RPSBLAST alignment for GI: 254780502 and conserved domain: PRK12365

>gnl|CDD|171440 PRK12365, PRK12365, ribonucleotide-diphosphate reductase subunit alpha; Provisional. Length = 1046
 Score = 1058 bits (2738), Expect = 0.0
 Identities = 501/940 (53%), Positives = 638/940 (67%), Gaps = 25/940 (2%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
            + VI+R+G V  F+P KIS A+ KAF A +         V + I  LT+  V  +L+   
Sbjct: 118  LSVIRRDGTVVHFNPMKISAALEKAFRATDKIEGMTPSSVLEEINALTQNIVEEILECCS 177

Query: 89   SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRA--AQSHSKSDAPIAPKLK 146
                + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR    +  S          +
Sbjct: 178  QEDRIDIEKIQDIVEQQLMVVGHYDVAKNYILYREARARVRDNKEEDGSTEKTIAEEAYE 237

Query: 147  IMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLETALIFS 205
            ++  DG+  +    +L      ACS   + +   +L++  + N Y G+ ES++  A I +
Sbjct: 238  VLSKDGSTYTMTKSQLLAHFAWACSRFPETTDAALLADMAFANFYSGIKESEVVLACIMA 297

Query: 206  SRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVK 265
            +R  IEKEP+YA V A  LL+ + +E L       +     +++  + ++F RYI EG  
Sbjct: 298  ARANIEKEPDYAFVAAELLLDVVYKEALG------KSKYDEDLEEAHKDHFKRYILEGDT 351

Query: 266  ARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVA 325
             RL +  +  +DL  LA  L   RD  F Y+G+Q LYDRYF H  G R+E PQ F+MRV+
Sbjct: 352  YRL-NPELKHYDLDALAEALDLSRDLQFSYMGVQNLYDRYFNHHEGRRLETPQIFWMRVS 410

Query: 326  MGLALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
            MGLAL E + K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  I+
Sbjct: 411  MGLALNEGQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLVHIY 470

Query: 385  GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
              + +NAML+K++GG+GNDWT VR  GA I GTNGKSQGVIPF+KVANDTAVAVNQGGKR
Sbjct: 471  KVISDNAMLSKWAGGIGNDWTAVRATGALIKGTNGKSQGVIPFIKVANDTAVAVNQGGKR 530

Query: 445  KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
            KGAVC YLE WH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ Q   WTLFSP
Sbjct: 531  KGAVCVYLEVWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLQQKGTWTLFSP 590

Query: 505  DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
            D+V  LH+ YG+EFE  YE YER+ D GEI++++K+ A  LWRKML+ML+ETGHPW+TFK
Sbjct: 591  DDVPGLHEAYGEEFEKLYEEYERKVDTGEIRLYKKVEAEDLWRKMLSMLYETGHPWMTFK 650

Query: 565  DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAST 624
            DP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H  N+  D +KL+ T
Sbjct: 651  DPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVEHIVNDGLDEEKLSET 710

Query: 625  IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
            I  A+R+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L+I YAS EAVE AD
Sbjct: 711  ISIAIRILDNVIDINFYPTKEAKEANLAHRAIGLGVMGFQDALYKLNISYASQEAVEFAD 770

Query: 685  ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTS 742
             S E I+++AI AS  LA+ERG YSS+KGS WD+G  PID+I LL E R E  L M+ +S
Sbjct: 771  YSSELIAYYAILASSLLAKERGTYSSYKGSKWDRGYLPIDTIELLKEYRGEANLLMDTSS 830

Query: 743  RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            R  W+ ++  +K  GMRNS  MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT+ 
Sbjct: 831  RKDWEPVRSLIKEYGMRNSQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFTIP 890

Query: 803  NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
            N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LKKI  TAFEI+P W+IE ASR
Sbjct: 891  NVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKKIFLTAFEIEPEWIIECASR 950

Query: 863  RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD-G 921
            RQKWID  QSLNLYL EP GKKL  +Y  AW  GLKTTYYLRS +ATSVEKS    VD  
Sbjct: 951  RQKWIDMGQSLNLYLAEPDGKKLSNMYLTAWKKGLKTTYYLRSSAATSVEKSF---VDIN 1007

Query: 922  KLNAVPVTDPNSSTHSLGI-------PSSCTSDTECEVCQ 954
            K    P    N S  S  I          C+ +  CE CQ
Sbjct: 1008 KRGIQPRWMKNKSA-STSIVVERAKKTPVCSLEEGCESCQ 1046