RPSBLAST alignment for GI: 254780502 and conserved domain: PRK06406

>gnl|CDD|180555 PRK06406, PRK06406, ribonucleotide-diphosphate reductase subunit alpha; Validated. Length = 771
 Score =  287 bits (736), Expect = 1e-77
 Identities = 182/592 (30%), Positives = 291/592 (49%), Gaps = 78/592 (13%)

Query: 321 FMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDL 380
           F+     L  K    E+   +F  ++S+  F+ ++PTL N+GT+  QLS+CF+  VPD +
Sbjct: 205 FLDF---LKTKWDSIEEYINKFEEVMSNLKFVPNSPTLMNAGTKLGQLSACFVLPVPDSI 261

Query: 381 YGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQ 440
            GIF AL+  AM+ K  GG G  ++ +R     +  T G + G + F+++ + T   + Q
Sbjct: 262 EGIFNALKYTAMIHKSGGGTGFSFSRLRPKDDIVASTKGVASGPLSFMRIFDVTTDVIKQ 321

Query: 441 GGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
           GGKR+GA    L   H D+ EF+   K++  + +   + N +  + D F  ++  +  + 
Sbjct: 322 GGKRRGANMGILSYHHPDIMEFI-TSKDS--ENKVLSNFNISVAVTDEFFDKLDNDDYYP 378

Query: 501 LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
           L +P                      R       K  ++I A  +W  ++T  ++TG P 
Sbjct: 379 LRNP----------------------RNG-----KEVKRIKARQVWDLIITQAWKTGDPG 411

Query: 561 ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDK 620
           + F D  N ++P +++G + S+N C E  L         CNLGSINL     N + D+D+
Sbjct: 412 VIFLDEINRKNPVKNLGEIESTNPCGEQPLLPYES----CNLGSINLSKFVENGKIDWDR 467

Query: 621 LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
           L  T+  A R LDNVID N   + + K+     R IGLG+MGF   L  L IPY S EA+
Sbjct: 468 LRETVHIATRFLDNVIDANKFPVPQIKEMTRMTRKIGLGVMGFADMLIKLGIPYNSEEAL 527

Query: 681 EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNR 740
           EIA++ M+FI+  +  AS +LA+ERG + ++ GS W++                      
Sbjct: 528 EIAEKVMKFINEESHRASQKLAEERGVFPAWYGSEWEK---------------------- 565

Query: 741 TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG-DF 799
                        K I MRNS    IAPT TI+ I G S SI+P +   +V+  ++G + 
Sbjct: 566 -------------KGIKMRNSTTTTIAPTGTISIIAGCSSSIEPLFAIAFVRHVLNGQEL 612

Query: 800 TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
             VN       ++R L+ E ++  +    G++ NI+ +P+D+K+I  TA EIDP W +  
Sbjct: 613 LEVNPLFEEITRKRGLYSEELMRKVA-ETGNLQNID-VPEDIKRIFVTAHEIDPQWHVLM 670

Query: 860 ASRRQKWIDQAQS--LNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSAT 909
            +  Q++ D   S  +NL  D  + + +   YR A  +  K     R +S T
Sbjct: 671 QATFQRYCDSGVSKTINLRYD-ATPEDIAKAYRLAKDLHCKGITVYRDKSKT 721