RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate
reductase subunit alpha [Candidatus Liberibacter asiaticus str. psy62]
         (954 letters)



>gnl|CDD|180884 PRK07207, PRK07207, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 965

 Score = 1707 bits (4422), Expect = 0.0
 Identities = 596/949 (62%), Positives = 733/949 (77%), Gaps = 14/949 (1%)

Query: 16  PSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNL 75
            +LA   P ++   +VI+RNG V  F+PSKI+ A+ KAF+AVEG  A+ S RV++ ++ L
Sbjct: 21  GALAAAAPGQLADYKVIRRNGSVVPFEPSKIAVAMTKAFLAVEGGQAAASARVRETVEQL 80

Query: 76  TEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS 135
           TEQ V  L++   S    HIEDIQDQVE +LM+SG HK+ R YVLYRE+R+  RAA++ +
Sbjct: 81  TEQVVRALVRRRPSGGTFHIEDIQDQVELALMRSGEHKVARAYVLYREKRAQERAAEAEA 140

Query: 136 KSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSE 195
            +     P L + +DDG     +  RL  ++EEAC GL+ V ++ +L+ET KN+YDG+  
Sbjct: 141 AAAEA-HPGLNVTLDDGVRRPLDMARLRALIEEACEGLEAVDAEPILAETLKNLYDGVPM 199

Query: 196 SDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEY 255
            ++  ALI ++RTLIEKEPNY+ VTAR LL+ LRRE L  +   P++ T  EM   Y EY
Sbjct: 200 DEVYKALILAARTLIEKEPNYSYVTARLLLDTLRREALGFLGV-PEEVTQAEMATRYAEY 258

Query: 256 FCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIE 315
           F  +I++G++A LL   +  FDL  L   L  ERD  F YLGLQ LYDRYFLH++G+RIE
Sbjct: 259 FPAFIKKGIEAELLDPKLAQFDLERLGAALDPERDLQFTYLGLQTLYDRYFLHVDGTRIE 318

Query: 316 MPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTT 375
           +PQAFFMRVAMGLAL E ++E RA+EFYNLLSSF FM STPTLFNSGT  PQLSSC+LTT
Sbjct: 319 LPQAFFMRVAMGLALNEIDREARAIEFYNLLSSFDFMSSTPTLFNSGTLRPQLSSCYLTT 378

Query: 376 VPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTA 435
           VPDDL GI+ A+++NA+L+K++GGLGNDWTPVR LG+HI GTNGKSQGV+PFLKV NDTA
Sbjct: 379 VPDDLDGIYEAIKDNALLSKFAGGLGNDWTPVRALGSHIKGTNGKSQGVVPFLKVVNDTA 438

Query: 436 VAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ 495
           VAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +
Sbjct: 439 VAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVME 498

Query: 496 NAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFE 555
           +  WTLFSP EV DLHDL+GK FE AY  YE +A RGEIK+F+KI AV LWRKML+MLFE
Sbjct: 499 DGEWTLFSPSEVPDLHDLFGKAFEEAYTAYEAKAARGEIKLFKKIPAVDLWRKMLSMLFE 558

Query: 556 TGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN- 614
           TGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGS+NL+AH  +  
Sbjct: 559 TGHPWITFKDPCNLRSPQQHVGVVHSSNLCTEITLNTSDDEIAVCNLGSVNLVAHIKDGA 618

Query: 615 QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPY 674
           + D++KL  T+ TA+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ AL+LL IPY
Sbjct: 619 KLDHEKLKRTVSTAMRMLDNVIDINYYAVPKARNSNLRHRPVGLGIMGFQDALYLLRIPY 678

Query: 675 ASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR- 733
           AS EAVE AD SME +S++AI AS ELA+ERG YSS++GSLW +G+ PIDS+ LLAE R 
Sbjct: 679 ASDEAVEFADRSMEAVSYYAIWASTELAEERGRYSSYEGSLWSRGILPIDSLKLLAEARG 738

