RPSBLAST alignment for GI: 254780502 and conserved domain: PRK06539

>gnl|CDD|180610 PRK06539, PRK06539, ribonucleotide-diphosphate reductase subunit alpha; Validated. Length = 822
 Score =  676 bits (1746), Expect = 0.0
 Identities = 316/778 (40%), Positives = 466/778 (59%), Gaps = 13/778 (1%)

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVL--SETYKNMYDGLSESDLETAL 202
           + ++  DG+   +++ ++   +E+A  GL D  + +    SE    ++DG++   L+ A+
Sbjct: 3   ITVVKRDGSKEPYDANKVNAAIEDAARGLDDAITWVTQLASELEITLFDGITTQQLDEAV 62

Query: 203 IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
           I  +   ++ +P +  V AR LL+K+ + VL   Y  P+     E+Q L+  +F R IE+
Sbjct: 63  IQVALQNVKDDPAFDTVAARLLLKKIYKRVLGD-YDSPE-----ELQDLHANHFRRTIEK 116

Query: 263 GVKARLLHESMM-DFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHI-NGSRIEMPQAF 320
           GV   LL   +   FDL  LA  L   RD   +Y+G+  L +RY +   NG  +E+PQ F
Sbjct: 117 GVAEGLLDSRLGGLFDLERLAAALDPTRDELLKYIGVVTLNNRYGIRARNGDALEVPQYF 176

Query: 321 FMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDL 380
           +MR+AMGL+L E +    A+ FY  +S   ++ +  TL N+GT +PQLS+CF+  + DD+
Sbjct: 177 WMRIAMGLSLNEDDPTSSALAFYEKMSKLEYLAAGSTLVNAGTPYPQLSNCFVMEMQDDI 236

Query: 381 YGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQ 440
             I    ++   L K +GG+G   + +R  G+ I   N  S G IPF+   +    AV++
Sbjct: 237 EHIAKTTRDVMWLTKGTGGIGLSVSKLRAQGSPIRSNNTTSTGPIPFMHTIDSVLRAVSR 296

Query: 441 GGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
           GGK+ GA+C Y+E WH+D  EFLDLR+N+GD  RRT   NTA WI D FMKRV  +  W 
Sbjct: 297 GGKKFGALCFYMENWHMDFPEFLDLRQNSGDPYRRTRTANTAVWISDEFMKRVQNDEDWY 356

Query: 501 LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
           LF P E  DL++LYGK F   Y  Y  QA+ G I++F++I+A   +R +L  L  T HPW
Sbjct: 357 LFDPLETPDLNELYGKAFSKRYAQYVEQAEAGRIRMFKRITAREQFRAILMSLQTTSHPW 416

Query: 561 ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDK 620
           +T+KD  N R+   + G +H SNLCTEI L    +  +VCNL SINL  H A+ + D+ +
Sbjct: 417 LTWKDTINNRALNNNTGTIHLSNLCTEICLPQDRDNVSVCNLASINLSRHLADGELDWAQ 476

Query: 621 LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
           L  + R AVR LDN+IDI   ++++A  SN  +RAIGLG+MGF   +  L   Y S EA 
Sbjct: 477 LEESTRLAVRQLDNLIDITASSVKEADFSNQQNRAIGLGVMGFTDMVERLGYSYESEEAY 536

Query: 681 EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMN 739
           ++ D  ME IS+ AI  S +LA ERGAY +F+GS W +G+ P+DSI LL   R   + +N
Sbjct: 537 DLIDRIMEHISYAAIDESADLAAERGAYPNFEGSRWSRGMVPVDSIALLEADRGVPVDVN 596

Query: 740 RTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDF 799
           RT+RL WD L+ +V+  GMRN+  MAIAPTA+I  + G +  +DP +  ++ +S  SG F
Sbjct: 597 RTTRLDWDALRAKVRG-GMRNATLMAIAPTASIGLVAGTTPGLDPQFSQIFSRSTSSGKF 655

Query: 800 TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
             VN  LV +LK+  LW E +  ++    G I  I  IPD++K ++ T+F++ P   +E 
Sbjct: 656 LEVNRNLVADLKELGLW-ETVREEILRSQGDIQEIAAIPDEIKALYRTSFQLSPYAFLEV 714

Query: 860 ASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           A+R QKW+DQA S N+YL+      +  IY  AW MG+KTTYYL  +   + E+ST+K
Sbjct: 715 AARAQKWVDQAISRNMYLESRDIGDMMDIYTAAWEMGVKTTYYLHMKPRHTAEQSTVK 772