA+ERG Y+S+ GS WD+G  P+D+I LL E R E    ++ +S+ 
Sbjct: 772  SEIIAYYAILASSLLAKERGTYASYSGSKWDRGYLPLDTIELLKETRGEHNVLVDTSSKK 831

Query: 745  PWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNS 804
             W  ++  ++  GMRNS  MAIAPTATI+NI GV+QSI+P Y++L+VKSN+SG+FT+ N+
Sbjct: 832  DWTPVRDTIQKYGMRNSQVMAIAPTATISNIIGVTQSIEPMYKHLFVKSNLSGEFTIPNT 891

Query: 805  FLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQ 864
            +L+ +LK+  LWD  M+ DLKY DGS+  IERIP+ LKK+  TAFEI+P W+IE  SRRQ
Sbjct: 892  YLIKKLKELGLWDAEMLDDLKYFDGSLLEIERIPNHLKKLFLTAFEIEPEWIIECTSRRQ 951

Query: 865  KWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLN 924
            KWID   SLNLYL EP GKKL  +Y  AW  GLKTTYYLRS++ATSVEKS +      + 
Sbjct: 952  KWIDMGVSLNLYLAEPDGKKLSNMYLTAWKKGLKTTYYLRSQAATSVEKSFIDINKRGIQ 1011

Query: 925  AVPVTDPNSSTH---SLGIPSSCTSDTECEVCQ 954
               + + ++ST           C+ +  CE CQ
Sbjct: 1012 PRWMKNKSASTSIVVERKTTPVCSMEEGCESCQ 1044



 Score =  126 bits (317), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/194 (20%), Positives = 75/194 (38%), Gaps = 21/194 (10%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEG--KGASRSIRVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    F+  +I +A+  AF         +     +++ I  +T + V  +L
Sbjct: 7   KHYTIVKRNGMFVPFNQDRIFQALEAAFRDTRSLETSSPLPKDLEESIAQITHKVVKEVL 66

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
                  +V +E IQD VE  L  SG   + R+Y++YR++R   R            +  
Sbjct: 67  AKISEGQVVTVERIQDLVESQLYISGLQDVARDYIVYRDQRKAER---------GNSSSI 117

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIF 204
           + I+  DG    FN  ++   +E+A             +     M    + S++    + 
Sbjct: 118 IAIIRRDGGSAKFNPMKISAALEKAFR----------ATLQINGMTPPATLSEINDLTLR 167

Query: 205 SSRTLIEKEPNYAK 218
               ++      A 
Sbjct: 168 IVEDVLSLHGEEAI 181


>gi|72163400|ref|YP_291057.1| ribonucleoside-diphosphate reductase [Thermobifida fusca YX]
 gi|71917132|gb|AAZ57034.1| ribonucleoside-diphosphate reductase [Thermobifida fusca YX]
          Length = 821

 Score =  806 bits (2081), Expect = 0.0,   Method: Composition-based stats.
 Identities = 523/821 (63%), Positives = 637/821 (77%), Gaps = 25/821 (3%)

Query: 159 SKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAK 218
            +R+  +V EAC GL   S++ V++E  +  Y G++ ++LE ALI ++RT +E +P+Y+ 
Sbjct: 1   MERIRKVVAEACQGLPGASAETVIAEATRGFYPGITPAELELALIMAARTFVETDPDYSY 60

Query: 219 VTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDL 278
           V+AR LL+KLRRE LT +   P +ATH +M   YPEY   +I  G++   L   + DFDL
Sbjct: 61  VSARLLLDKLRREALTFLSGHPDEATHADMARRYPEYLRAFITRGIELEHLTPELADFDL 120

Query: 279 VYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKR 338
             L   L+ ERD  F YLGLQ LYDRYFLH  G+R E+PQAF MRVAMG+AL E ++  R
Sbjct: 121 DRLGAALRPERDLNFTYLGLQTLYDRYFLHHEGTRYELPQAFLMRVAMGVALHEDDRNAR 180

Query: 339 AVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSG 398
           A+EFY LLSSF FMCSTPTLFN+GTR PQLSSCFLTTV DDL  IF A+  NA+L+KYSG
Sbjct: 181 AIEFYELLSSFDFMCSTPTLFNAGTRRPQLSSCFLTTVGDDLAEIFRAISNNALLSKYSG 240

Query: 399 GLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHID 458
           GLGNDWTPVRGLGAHI GTNGKSQGV+PFLK+ANDTAVAVNQGGKRKGAVCAYLETWHID
Sbjct: 241 GLGNDWTPVRGLGAHIKGTNGKSQGVVPFLKIANDTAVAVNQGGKRKGAVCAYLETWHID 300

Query: 459 VEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEF 518
           +EEFLDLRKNTGD+RRRTHDMNTANW+PDLF++RV  +A WTLFSPDEV DLHD YG++F
Sbjct: 301 IEEFLDLRKNTGDERRRTHDMNTANWVPDLFLERVESDAQWTLFSPDEVPDLHDRYGEDF 360

Query: 519 EIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGV 578
             AY  YER ADRGEI+VFR++ AV LWR+MLTMLFETGHPWITFKDPCN+RSPQQH GV
Sbjct: 361 ARAYVAYERAADRGEIRVFRRVRAVDLWRRMLTMLFETGHPWITFKDPCNLRSPQQHAGV 420

Query: 579 VHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDI 638
           VHSSNLCTEITLN+S +E AVCNLGS+NL  H   +  D ++L  T+RTAVR+LDNVID+
Sbjct: 421 VHSSNLCTEITLNTSLDEVAVCNLGSVNLANHVGPDGLDAERLRRTVRTAVRMLDNVIDV 480

Query: 639 NCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISAS 698
           N +TI +A+++N  HR IGLGLMG+Q AL  L +P ASPEAVE ADESME +S++AI AS
Sbjct: 481 NLYTIPEAERANMRHRPIGLGLMGYQDALFTLRLPVASPEAVEFADESMELLSYYAIEAS 540

Query: 699 VELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV-RDELAMNRTSRLPWDELKKRVKTIG 757
            +LA ERG+YSSF+GSLW +G+ PIDS+ LLAE  R +L ++RT RL WD L+++V+T G
Sbjct: 541 ADLAAERGSYSSFEGSLWSRGILPIDSLELLAEARRGDLDVDRTQRLDWDTLREKVRTTG 600

Query: 758 MRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWD 817
           MRNSN MAIAPTATIANI GV+ SI+P Y+NLYVK+NMSGDFTVVN  LV +LK+R LWD
Sbjct: 601 MRNSNVMAIAPTATIANIVGVNPSIEPLYRNLYVKANMSGDFTVVNPSLVRDLKERGLWD 660

Query: 818 EAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYL 877
           E M++ LK HDGS+G I+R+P+DLK ++ATAFEIDP+WL+++ASRRQKWIDQAQSLNLY+
Sbjct: 661 EEMVTALKLHDGSLGPIDRVPEDLKNLYATAFEIDPIWLVDAASRRQKWIDQAQSLNLYM 720

Query: 878 DEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTH- 936
            EPSG+KLD +YR+AW  GLKTTYYLRS+ AT VEKSTL+G DG+LNAV     ++ +  
Sbjct: 721 AEPSGRKLDELYRRAWRKGLKTTYYLRSQGATHVEKSTLRGTDGRLNAVTPVAVSAPSPS 780

Query: 937 -----------------------SLGIPSSCTSDTECEVCQ 954
                                  +         D ECE CQ
Sbjct: 781 PTPAPRPAAAPPRSAAGPAPDLTAEAAAFCAVDDPECEACQ 821


>gi|171913277|ref|ZP_02928747.1| ribonucleotide-diphosphate reductase subunit alpha [Verrucomicrobium
            spinosum DSM 4136]
          Length = 1109

