RPSBLAST alignment for GI: 254780502 and conserved domain: PRK07111

>gnl|CDD|180846 PRK07111, PRK07111, anaerobic ribonucleoside triphosphate reductase; Provisional. Length = 735
 Score = 86.2 bits (214), Expect = 4e-17
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 8/104 (7%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA 90
           ++KR+G    FD  KI+ AI KA  AV G+     +   + I  LT++ +  L +  K  
Sbjct: 5   IVKRDGREVPFDEEKITNAIFKAAEAVGGE-----LDESEAI-ELTQKVIKYLEEKYKEE 58

Query: 91  LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSH 134
           + V  EDIQD VE  L+++GH +  + Y+LYR ER+ +R  +S 
Sbjct: 59  VTV--EDIQDLVEKVLIENGHAETAKAYILYRAERTRIREIKSD 100