RPSBLAST alignment for GI: 254780502 and conserved domain: PRK08115

>gnl|CDD|181232 PRK08115, PRK08115, ribonucleotide-diphosphate reductase subunit alpha; Validated. Length = 858
 Score = 56.8 bits (137), Expect = 3e-08
 Identities = 44/146 (30%), Positives = 69/146 (47%), Gaps = 5/146 (3%)

Query: 323 RVAMGLALKETEKEKRAV---EFYNLLSSFHFMCSTPTLFNSGTRHP-QLSSCF-LTTVP 377
           R A GLA  E  +EKR     +FY  L + +F+ +   L+ +G++      +C+ +  V 
Sbjct: 137 RNATGLAAVEKTEEKRKESFEKFYQELVNMNFVPAGRVLYGAGSKTDVTYFNCYVMPFVK 196

Query: 378 DDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVA 437
           D   GI    ++   +    GG+G + + +R       G NGKS G + +L         
Sbjct: 197 DSREGISEHRKQVMEIMSRGGGVGTNGSTLRPRNTLARGVNGKSSGSVSWLDDIAKLTHL 256

Query: 438 VNQGGKRKGAVCAYLETWHIDVEEFL 463
           V QGG R+GA    L  WH D+ EF+
Sbjct: 257 VEQGGSRRGAQMIMLADWHPDILEFI 282