RPSBLAST alignment for GI: 254780502 and conserved domain: COG0209

>gnl|CDD|73173 COG0209, NrdA, Ribonucleotide reductase, alpha subunit [Nucleotide transport and metabolism]. Length = 651
 Score =  567 bits (1462), Expect = e-162
 Identities = 256/752 (34%), Positives = 357/752 (47%), Gaps = 117/752 (15%)

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
               T    YDG   +  E  ++ +   + E +P+  ++ AR     LR+E +     + 
Sbjct: 1   RELRTVIGFYDG--ITIAENLILAALTVIEEDDPDVQRLAARLAGSDLRKEAV-----RQ 53

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
                   + ++      Y ++      L       DL  L   +  ERD  F Y   ++
Sbjct: 54  FGRFDVLDEKVFALVANGYYDQ-----RLLRLYSREDLDDLNKKILLERDRQFSYAAAKV 108

Query: 301 LYDRYFLHINGSR--IEMPQAFFMRVAMGLALKETE--KEKRAVEFYNLLSSFHFMCSTP 356
           LY RY L        +E+PQ  FMRVA+ LA  E    + + A EFY+L+SS  FM +TP
Sbjct: 109 LYSRYLLKDEDGSEILELPQDLFMRVALLLAQNEAPERRLEWAKEFYDLMSSLRFMPATP 168

Query: 357 TLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHG 416
           TL N GT   QLSSCF+  V DD                                     
Sbjct: 169 TLLNGGTPRGQLSSCFVLPVEDD------------------------------------- 191

Query: 417 TNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRT 476
               S GV+PF+K+ +D   A+NQGG R+GA   YL+ WH D+EEFLD ++N GD+  R 
Sbjct: 192 ----SSGVVPFMKLLDDAFDAINQGGVRRGAQAVYLDIWHPDIEEFLDAKRNNGDEILRA 247

Query: 477 HDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKV 536
            D++   WIPDLFMKR  +   WTLFSP +  +  D+YG EFE  Y  YE          
Sbjct: 248 FDISVGVWIPDLFMKRAKEGEDWTLFSPRDGYEAPDVYGAEFE-EYAEYEAD----PGIR 302

Query: 537 FRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQ-QHVGVVHSSNLCTEITLNSSS- 594
            ++I A  L+ K+    FETG P++ F D  N R+P  +  G + +SNLC+EI   +   
Sbjct: 303 KKRIKARELFDKLAEAAFETGDPYLIFVDTLNRRNPNAEGGGAIRASNLCSEILQRTKPL 362

Query: 595 ------EETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKK 648
                  E A CNLGSINL           D LA  +  AVR LDNVID+N + + +A++
Sbjct: 363 SLEQPLGEDASCNLGSINLAKFVKYG----DGLAELVAVAVRALDNVIDLNPYPVPEAER 418

Query: 649 SNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAY 708
           +N   RAIGLG+MG    L  L IPY S EA++  D   E+I+++A+ AS ELA+ERG Y
Sbjct: 419 ANAESRAIGLGVMGLADLLAQLGIPYGSEEALKFNDRLFEYIAYYALKASAELAKERGPY 478

Query: 709 SSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAP 768
             F+GS W +G+ PID   L     D           W++L++ +K  G+RNS   AIAP
Sbjct: 479 PYFEGSRWARGILPIDYPRLFGITED-----------WEKLREDIKKHGLRNSYLTAIAP 527

Query: 769 TATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHD 828
           T +I+ I G +  I+P +  +Y +    G F  V   L  +L                  
Sbjct: 528 TGSISYIAGTTSGIEPIFALVYFRETKGGRFYYVVPPLFEDLLAYYGL------------ 575

Query: 829 GSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLD-EPSGKKLDF 887
                              A+EIDP+W I+  +  Q+WIDQ  S  L L    + K L+ 
Sbjct: 576 -------------------AYEIDPLWHIDMQAAAQRWIDQGISKTLNLPNTATTKDLNK 616

Query: 888 IYRQAWLMGLKTTYYLRSRSATSVEKSTLKGV 919
            Y  AW +GLKTTYY R+  A  V    L   
Sbjct: 617 AYLYAWKLGLKTTYYRRTSQAAQVLTVVLDCE 648