 Score =  796 bits (2056), Expect = 0.0,   Method: Composition-based stats.
 Identities = 413/971 (42%), Positives = 591/971 (60%), Gaps = 43/971 (4%)

Query: 13   DAFPSLAYPFP-EKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDI 71
            ++        P   +   ++I+RNG V S++P+KI  A+ KAF++VE            +
Sbjct: 153  ESMSDTEANAPVGLLVPTKIIRRNGQVVSWNPNKIELAVSKAFVSVEMGTTHAKA----V 208

Query: 72   IKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERS--DVR 129
             + LT Q +    Q       +HIE +QD VE  LM+ GH K  + Y+LYR  R+    R
Sbjct: 209  AEALTHQMIEEAKQ------FIHIEQVQDLVEEQLMRQGHFKAAKAYMLYRALRADSRER 262

Query: 130  AAQS-------HSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIV 181
             A+S           D      + + + D   I ++   L+  ++ A  GL   +S   +
Sbjct: 263  DAKSAADISAPELPVDDGQQEMIMVRISDKETILWDGLDLQRRIDFAMMGLDLCISRAEI 322

Query: 182  LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
             S   +++   +S   L+  +I +++ L+ ++ ++A+  AR LL  +  EVL     +  
Sbjct: 323  ESSLRRSLATDISLDHLKQTIILNAKALMARDADFARFAARILLSYIYEEVLGWDIVRDG 382

Query: 242  KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
                  +Q  +   F R ++ GV+   ++  ++DFDL  LA+ L    D  F+YLG+  L
Sbjct: 383  ---IGSLQTFHRRAFRRNLQRGVEIDRINAKLLDFDLDKLADALDPAADMDFDYLGIHTL 439

Query: 302  YDRYFLHING----SRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPT 357
            YDRY +         R+E PQ F+MRVAMGL ++E +  ++ +  Y +  S  F  STPT
Sbjct: 440  YDRYLIIDKKTKPAKRLETPQLFWMRVAMGLFVREEDPTEKVIALYRMYKSRRFCSSTPT 499

Query: 358  LFNSGTRHPQLSSCFLTTVPDDLYGIF-GALQENAMLAKYSGGLGNDWTPVRGLGAHIHG 416
            LFNSGT H QLSSC+L  V D++  I    + ENA L+K++GGLG  WT VRG G++I G
Sbjct: 500  LFNSGTLHSQLSSCYLYKVDDNIESIMIRGIAENAFLSKWAGGLGGSWTAVRGTGSYIKG 559

Query: 417  TNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRT 476
            TNG+SQGVIPFLK+ ND  VAVNQGGKR+G+ CAYLETWH D+ +FLDLRKN GD+RRRT
Sbjct: 560  TNGESQGVIPFLKLHNDQLVAVNQGGKRRGSGCAYLETWHNDIVDFLDLRKNVGDERRRT 619

Query: 477  HDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKV 536
            HDMNTANW+PDLFMKR+   + WTLF  +E  DLH+LYG+ FE  Y  YE  A  G++ +
Sbjct: 620  HDMNTANWVPDLFMKRMEARSHWTLFRANETPDLHELYGQAFEKRYLEYEAMAAEGKV-L 678

Query: 537  FRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEE 596
             ++I A+ LW+ ML  +FETGHPWITFKDPCN+RSPQ H GV+HSSNLCTEITLN+S +E
Sbjct: 679  GKQIPAIDLWKSMLKAIFETGHPWITFKDPCNVRSPQDHAGVIHSSNLCTEITLNTSKDE 738

Query: 597  TAVCNLGSINLLAH-FANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRA 655
            TAVCNLGS+ L  H       D+ KL  T+R AVR LDNVIDIN +  + AK +N  HR 
Sbjct: 739  TAVCNLGSVILENHLDEAGNIDHTKLRETVRMAVRALDNVIDINFYPTDAAKTANTRHRP 798

Query: 656  IGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSL 715
            IGLG+MG Q +L+   +P+AS EAV+  DE ME ++++A  AS +LA E G YS++ GS 
Sbjct: 799  IGLGVMGLQYSLYRKGLPFASKEAVDFNDEVMEAVAYYAYEASSDLAAELGKYSTYPGSK 858

Query: 716  WDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
            W +G+ P D++ LL + R   + + R  ++ W  +++++   GMRNSN +AIAPTATI+N
Sbjct: 859  WSRGLLPQDTVDLLEKERGEPVDVVRGGKMDWSPVREKIAKQGMRNSNVLAIAPTATISN 918

Query: 775  ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
            I G S  I+P + N + KSN+ G++ V+N +LV +LK+RDLW   +   LKY DG +  +
Sbjct: 919  IMGSSPCIEPLFTNNFTKSNLGGNYVVLNPYLVKDLKKRDLWTNEVAERLKYFDGELAAM 978

Query: 835  ERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWL 894
            + IP DLK+ +ATAF +D  +++++A+RRQKWIDQ+QS+NL+  +   + L  +YR AW 
Sbjct: 979  DEIPADLKRKYATAFSVDWAYVLDAAARRQKWIDQSQSVNLWCPDTDMRTLSHMYRAAWR 1038

Query: 895  MGLKTTYYLRSRSATSVEKSTLK-----------GVDGKLNAVPVTDPNSSTHSLGIPSS 943
             GLKTTYYLR++ A+S+E ST +                 +   V               
Sbjct: 1039 KGLKTTYYLRTKGASSIEGSTTQVQTDIRGVVAQTAAAVADKAKVDADEYKQFLAEARRK 1098

Query: 944  CTSDTECEVCQ 954
              +  +CE+CQ
Sbjct: 1099 AQAGEDCEMCQ 1109



 Score = 42.9 bits (99), Expect = 0.25,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 47/113 (41%), Gaps = 9/113 (7%)

Query: 57  VEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITR 116
           V+      +  + +  K   E+    LL      +   IE +       L++   H + R
Sbjct: 91  VKVFSLQVAQELHERAKRNAEKVGDELLSLTAQEIYHAIEHV-------LVKQNAHDVAR 143

Query: 117 EYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEA 169
             V+ R +R +  +    +     + P  KI+  +G ++S+N  ++E+ V +A
Sbjct: 144 S-VIARRQRLESMSDTEANAPVGLLVPT-KIIRRNGQVVSWNPNKIELAVSKA 194


>gi|284032752|ref|YP_003382683.1| ribonucleoside-diphosphate reductase subunit alpha [Kribbella
           flavida DSM 17836]
 gi|283812045|gb|ADB33884.1| ribonucleoside-diphosphate reductase, alpha subunit [Kribbella
           flavida DSM 17836]
          Length = 806

 Score =  781 bits (2016), Expect = 0.0,   Method: Composition-based stats.
 Identities = 502/802 (62%), Positives = 628/802 (78%), Gaps = 9/802 (1%)

Query: 154 LISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKE 213
             + N +RL ++V EA +GL  V  +++L+ET  + YDG+ + ++E AL+ ++RT +E+E
Sbjct: 13  TAALNVERLRLMVAEASAGLDAVDPELILTETLGSCYDGIPQHEVELALVMAARTYVEQE 72

Query: 214 PNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESM 273
           P Y++  AR LL+++RREVL  V+ +P++A+  +M+  Y  YF RY+  G++A LL   +
Sbjct: 73  PQYSQAAARLLLDQIRREVLGRVHGEPRQASQADMRTAYAGYFPRYLAVGIEAGLLDHEL 132

Query: 274 MDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKET 333
             FDL  LA  ++ ERD  F +LGLQ LYDRY LHI+ +R E+PQAFF+RVAMG+ALKE 
Sbjct: 133 ASFDLDRLAAAIRPERDLDFTFLGLQTLYDRYLLHIDKTRFELPQAFFLRVAMGMALKEH 192