Query: 734 DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS 793
             L ++R+S L WD L+ R+K  GMRNSNCMAIAPTATI+NI GVSQSI+P+YQNLYVKS
Sbjct: 739 GYLEVDRSSTLDWDALRARIKKHGMRNSNCMAIAPTATISNIIGVSQSIEPTYQNLYVKS 798

Query: 794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDP 853
           N+SG+FTVVN +LV +LK R LWDE M++DLKY DGS+  I+RIP DLK ++ATAFE+DP
Sbjct: 799 NLSGEFTVVNPYLVRDLKARGLWDEVMVNDLKYFDGSLQRIDRIPADLKALYATAFEVDP 858

Query: 854 MWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK 913
            WL+E+ASRRQKWIDQAQSLNLY+   SGKKLD  Y+ AWL GLKTTYYLR+  AT VEK
Sbjct: 859 RWLVEAASRRQKWIDQAQSLNLYMAGASGKKLDETYKLAWLRGLKTTYYLRTLGATHVEK 918

Query: 914 STLKGVDGKLNAVP-------VTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           ST+    G LNAV             ++      P +C+  D +CE CQ
Sbjct: 919 STVN--TGALNAVSSGGGGAGGAAAAAAAPPAADPKACSIDDPDCEACQ 965


>gnl|CDD|171440 PRK12365, PRK12365, ribonucleotide-diphosphate reductase subunit
            alpha; Provisional.
          Length = 1046

 Score = 1058 bits (2738), Expect = 0.0
 Identities = 501/940 (53%), Positives = 638/940 (67%), Gaps = 25/940 (2%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
            + VI+R+G V  F+P KIS A+ KAF A +         V + I  LT+  V  +L+   
Sbjct: 118  LSVIRRDGTVVHFNPMKISAALEKAFRATDKIEGMTPSSVLEEINALTQNIVEEILECCS 177

Query: 89   SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRA--AQSHSKSDAPIAPKLK 146
                + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR    +  S          +
Sbjct: 178  QEDRIDIEKIQDIVEQQLMVVGHYDVAKNYILYREARARVRDNKEEDGSTEKTIAEEAYE 237

Query: 147  IMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLETALIFS 205
            ++  DG+  +    +L      ACS   + +   +L++  + N Y G+ ES++  A I +
Sbjct: 238  VLSKDGSTYTMTKSQLLAHFAWACSRFPETTDAALLADMAFANFYSGIKESEVVLACIMA 297

Query: 206  SRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVK 265
            +R  IEKEP+YA V A  LL+ + +E L       +     +++  + ++F RYI EG  
Sbjct: 298  ARANIEKEPDYAFVAAELLLDVVYKEALG------KSKYDEDLEEAHKDHFKRYILEGDT 351

Query: 266  ARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVA 325
             RL +  +  +DL  LA  L   RD  F Y+G+Q LYDRYF H  G R+E PQ F+MRV+
Sbjct: 352  YRL-NPELKHYDLDALAEALDLSRDLQFSYMGVQNLYDRYFNHHEGRRLETPQIFWMRVS 410

Query: 326  MGLALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
            MGLAL E + K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  I+
Sbjct: 411  MGLALNEGQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLVHIY 470

Query: 385  GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
              + +NAML+K++GG+GNDWT VR  GA I GTNGKSQGVIPF+KVANDTAVAVNQGGKR
Sbjct: 471  KVISDNAMLSKWAGGIGNDWTAVRATGALIKGTNGKSQGVIPFIKVANDTAVAVNQGGKR 530

Query: 445  KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
            KGAVC YLE WH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ Q   WTLFSP
Sbjct: 531  KGAVCVYLEVWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLQQKGTWTLFSP 590

Query: 505  DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
            D+V  LH+ YG+EFE  YE YER+ D GEI++++K+ A  LWRKML+ML+ETGHPW+TFK
Sbjct: 591  DDVPGLHEAYGEEFEKLYEEYERKVDTGEIRLYKKVEAEDLWRKMLSMLYETGHPWMTFK 650

