RPSBLAST alignment for GI: 254780502 and conserved domain: PRK08188

>gnl|CDD|181278 PRK08188, PRK08188, ribonucleotide-diphosphate reductase subunit alpha; Validated. Length = 714
 Score =  208 bits (532), Expect = 5e-54
 Identities = 190/630 (30%), Positives = 290/630 (46%), Gaps = 96/630 (15%)

Query: 324 VAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHP-QLSSCFLTTVPDDL-- 380
           VA+ LA      E  A +  + + S  F  +TPT  N G +   +L SCFL  + D++  
Sbjct: 133 VALTLA---QGDETLARQLVDEIISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMES 189

Query: 381 --YGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
               I  ALQ    L+K  GG+    + +R  GA I     +S GVIP +K+  D     
Sbjct: 190 IGRSINSALQ----LSKRGGGVALLLSNLREAGAPIKRIENQSSGVIPVMKLLEDAFSYA 245

Query: 439 NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
           NQ G R+GA   YL   H D+  FLD ++   D++ R   ++    IPD+  +   +N  
Sbjct: 246 NQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKENED 305

Query: 499 WTLFSPDEVSDLHDLYGKEF-EIAY-ENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             LFSP    D+  +YGK F +I+  E Y+       I+  +KI+A   ++ +  + FE+
Sbjct: 306 MYLFSP---YDVERVYGKPFADISVTEKYDEMVADERIRK-KKINAREFFQTLAEIQFES 361

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEI-TLNSSSE-----------ETAVCNLGS 604
           G+P+I F+D  N  +P    G ++ SNLC+EI  +NS+SE           +   CNLGS
Sbjct: 362 GYPYIMFEDTVNRANPIA--GRINMSNLCSEILQVNSASEYNEDLSYAHIGKDISCNLGS 419

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVID---INC-HTIEKAKKSNHTHRAIGLGL 660
           +N +AH      D      T+ TA+R L  V D   I    +IEK   ++H   AIGLG 
Sbjct: 420 LN-IAH----TMDSPDFGRTVETAIRALTAVSDMSHIRSVPSIEKGNAASH---AIGLGQ 471

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERG-AYSSFKGSLWDQG 719
           M     L    I Y S EA++  +     +++HA+ AS  LA+ERG  ++ F+ S +  G
Sbjct: 472 MNLHGYLAREGIFYGSEEALDFTNIYFYTVTYHALRASNLLARERGETFAGFEQSKYASG 531

Query: 720 VF-----PIDSIGLLAEVRDELAMNRTSRLP----WDELKKRVKTIGMRNSNCMAIAPTA 770
            +       D     A+VR EL       +P    W +L+  V   G+ N N  A+ PT 
Sbjct: 532 EYFDKYTQQDWQPKTAKVR-ELFARAGITIPTQEDWAQLRDDVMRHGIYNQNLQAVPPTG 590

Query: 771 TIANICGVSQSIDPSYQNLYV-KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDG 829
           +I+ I   + SI P    + + K    G       ++ N+                    
Sbjct: 591 SISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAPYMTND-------------------- 630

Query: 830 SIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYL-DEPSGKKLDF- 887
              N+E   D        A+EI P  +I++ +   + +DQ  SL L+  D  + + ++  
Sbjct: 631 ---NLEYYQD--------AYEIGPEKIIDTYAAATQHVDQGLSLTLFFPDTATTRDINKA 679

Query: 888 -IYRQAWLMGLKTTYYLRSR----SATSVE 912
            IY  AW  G+KT YY+R R      T VE
Sbjct: 680 QIY--AWRKGIKTLYYIRLRQMALEGTEVE 707