Query: 334 EKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAML 393
           ++E RA+EFY LLSSF FM STPTLFN+GT  PQLSSCFLTTV DDL GIF  ++ NA+L
Sbjct: 193 DREARALEFYELLSSFRFMSSTPTLFNAGTTRPQLSSCFLTTVEDDLAGIFTGIRNNALL 252

Query: 394 AKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLE 453
           AKYSGGLGNDWTP+RG+GA I GTNG+SQGV+PFLK+ANDTA+AV+QGGKRKGAVCAYLE
Sbjct: 253 AKYSGGLGNDWTPIRGIGATIRGTNGESQGVVPFLKIANDTAIAVHQGGKRKGAVCAYLE 312

Query: 454 TWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDL 513
           TWH+DVE+FL+LRKNTGD+RRRTHDMNTANW+PDLF++RV  +AGWTLFSPDEV  LHDL
Sbjct: 313 TWHVDVEQFLELRKNTGDERRRTHDMNTANWVPDLFLQRVEADAGWTLFSPDEVPGLHDL 372

Query: 514 YGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQ 573
           YG  F  AYE YER ADRGEI+VFR++ AV LWR+MLT+LFETGHPWITFKD CN+RSPQ
Sbjct: 373 YGAAFAAAYEQYERAADRGEIRVFRRVRAVDLWRRMLTVLFETGHPWITFKDACNLRSPQ 432

Query: 574 QHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLD 633
           QH GVVHSSNLCTEITLN++ +ETAVCNLGS+NL+AH      D   L  T+RTAVR+LD
Sbjct: 433 QHDGVVHSSNLCTEITLNTTVDETAVCNLGSVNLVAHLTPAGLDAGLLRDTVRTAVRMLD 492

Query: 634 NVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFH 693
           NVID+N +T  +++++N  HR +GLGLMGF  AL  L +PYAS  AV  AD SME +S+H
Sbjct: 493 NVIDVNFYTTPESERANQRHRPVGLGLMGFADALFALRVPYASDAAVAFADTSMEQLSYH 552

Query: 694 AISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKR 752
           AI AS +LA ERG Y ++ GSLW QG+ PIDS+ LL E R  +L ++ ++ L WD L+ +
Sbjct: 553 AIEASSDLAAERGTYRTYDGSLWSQGILPIDSVELLREARGGDLDVDTSTTLDWDALRAK 612

Query: 753 VKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQ 812
           V+  GMRNSN +AIAPTATI+NICGVSQSI+P+Y NL+VKSNMSG+FTV N +LV +LK 
Sbjct: 613 VRRDGMRNSNVLAIAPTATISNICGVSQSIEPTYSNLFVKSNMSGEFTVANPYLVADLKA 672

Query: 813 RDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQS 872
           R LWD+ M+ DLKYHDG +  IERIP DL+ ++ATAFEIDP WL+ +ASRRQKWIDQ+QS
Sbjct: 673 RGLWDQRMVDDLKYHDGVLNRIERIPADLRTLYATAFEIDPAWLVAAASRRQKWIDQSQS 732

Query: 873 LNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPN 932
           LNLY+ EPSGK LD +YR AW  GLKTTYYLRS+SAT VEKSTL+G DG+LNAVPV    
Sbjct: 733 LNLYVSEPSGKALDELYRSAWRHGLKTTYYLRSQSATHVEKSTLRGTDGRLNAVPVEPVA 792

Query: 933 SSTHSLGIPSSCTSDTECEVCQ 954
           +             D +CE CQ
Sbjct: 793 AV--------CAIDDQDCEACQ 806


>gi|297563528|ref|YP_003682502.1| ribonucleoside-diphosphate reductase, subunit alpha [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
 gi|296847976|gb|ADH69996.1| ribonucleoside-diphosphate reductase, alpha subunit [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
          Length = 882

 Score =  775 bits (2000), Expect = 0.0,   Method: Composition-based stats.
 Identities = 517/839 (61%), Positives = 617/839 (73%), Gaps = 35/839 (4%)

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
            DG        R+E +V EAC+ L  VS++ VL+E  +  Y G+S++++E AL+ ++R+ 
Sbjct: 45  KDGN-PPAAVDRIEHVVAEACARLTGVSAEKVLTEARRGFYPGISDAEVELALVMAARSF 103

Query: 210 IEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
           +E +P+Y+ V AR LL+KLRRE LT +   P  A   EM   Y  Y   Y+  G+    L
Sbjct: 104 VEVDPDYSYVAARLLLDKLRREALTFISGAPDAAGQSEMGERYAAYLAAYVGRGIDLGQL 163

Query: 270 HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLA 329
             ++  FDL  L   L+ ERD  F +LG+Q LYDRYFLH +  R E+PQAFFMRVAMGLA
Sbjct: 164 DPALAKFDLARLGAALRPERDEQFTFLGIQTLYDRYFLHSDEVRYELPQAFFMRVAMGLA 223

Query: 330 LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQE 389
           L E ++E RA+EFY LLSSF FM STPTLFNSGT   QLSSCFLTTV DDL  IF  +  
Sbjct: 224 LNEDDREARAIEFYELLSSFDFMASTPTLFNSGTVRAQLSSCFLTTVGDDLQAIFHGISN 283

Query: 390 NAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVC 449
           NAML+KYSGGLGNDWTPVRGLG+HI GTNGKSQGV+PFLK+ANDTAVAVNQGGKRKGAVC
Sbjct: 284 NAMLSKYSGGLGNDWTPVRGLGSHIRGTNGKSQGVVPFLKIANDTAVAVNQGGKRKGAVC 343

Query: 450 AYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSD 509
           AYLETWHID+EEFLDLRKNTGD+RRRTHDMNTANW+PDLFM+RV Q   WTLFSPDEV D
Sbjct: 344 AYLETWHIDIEEFLDLRKNTGDERRRTHDMNTANWVPDLFMQRVEQGGSWTLFSPDEVPD 403

Query: 510 LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNI 569
           LHD YG EF  AY +YE +A  G IKV + + AV LWR+MLTMLFETGHPWITFKDP N+
Sbjct: 404 LHDKYGAEFAEAYAHYEAEAAAGRIKVSKTLPAVDLWRRMLTMLFETGHPWITFKDPSNL 463

Query: 570 RSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAV 629
           RSPQQHVGVVHSSNLCTEITLN+S++E AVCNLGS+NL  H   +  D ++L  T+RTAV
Sbjct: 464 RSPQQHVGVVHSSNLCTEITLNTSADEVAVCNLGSVNLAQHVGPDGLDAERLRRTVRTAV 523

Query: 630 RVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEF 689
           R+LDNVID+N +TI +A+++N  HR +GLGLMGFQ AL  L  P+AS  AV  ADESME 
Sbjct: 524 RMLDNVIDVNFYTIPEARRANMRHRPVGLGLMGFQDALFKLRTPFASDGAVSFADESMEL 583

Query: 690 ISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDE 748
           IS++AI AS+ELA ERG+Y SF+GSLW +GV PIDS+ LLAE R  +L M+R   L WD 
Sbjct: 584 ISYYAIEASMELAAERGSYESFEGSLWSRGVLPIDSLRLLAESRDGDLDMDRGETLDWDS 643

Query: 749 LKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVN 808
           L++RVKT GMRNSN MAIAPTATIANI GVSQSI+P Y+NLYVKSNMSGDFTVVN +LV 
Sbjct: 644 LRERVKTTGMRNSNVMAIAPTATIANITGVSQSIEPVYRNLYVKSNMSGDFTVVNPYLVR 703

Query: 809 ELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWID 868
           +LK R LWD+ M+S LK HDGS+G I+R+P DLK ++ATAFE+DP WL+++ SRRQKWID
Sbjct: 704 DLKARGLWDDDMVSALKMHDGSLGAIDRVPADLKALYATAFEVDPEWLVDAGSRRQKWID 763