Query: 565  DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAST 624
            DP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H  N+  D +KL+ T
Sbjct: 651  DPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVEHIVNDGLDEEKLSET 710

Query: 625  IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
            I  A+R+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L+I YAS EAVE AD
Sbjct: 711  ISIAIRILDNVIDINFYPTKEAKEANLAHRAIGLGVMGFQDALYKLNISYASQEAVEFAD 770

Query: 685  ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTS 742
             S E I+++AI AS  LA+ERG YSS+KGS WD+G  PID+I LL E R E  L M+ +S
Sbjct: 771  YSSELIAYYAILASSLLAKERGTYSSYKGSKWDRGYLPIDTIELLKEYRGEANLLMDTSS 830

Query: 743  RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            R  W+ ++  +K  GMRNS  MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT+ 
Sbjct: 831  RKDWEPVRSLIKEYGMRNSQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFTIP 890

Query: 803  NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
            N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LKKI  TAFEI+P W+IE ASR
Sbjct: 891  NVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKKIFLTAFEIEPEWIIECASR 950

Query: 863  RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD-G 921
            RQKWID  QSLNLYL EP GKKL  +Y  AW  GLKTTYYLRS +ATSVEKS    VD  
Sbjct: 951  RQKWIDMGQSLNLYLAEPDGKKLSNMYLTAWKKGLKTTYYLRSSAATSVEKSF---VDIN 1007

Query: 922  KLNAVPVTDPNSSTHSLGI-------PSSCTSDTECEVCQ 954
            K    P    N S  S  I          C+ +  CE CQ
Sbjct: 1008 KRGIQPRWMKNKSA-STSIVVERAKKTPVCSLEEGCESCQ 1046



 Score = 70.7 bits (173), Expect = 1e-12
 Identities = 44/171 (25%), Positives = 80/171 (46%), Gaps = 26/171 (15%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIR--------VQDIIKNLT 76
           + K   ++KRNG    F+ ++I +A+  AF        +RS+         ++  I+++T
Sbjct: 5   QEKQYTIVKRNGMFVPFNQNRIFQALEAAFRD------TRSLEDHSPLPEDLESSIRSIT 58

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
            Q V  ++Q      +V +E IQD VE  L  +G   + R+Y++YR++R   R     S 
Sbjct: 59  HQVVKEVVQKITEGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQS- 117

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ---DVSSKIVLSE 184
                   L ++  DGT++ FN  ++   +E+A         ++   VL E
Sbjct: 118 --------LSVIRRDGTVVHFNPMKISAALEKAFRATDKIEGMTPSSVLEE 160


>gnl|CDD|162894 TIGR02506, NrdE_NrdA, ribonucleoside-diphosphate reductase, alpha
           subunit.  This model identifies RNR's in diverse clades
           of bacteria, eukaryotes as well as numerous DNA viruses
           and phage.
          Length = 617

 Score =  697 bits (1800), Expect = 0.0
 Identities = 275/622 (44%), Positives = 380/622 (61%), Gaps = 15/622 (2%)

Query: 295 YLGLQILYDRYFL--HINGSRIEMPQAFFMRVAMGLALKET--EKEKRAVEFYNLLSSFH 350
           Y+GL+ LY+RY L     G+  E PQ  +MRVAMGLA  E    +   A+ FY+LLS   
Sbjct: 1   YMGLKELYNRYLLRNAATGAIYESPQEAYMRVAMGLASLEPKDTRLADAIRFYDLLSRLK 60

Query: 351 FMCSTPTLFNSGTRHPQLSSCFLTTVPDD-LYGIFGALQENAMLAKYSGGLGNDWTPVRG 409
              +TPTLFN+GT   QLSSCFL  V DD L  I+ A+ + A L+K+ GG+G + T +R 
Sbjct: 61  ISPATPTLFNAGTPRGQLSSCFLLDVTDDTLESIYKAIDDVAQLSKHGGGIGLNLTKLRA 120

