RPSBLAST alignment for GI: 254780502 and conserved domain: PRK12364

>gnl|CDD|183475 PRK12364, PRK12364, ribonucleotide-diphosphate reductase subunit alpha; Provisional. Length = 842
 Score =  485 bits (1250), Expect = e-137
 Identities = 305/918 (33%), Positives = 467/918 (50%), Gaps = 128/918 (13%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++IKRNG    +D  KI  AI KAF +V GK  S      +II +L  +    + +   +
Sbjct: 2   EIIKRNGTTEPYDREKIEVAIRKAFASV-GKPIS-----DEIIYSLVAEVERFIKEKYPN 55

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
              V +E+IQD VE +LM+ GH+   + Y+LYR +R++ R A+           ++    
Sbjct: 56  GHNVSVEEIQDLVEKTLMEHGHYAEVKSYILYRAQRTEKRKARE----------QIIKFF 105

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMY-DGLSESDLETALIFSSRT 208
           DD T++      L+ I ++  S   D  S  +L+E + +     +SE +   ALI ++  
Sbjct: 106 DDDTVLGV----LKEIQKDFPS---DEYSLDLLAEKFLSFCKPNMSEGESLAALIKAAVE 158

Query: 209 LIEKE-PNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYI-EEGVKA 266
           L  +E P++  + AR L+ +  ++ L    +K        +   Y +   +Y+ EEG+  
Sbjct: 159 LTTQEAPDWEFIAARLLMLQFSKK-LGKSLEK------LGIHSFYDK--IKYLTEEGLYG 209

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHI-NGSRIEMPQAFFMRVA 325
             + E     ++   A  +  ERD  F Y GL +L  RY +   +   +E PQ  F+ +A
Sbjct: 210 SYILEHYSREEIEEAAGFIDPERDKLFTYSGLDLLLKRYVIRTHSHEPLESPQEMFLGIA 269

Query: 326 MGLALKETEKEKRAVE-FYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           + LA+ E +     V+ FY++LS      +TPTL N+     QLSSCF+ TVPD L GI+
Sbjct: 270 LHLAMPEKQDRMGWVKRFYDMLSKLKVTMATPTLSNARKPFHQLSSCFIDTVPDSLDGIY 329

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
            ++   A ++K+ GG+G  +  VR +G++I G  G + GVI ++K+ANDTAVAV+Q G R
Sbjct: 330 RSIDNFAQVSKFGGGMGLYFGKVRAVGSNIRGFQGVAGGVIRWIKLANDTAVAVDQLGMR 389

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ--NAGWTLF 502
           +GAV  YL+ WH D+ EFL LR N GDDR + HD+  A   PDLF K V    N  W LF
Sbjct: 390 QGAVAVYLDVWHKDIPEFLQLRTNNGDDRMKAHDVFPAVCYPDLFWKMVRDDINQSWYLF 449

Query: 503 SPDEVSD-----LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETG 557
            P E+       L D YG+E+E  Y +    A   +    R I    L R +L    ETG
Sbjct: 450 CPHEILTVKGYALEDYYGEEWEKRYLDCVNDARISK----RSIPIKDLVRLILKSAVETG 505

Query: 558 HPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEET-------------------- 597
            P+   +D  N  +P +H G+++ SNLCTEI  N S+ ET                    
Sbjct: 506 TPFTFNRDTVNRANPNKHKGMIYCSNLCTEIAQNMSAIETVSTEIETEDGDTVVVTTTRP 565

Query: 598 ---AVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
               VCNL S++ L +      D ++L   +RT VR LDNVID+N + +  A+ +N  +R
Sbjct: 566 GDFVVCNLASLS-LGNIDLE--DEEELEEVVRTVVRALDNVIDLNFYPVPYAQITNKRYR 622

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
           +IGLG+ G+  AL    I + S E +E AD   E I++ AI AS+E+A+E+GAY  F+GS
Sbjct: 623 SIGLGVSGYHHALAKNGIRWESEEHLEFADRVFERINYAAIKASMEIAKEKGAYGYFEGS 682

Query: 715 LWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
            W  G +     G  +E              W  L + V   GMRN+  +A+APT++ + 
Sbjct: 683 DWQTGAY-FRKRGYTSE-------------EWQRLAREVAENGMRNAYLLAVAPTSSTSI 728

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           I G +  +DP                V+  + + E K                 G++  +
Sbjct: 729 IAGTTAGVDP----------------VMKRYFLEEKK-----------------GAL--M 753

Query: 835 ERIPDDLKK----IHATAFEIDPMWLIESASRRQKWIDQAQSLNLYL-DEPSGKKLDFIY 889
            R+  +L      ++  A  ID  W I +A  RQ+ IDQAQS+NLY+ +E + +++  +Y
Sbjct: 754 PRVAPELSDKTFWLYKNAHLIDQKWSIRAAGVRQRHIDQAQSVNLYITNEFTMRQVLDLY 813

Query: 890 RQAWLMGLKTTYYLRSRS 907
             AW  G+KT YY+RS+S
Sbjct: 814 LLAWEEGVKTIYYVRSKS 831