Query: 869 QAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP- 927
           QAQSLNLY+  PSG+KLD +YR+AW  GLKTTYYLRS+SAT VEKSTLKG DG+LNAV  
Sbjct: 764 QAQSLNLYMAAPSGRKLDSLYRRAWRSGLKTTYYLRSQSATHVEKSTLKGTDGRLNAVAA 823

Query: 928 --------------------------------VTDPNSSTHSLGIPSSCTSDTECEVCQ 954
                                                     +   +    D ECE CQ
Sbjct: 824 TPAAPVASPAPSPAPAPSPAPSPSPNPQPVTGGAADEDEFEIIDGQACSIDDPECEACQ 882


>gi|134097870|ref|YP_001103531.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Saccharopolyspora erythraea NRRL 2338]
 gi|291007411|ref|ZP_06565384.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Saccharopolyspora erythraea NRRL 2338]
 gi|133910493|emb|CAM00606.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Saccharopolyspora erythraea NRRL 2338]
          Length = 782

 Score =  770 bits (1987), Expect = 0.0,   Method: Composition-based stats.
 Identities = 515/781 (65%), Positives = 609/781 (77%), Gaps = 3/781 (0%)

Query: 177 SSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTV 236
           S+  VL E  +N +DG+S  +L  A I ++R ++E EPNY++VTAR LL++LRRE LT +
Sbjct: 2   SADAVLDEVRRNSFDGISADELAIAQIMAARIMVEAEPNYSQVTARLLLDRLRREALTYL 61

Query: 237 YKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYL 296
              P  A   +M+  Y  YF  Y+  GV+   L   +  FDL  L   L  ERD +F +L
Sbjct: 62  AGLPDDADQEQMRERYAPYFRDYVARGVELGQLDPELASFDLDRLGAALLPERDMSFGFL 121

Query: 297 GLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTP 356
           GLQ LYDRYFLH +G+R E+PQAFFMRVAMGLAL+E ++E RAVEFY LLSSF FMCSTP
Sbjct: 122 GLQTLYDRYFLHHDGTRYELPQAFFMRVAMGLALREDDREARAVEFYRLLSSFDFMCSTP 181

Query: 357 TLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHG 416
           TLFNSGT  PQLSSCFLTTV DDL+GIF ++  NAML+KY+GGLGNDWTPVRG+GAHI G
Sbjct: 182 TLFNSGTTRPQLSSCFLTTVDDDLHGIFHSISNNAMLSKYAGGLGNDWTPVRGIGAHIRG 241

Query: 417 TNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRT 476
           TNG+SQGV+PFLK+ANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRT
Sbjct: 242 TNGQSQGVVPFLKIANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRT 301

Query: 477 HDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKV 536
           HDMNTANW+PD FM+RV  +  WTLFSPDE  DLHDLYG  F   Y  YER A+RGEIKV
Sbjct: 302 HDMNTANWVPDEFMRRVEADGTWTLFSPDETPDLHDLYGTAFAERYRAYERAAERGEIKV 361

Query: 537 FRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEE 596
           +R++ AV LWR+MLTMLFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S +E
Sbjct: 362 YRQVRAVDLWRRMLTMLFETGHPWITFKDPCNLRSPQQHAGVVHSSNLCTEITLNTSRDE 421

Query: 597 TAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAI 656
            AVCNLGS+NL  H   +  D+++L  T RTAVR+LDNVIDIN +TI +A++SN  HR I
Sbjct: 422 VAVCNLGSVNLARHVTADGIDHERLERTTRTAVRMLDNVIDINFYTIPEARRSNLRHRPI 481

Query: 657 GLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLW 716
           GLGLMGF  AL    IP +S  AVE AD SME IS+HAISAS +LA ERG Y SF+GSLW
Sbjct: 482 GLGLMGFSDALFAQRIPVSSQAAVEFADRSMEEISYHAISASADLAAERGRYESFEGSLW 541

Query: 717 DQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANI 775
            QGV PIDS+ LL + R   + ++RT    W  L++RV+ +GMRNSN MAIAPTATIANI
Sbjct: 542 SQGVLPIDSLALLEQARDGHVDLDRTMTRDWGALRERVRAVGMRNSNVMAIAPTATIANI 601

Query: 776 CGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIE 835
           CGV QSI+P Y+NLYVKSNMSGDFTVVN  LV +LK   LWDE M++DLK+HDGS+  I 
Sbjct: 602 CGVGQSIEPIYRNLYVKSNMSGDFTVVNPHLVADLKAAGLWDEDMLADLKFHDGSLDPIS 661

Query: 836 RIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLM 895
           RIP +LK+++ATAFE++P WL+E+A+RRQKWIDQAQSLNLY+  PSG+KLD +YR AW  
Sbjct: 662 RIPGELKELYATAFEVEPRWLVEAAARRQKWIDQAQSLNLYVAAPSGRKLDELYRLAWRQ 721

Query: 896 GLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVT--DPNSSTHSLGIPSSCTSDTECEVC 953
           GLKTTYYLRS SAT VEKSTL+G DGKLNAVP T   P   T ++   +    D +CE C
Sbjct: 722 GLKTTYYLRSTSATHVEKSTLRGTDGKLNAVPTTPVAPVVPTAAVDGAACSVDDPDCEAC 781

Query: 954 Q 954
           Q
Sbjct: 782 Q 782


>gi|269839639|ref|YP_003324331.1| ribonucleoside-diphosphate reductase, subunit alpha [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269791369|gb|ACZ43509.1| ribonucleoside-diphosphate reductase, alpha subunit [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 819

 Score =  767 bits (1981), Expect = 0.0,   Method: Composition-based stats.
 Identities = 448/814 (55%), Positives = 586/814 (71%), Gaps = 9/814 (1%)

Query: 144 KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALI 203
           +++++  +G L+  +  R+   ++ AC GL +     + +E  +++YD ++   + +A+I
Sbjct: 12  RVRVVSPEGGLVPLDPDRVRRHLQHACRGLPECDPDELANEVVRSLYDRVTPEQIRSAMI 71

Query: 204 FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
            ++R  IE++P Y KV +R +LE++ +E    V       +  E+   Y E F RY+   
Sbjct: 72  LAARARIERDPAYDKVASRLMLEQIYQESWGWV------PSEAELAATYREMFPRYVHAC 125

Query: 264 VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMR 323
           + A  L E +  FDL  LA+ L+ ERD    Y+GLQ LYDRY L + G R+E PQ F+MR
Sbjct: 126 ISAGRLSEELARFDLARLASALRPERDEKLRYIGLQTLYDRYLLDVEGRRLEAPQYFWMR 185

Query: 324 VAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGI 383
           VAMGLAL+E +   RA +FY+LLSS  F+ +TPTLFNSGT HPQLSSC+L+TV DDL  I
Sbjct: 186 VAMGLALREDDPNARAAQFYDLLSSLRFVSATPTLFNSGTPHPQLSSCYLSTVEDDLEHI 245

Query: 384 FGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGK 443
           F  + +NA L+K++GGLGNDWT VR  GA I GT+GKSQGVIPFLK+ NDTAVAVNQGGK
Sbjct: 246 FKVIGDNAKLSKWAGGLGNDWTRVRATGALIRGTHGKSQGVIPFLKIVNDTAVAVNQGGK 305

Query: 444 RKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFS 503
           RKGAVC YLE WH+D EEFL+LRKNTGD+RRRTHDM+TA+W+PDLFM+RV +   WTLFS
Sbjct: 306 RKGAVCCYLEPWHLDFEEFLELRKNTGDERRRTHDMHTASWVPDLFMRRVQEGGTWTLFS 365

Query: 504 PDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITF 563
           P+EV DLH+LYG+ FE  Y  YER A+ G+++  +++ A  LWRKML+ML+ETGHPWI F
Sbjct: 366 PNEVPDLHELYGRAFERRYVEYERMAEEGKLRQHKRVDAKMLWRKMLSMLWETGHPWIAF 425