Query: 410 LGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNT 469
           +G+ I GTN  S+G+IPFLK+ + +  AVNQGGKR GA   YLE WH D+EEFLDL+KN 
Sbjct: 121 IGSPIRGTNNASKGIIPFLKLLDSSVEAVNQGGKRPGAAAVYLEVWHPDIEEFLDLKKNN 180

Query: 470 GDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQA 529
           GD+RRR  ++    WIPDLFMKRV ++  W LFSP +V  L+ LYG+EFE  YE  E+  
Sbjct: 181 GDERRRCDNLFYGLWIPDLFMKRVEEDKDWYLFSPYDVPGLYGLYGEEFEEEYERLEKDV 240

Query: 530 DRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSP-QQHVGVVHSSNLCTEI 588
           +  +    RK+SA  L + +L    ETG P+I FKD  N  +P +   G +  SNLCTEI
Sbjct: 241 EARKKI--RKVSARDLMKDILRTRVETGRPYILFKDAVNKHNPFKTGGGAIKMSNLCTEI 298

Query: 589 TLN---SSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEK 645
           T     S   ETAVCNL S+NL      ++FD+ +L   +R AVR LDNVID+  +    
Sbjct: 299 TQPTDDSHKGETAVCNLASVNLANFVMEDKFDFSELEDAVRIAVRFLDNVIDLQNYPTAP 358

Query: 646 AKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQER 705
           A KSN   R+IG+G+MG    L  L +PY S EA ++ D   E I ++AI AS ELA+E+
Sbjct: 359 AAKSNQRRRSIGIGVMGLHDVLAKLGLPYDSEEARDLNDRIFEAIYYYAIKASAELAKEK 418

Query: 706 GAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMA 765
           G +  F GS + +G    D+     +  D       +   W+ L++R+K  G+RNS   A
Sbjct: 419 GPFPGFSGSKYAKGWLHPDTW---EKTIDPKTSMAPTEEDWEALRERIKEYGLRNSQLTA 475

Query: 766 IAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLK 825
           + PTA+ + + GV++SI+P + N++ K  +SG+F + N +L+ EL++  LWD     D+ 
Sbjct: 476 LMPTASSSQLTGVTESIEPVFSNIFTKKTLSGEFLIPNKYLMKELEELGLWDADRRGDIV 535

Query: 826 YHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDE-PSGKK 884
            + GS   I  IP+ LK  + TA+E+D   LI+ A+ RQK++DQ+ SLNL+L E  + K 
Sbjct: 536 ENVGSPQPIAAIPETLKYKYKTAYELDQEALIDMAADRQKFVDQSISLNLFLTEEVTAKD 595

Query: 885 LDFIYRQAWLMGLKTTYYLRSR 906
           L  +   AW  GLKT YY RSR
Sbjct: 596 LLKLLLLAWKKGLKTMYYCRSR 617


>gnl|CDD|180610 PRK06539, PRK06539, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 822

 Score =  676 bits (1746), Expect = 0.0
 Identities = 316/778 (40%), Positives = 466/778 (59%), Gaps = 13/778 (1%)

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVL--SETYKNMYDGLSESDLETAL 202
           + ++  DG+   +++ ++   +E+A  GL D  + +    SE    ++DG++   L+ A+
Sbjct: 3   ITVVKRDGSKEPYDANKVNAAIEDAARGLDDAITWVTQLASELEITLFDGITTQQLDEAV 62

Query: 203 IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
           I  +   ++ +P +  V AR LL+K+ + VL   Y  P+     E+Q L+  +F R IE+
Sbjct: 63  IQVALQNVKDDPAFDTVAARLLLKKIYKRVLGD-YDSPE-----ELQDLHANHFRRTIEK 116

Query: 263 GVKARLLHESMM-DFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHI-NGSRIEMPQAF 320
           GV   LL   +   FDL  LA  L   RD   +Y+G+  L +RY +   NG  +E+PQ F
Sbjct: 117 GVAEGLLDSRLGGLFDLERLAAALDPTRDELLKYIGVVTLNNRYGIRARNGDALEVPQYF 176

