RPSBLAST alignment for GI: 254780502 and conserved domain: PRK07562

>gnl|CDD|181031 PRK07562, PRK07562, ribonucleotide-diphosphate reductase subunit alpha; Validated. Length = 1220
 Score = 57.7 bits (140), Expect = 1e-08
 Identities = 40/104 (38%), Positives = 59/104 (56%), Gaps = 5/104 (4%)

Query: 365 HPQLSSCFLTTVPDDLY---GIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           HPQ  +CF+ +V DDL    GI       A L KY  G G++++ +RG G  + G  GKS
Sbjct: 193 HPQPHACFIQSVEDDLVNEGGIMDLWVREARLFKYGSGTGSNFSNLRGEGEKLSG-GGKS 251

Query: 422 QGVIPFLKVANDTAVAVNQGG-KRKGAVCAYLETWHIDVEEFLD 464
            G++ FLK+ +  A A+  GG  R+ A    ++  H D+EEF+D
Sbjct: 252 SGLMSFLKIGDRAAGAIKSGGTTRRAAKMVIVDIDHPDIEEFID 295