Query: 564 KDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAS 623
           KDP NIRS Q HVGV+HSSNLCTEI L +S EETAVCNLGSINL+ H + +  D  KLA 
Sbjct: 426 KDPSNIRSAQDHVGVIHSSNLCTEILLPTSREETAVCNLGSINLVEHLSGDGLDEAKLAE 485

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+RTAVR+LDNVIDIN +   +A++SN  HR IGLG+MGF  AL  L IPYASP+AVE +
Sbjct: 486 TVRTAVRMLDNVIDINFYPTPEARRSNLRHRPIGLGIMGFHDALLALRIPYASPQAVEFS 545

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTS 742
           D++ME IS+HAI AS ELA ERG Y S++GS W +G+ PID+I LL   R  +L M+RT+
Sbjct: 546 DQTMELISWHAIMASSELAAERGRYPSYQGSKWSRGLLPIDTIELLERERGGDLEMDRTA 605

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
           RL W  +++ V   G+RNS  MAIAPTATI+NI GVSQSI+P Y+NL+VKSN+SGDFT+V
Sbjct: 606 RLDWGPVREAVARWGVRNSQIMAIAPTATISNIAGVSQSIEPHYRNLFVKSNLSGDFTIV 665

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK+  LW + M+  +KY+DGSI  IE IPD++K ++ TA EIDP+WLIE ASR
Sbjct: 666 NPYLVEDLKRLGLWSQEMLDRIKYYDGSILPIEEIPDEVKHLYLTAHEIDPLWLIECASR 725

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD-- 920
           RQKW+D  QSLN+Y+ EPSGKKL  IY  AW  GLKTTYYLR+  AT+VEK+++      
Sbjct: 726 RQKWVDMGQSLNIYVAEPSGKKLHEIYFAAWRKGLKTTYYLRAVGATNVEKASMDINRFG 785

Query: 921 GKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
            +   +     +S    +   S+C    +CE CQ
Sbjct: 786 VQPRWMRSRSASSRVRIVREGSTCQLGEDCEACQ 819


>gi|254449375|ref|ZP_05062817.1| ribonucleoside-diphosphate reductase, alpha subunit [gamma
           proteobacterium HTCC5015]
 gi|198261021|gb|EDY85324.1| ribonucleoside-diphosphate reductase, alpha subunit [gamma
           proteobacterium HTCC5015]
          Length = 839

 Score =  765 bits (1974), Expect = 0.0,   Method: Composition-based stats.
 Identities = 501/839 (59%), Positives = 626/839 (74%), Gaps = 55/839 (6%)

Query: 171 SGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRR 230
            GL+DV +  +L++T +N++DG+++ ++ TALI S+RT+IEK+PNY++V+AR LL+ +R 
Sbjct: 1   EGLEDVDADKILNDTLRNVFDGVAKKEVATALIMSARTMIEKDPNYSQVSARLLLDSMRE 60

Query: 231 EVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERD 290
           E LT +      AT  EMQ  YPEYF  YI   V+  LL   M +FDL  L   L  ERD
Sbjct: 61  EALTFLGDGAPAATQAEMQERYPEYFKHYIARAVELELLDGEMHNFDLERLGQALLPERD 120

Query: 291 FAFEYLGLQILYDRYFLHIN-GSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSF 349
             F YLGLQ LYDRYF+H + G R E+PQAFFMRVAMGLA+ E ++E+RA+EFY LLSSF
Sbjct: 121 QGFTYLGLQTLYDRYFIHDDSGVRFELPQAFFMRVAMGLAINEVDREERAIEFYTLLSSF 180

Query: 350 HFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRG 409
            FM STPTLFNS T  PQLSSC+LTTVPDDL GIF A++++AML+K++GGLGNDWT VR 
Sbjct: 181 DFMSSTPTLFNSATLRPQLSSCYLTTVPDDLDGIFSAVKDDAMLSKFAGGLGNDWTRVRA 240

Query: 410 LGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNT 469
           LGAHI GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGA+CAYLE+WH+D+EEFL+LRKNT
Sbjct: 241 LGAHIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAMCAYLESWHLDIEEFLELRKNT 300

Query: 470 GDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQA 529
           GDDRRRTHDMNTANWIPDLFMKRV ++  WTLFSP++V DLHDL GK+FE AY  YE +A
Sbjct: 301 GDDRRRTHDMNTANWIPDLFMKRVAEDGEWTLFSPNDVDDLHDLVGKKFEKAYTAYEAKA 360

Query: 530 DRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEIT 589
           D GEIK+F+++ AV LWRKML MLFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEIT
Sbjct: 361 DSGEIKLFKRVKAVDLWRKMLGMLFETGHPWITFKDPCNLRSPQQHAGVVHSSNLCTEIT 420

Query: 590 LNSSSEETAVCNLGSINLLAH-FANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKK 648
           LN+S  E AVCNLGS+N+  H     + D  KL  TI+TA+R+LDNVID N +++ +A++
Sbjct: 421 LNTSDMEIAVCNLGSVNMAQHVTEEGELDVAKLERTIKTAMRMLDNVIDYNYYSVPQARR 480

Query: 649 SNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAY 708
           SN  HR +GLG+MGFQ AL+   + Y S EAVE AD +ME +S++AIS+SV+LA+ERGAY
Sbjct: 481 SNIRHRPVGLGIMGFQDALYKKGVAYQSDEAVEFADRAMEAVSYYAISSSVDLAEERGAY 540

Query: 709 SSFKGSLWDQGVFPIDSIGLLAEVRDEL-AMNRTSRLPWDELKKRVKTIGMRNSNCMAIA 767
           SSF GSLW +G+ PIDSI +LAE R +   ++R+  + WD L++RV+  GMRNSNCMAIA
Sbjct: 541 SSFPGSLWSRGILPIDSIDILAEHRGDFLQVDRSQTMDWDSLRQRVRESGMRNSNCMAIA 600

Query: 768 PTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYH 827
           PTATI+NICGVSQSI+P+YQNL+VKSN+SG+FTV+N +LV ELK R+LWD+ M++DLKY+
Sbjct: 601 PTATISNICGVSQSIEPTYQNLFVKSNLSGEFTVINPYLVKELKARNLWDDVMVNDLKYY 660

Query: 828 DGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDF 887
           DGS+  IERIPDDL++I++TAFEID  WL+E+ SRRQKWIDQ QSLNLY+ EPSGKKLD 
Sbjct: 661 DGSVHPIERIPDDLRQIYSTAFEIDARWLVEAGSRRQKWIDQGQSLNLYMSEPSGKKLDN 720

Query: 888 IYRQAWLMGLKTTYYLRSRSATSVEKSTLKGV-------------------------DGK 922
           +Y+ AW  GLKTTYYLRS  AT VEK+  +                            G 
Sbjct: 721 LYKLAWARGLKTTYYLRSMGATHVEKTASRPAPGSGGQQGGSSDGTASGQSQEGQAGQGG 780

Query: 923 LNAVPVTDPNSSTH--------------------------SLGIPSSCTSD-TECEVCQ 954
           ++A   T  ++                             +   P +C+ D  +CE CQ
Sbjct: 781 VSASAPTGASAQPPQAQATAPVSATASVSSDAFDNISSETAPEAPQACSIDNPDCEACQ 839


>gi|257055669|ref|YP_003133501.1| ribonucleotide-diphosphate reductase subunit alpha
           [Saccharomonospora viridis DSM 43017]
 gi|256585541|gb|ACU96674.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Saccharomonospora viridis DSM 43017]
          Length = 815

 Score =  758 bits (1957), Expect = 0.0,   Method: Composition-based stats.
 Identities = 511/804 (63%), Positives = 620/804 (77%), Gaps = 5/804 (0%)