Query: 321 FMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDL 380
           +MR+AMGL+L E +    A+ FY  +S   ++ +  TL N+GT +PQLS+CF+  + DD+
Sbjct: 177 WMRIAMGLSLNEDDPTSSALAFYEKMSKLEYLAAGSTLVNAGTPYPQLSNCFVMEMQDDI 236

Query: 381 YGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQ 440
             I    ++   L K +GG+G   + +R  G+ I   N  S G IPF+   +    AV++
Sbjct: 237 EHIAKTTRDVMWLTKGTGGIGLSVSKLRAQGSPIRSNNTTSTGPIPFMHTIDSVLRAVSR 296

Query: 441 GGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
           GGK+ GA+C Y+E WH+D  EFLDLR+N+GD  RRT   NTA WI D FMKRV  +  W 
Sbjct: 297 GGKKFGALCFYMENWHMDFPEFLDLRQNSGDPYRRTRTANTAVWISDEFMKRVQNDEDWY 356

Query: 501 LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
           LF P E  DL++LYGK F   Y  Y  QA+ G I++F++I+A   +R +L  L  T HPW
Sbjct: 357 LFDPLETPDLNELYGKAFSKRYAQYVEQAEAGRIRMFKRITAREQFRAILMSLQTTSHPW 416

Query: 561 ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDK 620
           +T+KD  N R+   + G +H SNLCTEI L    +  +VCNL SINL  H A+ + D+ +
Sbjct: 417 LTWKDTINNRALNNNTGTIHLSNLCTEICLPQDRDNVSVCNLASINLSRHLADGELDWAQ 476

Query: 621 LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
           L  + R AVR LDN+IDI   ++++A  SN  +RAIGLG+MGF   +  L   Y S EA 
Sbjct: 477 LEESTRLAVRQLDNLIDITASSVKEADFSNQQNRAIGLGVMGFTDMVERLGYSYESEEAY 536

Query: 681 EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMN 739
           ++ D  ME IS+ AI  S +LA ERGAY +F+GS W +G+ P+DSI LL   R   + +N
Sbjct: 537 DLIDRIMEHISYAAIDESADLAAERGAYPNFEGSRWSRGMVPVDSIALLEADRGVPVDVN 596

Query: 740 RTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDF 799
           RT+RL WD L+ +V+  GMRN+  MAIAPTA+I  + G +  +DP +  ++ +S  SG F
Sbjct: 597 RTTRLDWDALRAKVRG-GMRNATLMAIAPTASIGLVAGTTPGLDPQFSQIFSRSTSSGKF 655

Query: 800 TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
             VN  LV +LK+  LW E +  ++    G I  I  IPD++K ++ T+F++ P   +E 
Sbjct: 656 LEVNRNLVADLKELGLW-ETVREEILRSQGDIQEIAAIPDEIKALYRTSFQLSPYAFLEV 714

Query: 860 ASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           A+R QKW+DQA S N+YL+      +  IY  AW MG+KTTYYL  +   + E+ST+K
Sbjct: 715 AARAQKWVDQAISRNMYLESRDIGDMMDIYTAAWEMGVKTTYYLHMKPRHTAEQSTVK 772


>gnl|CDD|181429 PRK08447, PRK08447, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 789

 Score =  616 bits (1590), Expect = e-177
 Identities = 320/823 (38%), Positives = 443/823 (53%), Gaps = 142/823 (17%)

Query: 168 EACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEK----EPNYAKVTARF 223
           +A  GL+ VS   +  +      DG++  +++  LI   +T ++K     PN+  V AR 
Sbjct: 25  DAVEGLEGVSQSELEVDAKIQFRDGITTEEIQQTLI---KTAVDKIDIDRPNWTFVAARL 81

Query: 224 LLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLAN 283
            L  L        Y K    T +       EYF +  +EG   R+L      +DL  L  
Sbjct: 82  FLYDL--------YHKVSGFTGY---NHLKEYFEKGEKEG---RILLGLKEKYDLDDLNA 127

Query: 284 DLKYERDFAFEYLGLQILYDRYFLH-INGSRIEMPQAFFMRVAMGLALKETEKEKRAVEF 342
            +K ERD  F YLG++ LYDRY +   N + IE+PQ  FM +AM LA  E + +K A +F
Sbjct: 128 YIKPERDLQFNYLGIKTLYDRYLIKDRNNNPIELPQHMFMAIAMFLAQNELDPQKWAKKF 187

Query: 343 YNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGN 402
           Y+++S F  M +TPTL N+ T   QLSSC++ + PD++ GIF + +E A+L+KY GG+G 
Sbjct: 188 YDVISKFEVMLATPTLSNARTTRHQLSSCYIGSTPDNIEGIFDSYKEMALLSKYGGGIGW 247

Query: 403 DWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEF 462
           DW+ VR +G++I G    + G+IPFLK+ ND A+AV+Q G RKGA+  YLE WH+D+ +F
Sbjct: 248 DWSKVRAMGSYIDGHKNAAGGIIPFLKITNDIAIAVDQLGTRKGAIAVYLEPWHMDISDF 307

Query: 463 LDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAY 522
           +DLRKN+G++RRR HD+  A WI DLFMKRV ++A WTLF P E  DL +LYG+EFE  Y
Sbjct: 308 IDLRKNSGEERRRAHDLFPALWINDLFMKRVEEDAMWTLFDPYECKDLTELYGEEFEKRY 367

Query: 523 ENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSS 582
             YE+  D   IK    I+A  LW+K+LT  FETG P++ FKD  N  +P  H G++ SS
Sbjct: 368 LEYEK--DEKIIK--EYINAKELWKKILTNYFETGLPFLCFKDNANRANPNAHAGIIRSS 423

Query: 583 NLCTE-------------ITLNSSSEE--------------------------------- 596
           NLCTE             I     S E                                 
Sbjct: 424 NLCTEIFQNTAPNHYKIKIEFEDGSIEFFEEEELVTVDSGITKKAKKITSLDSLKGKKIY 483

Query: 597 ----------TAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKA 646
                     TAVCNL SINL     N + D +++   +  A+R+LDNVID+N +   K 
Sbjct: 484 IVEKEKKDGKTAVCNLASINLSK--INTKEDIERV---VPIAIRMLDNVIDLNFYPNRKV 538

Query: 647 KKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERG 706
           K +N   RAIGLG+MG    L    I + S E +E  DE ME IS++AI AS  LA E+G
Sbjct: 539 KATNLKSRAIGLGVMGEAQMLAEHKIAWGSKEHLEKIDEIMEQISYNAIDASSNLALEKG 598

Query: 707 AYSSFKGSLWDQGVFPIDSI-----------GLLAEVRDELAMNRTSRLPWDELKKRVKT 755
            Y  F+GS W +G+FPID             GL     D           W+ L+++VK 
Sbjct: 599 VYPDFEGSNWSKGIFPIDKANEEAKKLVERGGLFDSACD-----------WEGLREKVKK 647

Query: 756 IGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDL 815
            GMRN   MAIAPT++I+ + G +Q+I+P Y+  + + N+SG   VV    V  L   + 
Sbjct: 648 DGMRNGYLMAIAPTSSISILVGTTQTIEPVYKRKWFEENLSGLIPVV----VPNLSP-ET 702

Query: 816 WDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNL 875
           W                          + +  A+++D   LI++A+ RQKWIDQ QSLN+
Sbjct: 703 W--------------------------QYYTPAYDLDQKDLIKAAAVRQKWIDQGQSLNI 736

Query: 876 Y--LDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
           +  LD+ SGK L+ IY  AW +GLK+TYYLRS S  S E S  
Sbjct: 737 FLSLDKASGKYLNEIYTLAWKLGLKSTYYLRSESPESEEVSVA 779


>gnl|CDD|178056 PLN02437, PLN02437, ribonucleoside--diphosphate reductase large
           subunit.
          Length = 813

 Score =  588 bits (1517), Expect = e-168
 Identities = 296/797 (37%), Positives = 443/797 (55%), Gaps = 66/797 (8%)