Query: 156 SFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPN 215
               +R+  +V EA +GL D S++ VL+E  +N+YDG+   +L  A I ++RTL+E+EPN
Sbjct: 12  PIPWERVHRVVREAVAGLPDTSAEAVLAELKRNVYDGIRADELALAQIMAARTLVEREPN 71

Query: 216 YAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMD 275
           Y+ V AR LL+ LR E  + +  +P++  + EM   Y +YF  Y+  G+  +LL E +  
Sbjct: 72  YSFVAARLLLDLLRGEATSYLADEPRQPDYAEMAAGYADYFRDYLRRGIDLQLLDEELAA 131

Query: 276 FDLVYLANDLKYERDFAFEYLGLQILYDRYFLH--INGSRIEMPQAFFMRVAMGLALKET 333
           FDL  LA  L+ ERD     LGLQ LYDRY L     G R E+PQAFFMRVAMGLA++E 
Sbjct: 132 FDLDILAAALRPERDLDLGLLGLQTLYDRYLLRDPHAGIRFELPQAFFMRVAMGLAIREP 191

Query: 334 EKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAML 393
           E++ RAVEFY LLS+  FM STPTLFN+GTR PQLSSCFLTTV DDL  IF   + NA+L
Sbjct: 192 ERDTRAVEFYELLSTLRFMTSTPTLFNAGTRRPQLSSCFLTTVSDDLESIFTGYRNNALL 251

Query: 394 AKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLE 453
           AKYSGGLGNDWTPVRGLGAHI GT GKSQGV+PFLK+ANDT VAVNQGGKRKGA CAYLE
Sbjct: 252 AKYSGGLGNDWTPVRGLGAHIRGTGGKSQGVVPFLKIANDTTVAVNQGGKRKGAACAYLE 311

Query: 454 TWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDL 513
           TWHID+EEFL+LRKNTGDDRRRTHDMNTANW+PD F++RV  +A WTLFSPDEV DLHDL
Sbjct: 312 TWHIDIEEFLELRKNTGDDRRRTHDMNTANWVPDEFLRRVEADAQWTLFSPDEVPDLHDL 371

Query: 514 YGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQ 573
           YG  F   Y  YE+ AD G+I+VFR++SA  LWR+MLTMLFETGHPWITFKDPCN+RSPQ
Sbjct: 372 YGTAFAERYRAYEKAADAGQIRVFRRVSATQLWRRMLTMLFETGHPWITFKDPCNLRSPQ 431

Query: 574 QHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLD 633
           QH GVVHSSNLCTEITLN+S +E AVCNLGS+NL  H   +  D + L  T+RTAVR+LD
Sbjct: 432 QHAGVVHSSNLCTEITLNTSPDEIAVCNLGSVNLARHIGKDGLDVEALRKTVRTAVRMLD 491

Query: 634 NVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFH 693
           NVIDIN +T+ +A++SN  HR +GLGLMGF  AL  L IP AS EAVE AD SME +S+H
Sbjct: 492 NVIDINFYTVPEARRSNLRHRPVGLGLMGFTDALFELGIPQASDEAVEFADRSMEVLSYH 551

Query: 694 AISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD--ELAMNRTSRLPWDELKK 751
           AISASVELA ERGAY SF GSLW +G+ P+DS+ LLAE R   EL ++ +S L WD L++
Sbjct: 552 AISASVELAGERGAYPSFDGSLWSRGILPLDSLRLLAEARGEDELDIDTSSTLDWDALRE 611

Query: 752 RVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELK 811
           RV+T+GMRNSN +AIAPTATI+NICGV QSI+P + NL+VKSNMSG+FTVVN +LV +LK
Sbjct: 612 RVRTVGMRNSNVLAIAPTATISNICGVGQSIEPLFSNLFVKSNMSGEFTVVNPYLVRDLK 671

Query: 812 QRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQ 871
           +R LWDE M+ +LK HDG +G IER+P++LKK++ATAFE D  WL+++A+RRQKWIDQAQ
Sbjct: 672 RRGLWDERMVVELKLHDGVLGPIERVPEELKKLYATAFEFDSRWLVDAAARRQKWIDQAQ 731

Query: 872 SLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDP 931
           SLNLYL EPSG+ LD +YR AW  GLKTTYYLRSR+AT VEKSTL+G DG+LNAV    P
Sbjct: 732 SLNLYLAEPSGRALDALYRHAWRRGLKTTYYLRSRAATQVEKSTLRGTDGRLNAVAPAVP 791

Query: 932 NSSTHSLGIPSSC-TSDTECEVCQ 954
                + G  ++C   D +CE CQ
Sbjct: 792 AVPADASGAAAACRIDDPDCEACQ 815


>gi|284043178|ref|YP_003393518.1| ribonucleoside-diphosphate reductase, subunit alpha [Conexibacter
            woesei DSM 14684]
 gi|283947399|gb|ADB50143.1| ribonucleoside-diphosphate reductase, alpha subunit [Conexibacter
            woesei DSM 14684]
          Length = 1091

 Score =  756 bits (1952), Expect = 0.0,   Method: Composition-based stats.
 Identities = 412/953 (43%), Positives = 579/953 (60%), Gaps = 37/953 (3%)

Query: 22   FPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASR---SIRVQDIIKNLTEQ 78
                   +++I+R+G VT+++P+KI  AI KAF++++         + RV +    L   
Sbjct: 156  AARPAGALRLIRRSGHVTAWEPAKIEVAIRKAFLSLQADSEPAVALAARVSERAHAL--- 212

Query: 79   TVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSD 138
                          V IE +QD V+  L+ +GH +    Y++YR ERS +RA  +     
Sbjct: 213  ----------GMAYVPIETVQDIVQEELVLAGHMRAAERYIVYRAERSLLRAQDAPVPGA 262

Query: 139  --APIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSE 195
              +   P + ++  DGT   +  + L   +  A  GL   ++ + +  E  + +  G+  
Sbjct: 263  PGSGAQPPVPVIELDGTESLWGGEDLRARIAFAAIGLDLPLAPEELERELRRAIRPGIKR 322

Query: 196  SDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEY 255
            +DL    + +++ L+E++ ++++   R LL  +  E L     +        ++  +   
Sbjct: 323  ADLRRLTVLNAKALVERDSDFSRFAGRILLSHVYEEALAWDIVRDG---VGALKAAHERG 379

Query: 256  FCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHING---- 311
                +E GV    +  ++ D+D+  LA  L    D  F++LGLQ LYDRY +        
Sbjct: 380  LRALLEHGVAIGRIDPALHDYDVARLAAALDPTADLDFDFLGLQTLYDRYLIVDKKAAEP 439

Query: 312  SRIEMPQAFFMRVAMGLA-----LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHP 366
             RIE PQ F+MRVAMG+           +E+RA++ Y +     F  STPTLFN+GT H 
Sbjct: 440  RRIETPQLFWMRVAMGVCLTARDGDPAAREERAIDLYTMYKQRRFCSSTPTLFNAGTPHS 499

Query: 367  QLSSCFLTTVPDDLYGIF-GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVI 425
            QLSSC+L  + D L  I    + ENAM +K++GGLG  WT VRG G+HI  TNG+SQGV+
Sbjct: 500  QLSSCYLYKIEDTLSSIVGRGIAENAMCSKWAGGLGGSWTAVRGTGSHIESTNGESQGVV 559

Query: 426  PFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWI 485
            PFLK+ ND  VAVNQGGKR G+ CAYLE WH D+ EFL+LR+NTGD+RRRTHDMNTANWI
Sbjct: 560  PFLKMHNDQLVAVNQGGKRAGSGCAYLEVWHNDIREFLELRRNTGDERRRTHDMNTANWI 619

Query: 486  PDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVAL 545
            PDLFMKRV     WTLF  ++V DLH+ YG++FE  YE YE + D GE+   R I A+ L
Sbjct: 620  PDLFMKRVEAREQWTLFRSNDVPDLHETYGRDFEARYEAYEARVDAGELHGER-IPAIEL 678