Query: 190 YDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQ 249
           Y G++ S L+     ++  +    P+YA + AR  +  L        +K  +K+    ++
Sbjct: 48  YKGVTTSQLDELAAETAAAMTTNHPDYAILAARIAVSNL--------HKNTKKSFSETVK 99

Query: 250 CLYPEYFCRYIEEGVKARLLHESMMDFDLV-----YLANDLKYERDFAFEYLGLQILYDR 304
            +Y     R    G+KA L+ + +  +D++      L +++ Y+RDF ++Y G + L   
Sbjct: 100 DMYNHVNER---SGLKAPLIADDV--YDIIMKNAARLDSEIIYDRDFDYDYFGFKTLERS 154

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           Y L +NG  +E PQ   MRV++G+   + E    A++ Y+L+S   F  ++PTLFN+GT 
Sbjct: 155 YLLKVNGKVVERPQHMLMRVSVGIHKDDIE---SAIKTYHLMSQRWFTHASPTLFNAGTP 211

Query: 365 HPQLSSCFLTTVPDD-LYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
            PQLSSCFL  + DD + GI+  L+E A+++K +GG+G     +R  G++I GTNG S G
Sbjct: 212 RPQLSSCFLICMKDDSIEGIYDTLKECAVISKSAGGIGLSVHNIRATGSYIRGTNGTSNG 271

Query: 424 VIPFLKVANDTAVAVNQGG-KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTA 482
           ++P L+V NDTA  V+QGG KRKGA   YLE WH D+ EFLDLRKN G +  R  D+  A
Sbjct: 272 IVPMLRVFNDTARYVDQGGGKRKGAFAIYLEPWHADIFEFLDLRKNHGKEEHRARDLFYA 331

Query: 483 NWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISA 542
            WIPDLFM+RV  N  W+LF P+E   L D +G+EFE  Y  YER+      K  + + A
Sbjct: 332 LWIPDLFMERVQSNGDWSLFCPNEAPGLADCWGEEFERLYTKYEREG-----KAKKVVQA 386

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
             LW  +L    ETG P++ FKD CN +S QQ++G + SSNLCTEI   +S  ETAVCNL
Sbjct: 387 QQLWFAILESQIETGTPYMLFKDSCNRKSNQQNLGTIKSSNLCTEIIEYTSPTETAVCNL 446

Query: 603 GSINL-----------LAH---------FANNQFDYDKLASTIRTAVRVLDNVIDINCHT 642
            SI L            +H           N  FD++KLA       R L+ +ID+N + 
Sbjct: 447 ASIALPRFVREKGVPLESHPSKLVGSLGSKNRYFDFEKLAEVTAVVTRNLNKIIDVNYYP 506

Query: 643 IEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELA 702
           +E A++SN  HR IG+G+ G   A  LL +P+ SPEA ++  +  E I +HA+ AS ELA
Sbjct: 507 VETARRSNMRHRPIGIGVQGLADAFILLGMPFDSPEAQQLNKDIFETIYYHALKASSELA 566

Query: 703 QERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSN 762
              G Y ++ GS   +G+   D  G+            + R  W  L++ +   G+RNS 
Sbjct: 567 AREGPYETYAGSPVSKGILQPDMWGVTP----------SGRWDWAALREMISKNGVRNSL 616

Query: 763 CMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMIS 822
            +A  PTA+ + I G ++  +P   N+Y +  +SG+F VVN  L+++L +  LW   + +
Sbjct: 617 LVAPMPTASTSQILGNNECFEPYTSNIYSRRVLSGEFVVVNKHLLHDLTEMGLWTPTLKN 676

Query: 823 DLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSG 882
            +   +GS+  I  IPDDLK I+ T +EI    L++ A+ R  +IDQ+QSLN+++D+P+ 
Sbjct: 677 KIIAENGSVQKIPEIPDDLKAIYKTVWEIKQRTLVDMAADRGCYIDQSQSLNIHMDQPNF 736