Query: 546  WRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSI 605
            W++ML +LFETGHPWITFKDPCN+RSPQ H GVVHSSNLCTEITLN+  +ETAVCNLGS+
Sbjct: 679  WKQMLKLLFETGHPWITFKDPCNVRSPQDHAGVVHSSNLCTEITLNTGPDETAVCNLGSV 738

Query: 606  NLLAHFANN-QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
             +  H     + D+ KL +TIR AVR LD+VID+N +  E A+ +N  HR +GLG+MG Q
Sbjct: 739  VIDQHLDAAGEIDHAKLRATIRVAVRALDDVIDVNFYPTEPARTANGRHRPVGLGVMGLQ 798

Query: 665  SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
             AL+   + + SPEA+   DE ME I+F+A  AS +LA ERG Y S+ GS WD+G+ P D
Sbjct: 799  YALYRKGLAFGSPEALAFGDEMMEAIAFYAYEASSDLAAERGTYQSYAGSKWDRGLLPQD 858

Query: 725  SIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSID 783
            ++ LL E R   + + R  R+ W  L+ ++   GMRNSN +AIAPTATIANI G S  I+
Sbjct: 859  TLDLLEEERGQPIEVERGGRMDWTPLRAKIAAQGMRNSNVLAIAPTATIANIMGTSPCIE 918

Query: 784  PSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKK 843
            P Y+NL+ KSN+SGDFT++N FLV +LK   +W  A+   LK  +G +  +  +P  L+ 
Sbjct: 919  PMYKNLFAKSNLSGDFTILNPFLVRDLKAAGVWSGALAERLKVVEGDLEQVPEVPAALRA 978

Query: 844  IHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYL 903
            ++ TAF+I+P  LI++A+RRQKWIDQ+QSLNL+L  P  K +  +YR+AW  GLKTTYYL
Sbjct: 979  LYRTAFQIEPERLIDAAARRQKWIDQSQSLNLFLAAPDLKAMSHMYRRAWHAGLKTTYYL 1038

Query: 904  RSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHS--LGIPSSCTSDTECEVCQ 954
            R+  A+++EK+T+              P +           +  +  ECE CQ
Sbjct: 1039 RTLGASAIEKATVAAPAAATVPAAAGMPTAPDAEALACSIEAMRNGEECEACQ 1091



 Score = 50.6 bits (119), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 39/85 (45%), Gaps = 5/85 (5%)

Query: 101 QVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSK 160
            VE +L+ +GH+++ +  VL R      R + S     A  A  L+++   G + ++   
Sbjct: 124 LVEAALIDAGHYELAKALVLRRA-----RPSASGDDVAARPAGALRLIRRSGHVTAWEPA 178

Query: 161 RLEMIVEEACSGLQDVSSKIVLSET 185
           ++E+ + +A   LQ  S   V    
Sbjct: 179 KIEVAIRKAFLSLQADSEPAVALAA 203


>gi|326797772|ref|YP_004315591.1| ribonucleoside-diphosphate reductase, subunit alpha
           [Sphingobacterium sp. 21]
 gi|326548536|gb|ADZ76921.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Sphingobacterium sp. 21]
          Length = 792

 Score =  737 bits (1903), Expect = 0.0,   Method: Composition-based stats.
 Identities = 294/815 (36%), Positives = 454/815 (55%), Gaps = 31/815 (3%)

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGL--QDVSSKIVLSETYKNMYDGLSESDLETAL 202
           + ++  DG   S    ++   +E+ C GL    V    V  +  + +YDG++ S+L+   
Sbjct: 1   MYVIKRDGRSESVKFDKITARIEKLCYGLNPDLVDPIDVARKVIEGLYDGVTTSELDNLA 60

Query: 203 IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
             ++ +L  K P+YA + +R  +  L +  + +  +         M  LY     +  + 
Sbjct: 61  AETAASLTTKHPDYALLASRIAVSNLHKNTVKSFSET--------MSLLYHYIDPKTGKP 112

Query: 263 GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
                     ++  + + L + + Y+RDF+F+Y G + L   Y L +NG   E PQ  FM
Sbjct: 113 APLIADDVYEVIQANAMELDSHIIYDRDFSFDYFGFKTLEKSYLLKLNGKIAERPQHLFM 172

Query: 323 RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDD-LY 381
           RVA+G+        +  ++ Y+LLS   F  +TPTLFN+GT  PQ+SSCFL T+ DD + 
Sbjct: 173 RVAVGIH---KHDIESVIKTYDLLSERWFTHATPTLFNAGTPKPQMSSCFLLTMKDDSIE 229

Query: 382 GIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQG 441
           GI+  L++ A +++ +GG+G     VR  GA+I GTNG S G+IP L+V NDTA  V+QG
Sbjct: 230 GIYDTLKQTAKISQSAGGIGLSIHNVRATGAYISGTNGTSNGIIPMLRVFNDTARYVDQG 289

Query: 442 G-KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
           G KRKGA   YLE WH DV +F+DLRKN G +  R  D+  A W+PDLFMKRV +N  W+
Sbjct: 290 GGKRKGAFAIYLEPWHADVYDFIDLRKNHGKEELRARDLFLALWVPDLFMKRVEENGEWS 349

Query: 501 LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
           LFSPDE   L + +G+ FE  YE YER     E +  + + A  LW  +L    ETG P+
Sbjct: 350 LFSPDEAPGLAECHGEAFEKLYEQYER-----EGRARKIVKAQDLWFAILDAQIETGTPY 404

Query: 561 ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDK 620
           + +KD  N +S QQ++G + SSNLCTEI   +S++E AVCNL S+ L  +  N +FD+ K
Sbjct: 405 LLYKDAANGKSNQQNLGTIKSSNLCTEIIEYTSADEVAVCNLASLALPRYVDNGEFDHQK 464

Query: 621 LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
           L          L+ +ID N + +++A+ SN  HR +GLG+ G      L+ +P+ S  A 
Sbjct: 465 LFDITYQVTINLNRIIDNNYYPVDEARNSNLRHRPVGLGVQGLADTFILMRMPFESEAAK 524

Query: 681 EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNR 740
           ++  +  E I F A++AS +LA + G Y SFKGS   QG F  D   +  +         
Sbjct: 525 QLNKDIFETIYFAAMTASKDLAVKEGPYESFKGSPLSQGKFQFDLWNVKPD--------- 575

Query: 741 TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
           + R  W+ L+K +K  G+RNS  +A  PTA+ + I G ++  +P   N+Y +  +SG+F 
Sbjct: 576 SGRWDWEGLRKEIKKHGVRNSLLVAPMPTASTSQILGNNECFEPYTSNIYTRRVLSGEFV 635

Query: 801 VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
           +VN  L+ +L +  LW+  M + +   +GSI +I  IP D+K+++ T +EI    +I+ A
Sbjct: 636 IVNKHLLRDLVELGLWNNEMKNRIIAANGSIQDINEIPADIKELYKTVWEIKMRNIIDMA 695

Query: 861 SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT-TYYLRSRSATSVEKSTLKGV 919
           + R  +I Q+QSLNL+++ P+  KL  ++  AW  GLKT  YYLR+++AT   K T++  
Sbjct: 696 ADRGAFICQSQSLNLFVNTPTTAKLTSMHFYAWKKGLKTGMYYLRTQAATQAVKFTVENQ 755

Query: 920 DGK-LNAVPVTDPNSSTHSLGIPSSCTSDTECEVC 953
            GK +  V      S    +   + C+ +  C  C
Sbjct: 756 AGKNMEPVIPAKIESVPDDIPTGAVCSMEEGCITC 790


>gi|149279600|ref|ZP_01885729.1| ribonucleoside diphosphate reductase, alpha subunit [Pedobacter sp.
           BAL39]
 gi|149229636|gb|EDM35026.1| ribonucleoside diphosphate reductase, alpha subunit [Pedobacter sp.
           BAL39]
          Length = 792

 Score =  731 bits (1886), Expect = 0.0,   Method: Composition-based stats.
 Identities = 292/815 (35%), Positives = 439/815 (53%), Gaps = 31/815 (3%)

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQD--VSSKIVLSETYKNMYDGLSESDLETAL 202
           + ++  DG   +    ++   +E+ C G     V    V  +  + +YDG++ S+L+   
Sbjct: 1   MFVIKRDGRKEAVRFDKITARIEKLCYGFNAELVDPIDVAKKVIEGLYDGVTTSELDNLA 60

Query: 203 IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
             ++ +L  K P+YA + +R  +  L +           K+    M+ LY     +  + 
Sbjct: 61  AETAASLTTKHPDYALLASRIAVSNLHKNT--------TKSFSKTMEMLYKYVDSKTDKS 112

Query: 263 GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
                     ++  +   L + + Y+RDF F+Y G + L   Y L I G  +E PQ  FM
Sbjct: 113 ASLIADDVWEVIQENADILDSTIIYDRDFGFDYFGFKTLEKSYLLKIEGQIVERPQHLFM 172

Query: 323 RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDD-LY 381
           RVA+G+          A++ YNL+S   F  +TPTLFN+ T  PQ+SSCFL T+ DD + 
Sbjct: 173 RVAVGIH---KSDIDSAIKTYNLMSERWFTHATPTLFNAATPKPQMSSCFLLTMQDDSIE 229

Query: 382 GIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQG 441
           GI+  L++ A +++ +GG+G     +R  G++I GTNG S G++P LKV NDTA  V+QG
Sbjct: 230 GIYDTLKQTAKISQSAGGIGLSIHNIRATGSYIGGTNGTSNGIVPMLKVFNDTARYVDQG 289

Query: 442 G-KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
           G KRKGA   YLE WH DV  FLDLRKN G +  R  D+  A W+ DLFMKRV  N  W+
Sbjct: 290 GGKRKGAFAIYLEPWHADVFSFLDLRKNHGKEELRARDLFYALWVCDLFMKRVEANEDWS 349

Query: 501 LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
           LF P E   L D +G EFE  YE YE+     E +  + + A  LW  +L    ETG P+
Sbjct: 350 LFCPHEAPGLADCFGDEFEALYERYEK-----EGRARKTVKAQELWFAILDSQIETGTPY 404

Query: 561 ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDK 620
           + +KD  N +S QQ++G + SSNLCTEI   +S +E AVCNL S+ L     N +FD+ K
Sbjct: 405 LLYKDAANSKSNQQNLGTIKSSNLCTEIIEYTSKDEVAVCNLASLALPRFVINGEFDHQK 464

Query: 621 LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
           L      A   L+ +ID N + +E+AK SN  HR +GLG+ G   A  L+ +P+ S  A 
Sbjct: 465 LYDVTYQATLNLNKIIDYNYYPVEEAKNSNMRHRPVGLGVQGLADAFILMRLPFESDGAR 524

Query: 681 EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNR 740
            +  E  E I F A++AS +LA   G Y +FKGS   QG F  D   +  +         
Sbjct: 525 LLNKEIFETIYFAAMTASHDLAVVNGPYQTFKGSPLSQGKFQFDLWNVTPD--------- 575

Query: 741 TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
           + R  W+ L+++V   G+ NS  +A  PTA+ + I G ++  +P   N+Y +  +SG+F 
Sbjct: 576 SGRWDWESLREKVVKDGVYNSLLVAPMPTASTSQILGNNECFEPYTSNIYTRRVLSGEFI 635

Query: 801 VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
           VVN  L+ +L    LW  AM   +   +GSI +I  IPD +K+++ T +EI    +I+ A
Sbjct: 636 VVNKHLLKDLVALGLWTPAMKDRIILANGSIQDIAEIPDYIKELYKTVWEIKMRSIIDMA 695

Query: 861 SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT-TYYLRSRSATSVEKSTLKGV 919
           + R  +I Q+QSLNL+++ P+  KL  ++  AW  GLKT  YYLR+++A+   K T++  
Sbjct: 696 ADRGAYICQSQSLNLFINAPNTSKLTSMHFYAWKKGLKTGMYYLRTQAASQAVKFTVENQ 755

Query: 920 DGK-LNAVPVTDPNSSTHSLGIPSSCTSDTECEVC 953
            GK +  V     +     +     C+ +  C  C
Sbjct: 756 AGKNMEPVIPDHIDQPVEEITDGPVCSMEEGCISC 790


>gi|312130871|ref|YP_003998211.1| ribonucleoside-diphosphate reductase, alpha subunit [Leadbetterella
           byssophila DSM 17132]
 gi|311907417|gb|ADQ17858.1| ribonucleoside-diphosphate reductase, alpha subunit [Leadbetterella
           byssophila DSM 17132]
          Length = 820

 Score =  730 bits (1883), Expect = 0.0,   Method: Composition-based stats.
 Identities = 294/843 (34%), Positives = 447/843 (53%), Gaps = 59/843 (6%)

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQD--VSSKIVLSETYKNMYDGLSESDLETAL 202
           + ++  DG   S    ++   +E  C GL    V    V  +    +YDG++ S+L+T  
Sbjct: 1   MFVVKRDGRRESVKFDKITARIERLCYGLDPYFVQPVEVAMKVVAGIYDGVTTSELDTLA 60

Query: 203 IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
             ++ ++  K P+YA + AR  +  L +  L +            M+ LY     +  E 
Sbjct: 61  AETAASMTTKHPDYAILAARVAISNLHKNTLKSFSGT--------MKLLYQYVDPKTGEN 112

Query: 263 GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
                     ++  +   L + + Y+RDF +++ G + L   Y + +NG  +E PQ   M
Sbjct: 113 AALISKETWKIIQANAALLDSSIIYDRDFGYDFFGYKTLEKSYLMKLNGKIVERPQHMLM 172

Query: 323 RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDD-LY 381
           RVA+G+     E  ++A+E YNLLS   F  +TPTLFN+GT  PQLSSCFL T+ DD + 
Sbjct: 173 RVAVGIHG---ENIEKAIETYNLLSERWFTHATPTLFNAGTPKPQLSSCFLLTMKDDSIE 229

Query: 382 GIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQG 441
           GI+  L++ A +++ +GG+G     VR  G++I GTNG S G+IP L+V NDTA  V+QG
Sbjct: 230 GIYDTLKQTAKISQSAGGIGLSIHNVRATGSYIKGTNGTSNGIIPMLRVFNDTARYVDQG 289

Query: 442 G-KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
           G KRKG+   YLE WH D+ EFL+L+KN G +  R  D+  A W PDLFMKRV  NA W+
Sbjct: 290 GGKRKGSFAIYLEPWHADIFEFLNLKKNHGKEEERARDLFYALWTPDLFMKRVEANADWS 349

Query: 501 LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
           LF P E   L D YG++FE  Y  YE      E K  + I A  LW ++L    ETG P+
Sbjct: 350 LFCPHECPGLADTYGEDFERLYTKYEA-----EGKARKTIPAQELWFQILESQVETGTPY 404

Query: 561 ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFAN----NQF 616
           + +KD  N +S Q+++G + SSNLCTEI   ++ +E AVCNL SI L            F
Sbjct: 405 MLYKDAANKKSNQKNLGTIKSSNLCTEIIEYTAPDEVAVCNLASIALPKFVNTEGPAPSF 464

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D+ KL    +   R L+ +IDIN + + +A+ SN  HR IGLG+ G   A  L+  P+ S
Sbjct: 465 DFQKLYEVTKVVTRNLNRIIDINYYPVPEAENSNKRHRPIGLGIQGLADAFILMRFPFDS 524

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDEL 736
            EA ++  +  E + F A+  S+ELA