Query: 883 KKLDFIYRQAWLMGLKT-TYYLRSRSATS-----VEKSTLKGVDGKLNAVPVTDPNSSTH 936
            KL  ++  AW  GLKT  YYLRSR+A       V+ ++LK     + A    D  +   
Sbjct: 737 GKLTSLHFYAWSKGLKTGMYYLRSRAAADAIKFTVDTASLKPSATGVAAPEEEDVETKMA 796

Query: 937 SLGIPSSCTSDTECEVC 953
            +    S  +  EC  C
Sbjct: 797 QMVC--SLDNREECLAC 811


>gnl|CDD|183475 PRK12364, PRK12364, ribonucleotide-diphosphate reductase subunit
           alpha; Provisional.
          Length = 842

 Score =  485 bits (1250), Expect = e-137
 Identities = 305/918 (33%), Positives = 467/918 (50%), Gaps = 128/918 (13%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++IKRNG    +D  KI  AI KAF +V GK  S      +II +L  +    + +   +
Sbjct: 2   EIIKRNGTTEPYDREKIEVAIRKAFASV-GKPIS-----DEIIYSLVAEVERFIKEKYPN 55

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
              V +E+IQD VE +LM+ GH+   + Y+LYR +R++ R A+           ++    
Sbjct: 56  GHNVSVEEIQDLVEKTLMEHGHYAEVKSYILYRAQRTEKRKARE----------QIIKFF 105

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMY-DGLSESDLETALIFSSRT 208
           DD T++      L+ I ++  S   D  S  +L+E + +     +SE +   ALI ++  
Sbjct: 106 DDDTVLGV----LKEIQKDFPS---DEYSLDLLAEKFLSFCKPNMSEGESLAALIKAAVE 158

Query: 209 LIEKE-PNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYI-EEGVKA 266
           L  +E P++  + AR L+ +  ++ L    +K        +   Y +   +Y+ EEG+  
Sbjct: 159 LTTQEAPDWEFIAARLLMLQFSKK-LGKSLEK------LGIHSFYDK--IKYLTEEGLYG 209

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHI-NGSRIEMPQAFFMRVA 325
             + E     ++   A  +  ERD  F Y GL +L  RY +   +   +E PQ  F+ +A
Sbjct: 210 SYILEHYSREEIEEAAGFIDPERDKLFTYSGLDLLLKRYVIRTHSHEPLESPQEMFLGIA 269

Query: 326 MGLALKETEKEKRAVE-FYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           + LA+ E +     V+ FY++LS      +TPTL N+     QLSSCF+ TVPD L GI+
Sbjct: 270 LHLAMPEKQDRMGWVKRFYDMLSKLKVTMATPTLSNARKPFHQLSSCFIDTVPDSLDGIY 329

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
            ++   A ++K+ GG+G  +  VR +G++I G  G + GVI ++K+ANDTAVAV+Q G R
Sbjct: 330 RSIDNFAQVSKFGGGMGLYFGKVRAVGSNIRGFQGVAGGVIRWIKLANDTAVAVDQLGMR 389

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ--NAGWTLF 502
           +GAV  YL+ WH D+ EFL LR N GDDR + HD+  A   PDLF K V    N  W LF
Sbjct: 390 QGAVAVYLDVWHKDIPEFLQLRTNNGDDRMKAHDVFPAVCYPDLFWKMVRDDINQSWYLF 449

Query: 503 SPDEVSD-----LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETG 557
            P E+       L D YG+E+E  Y +    A   +    R I    L R +L    ETG
Sbjct: 450 CPHEILTVKGYALEDYYGEEWEKRYLDCVNDARISK----RSIPIKDLVRLILKSAVETG 505

Query: 558 HPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEET-------------------- 597
            P+   +D  N  +P +H G+++ SNLCTEI  N S+ ET                    
Sbjct: 506 TPFTFNRDTVNRANPNKHKGMIYCSNLCTEIAQNMSAIETVSTEIETEDGDTVVVTTTRP 565

Query: 598 ---AVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
               VCNL S++ L +      D ++L   +RT VR LDNVID+N + +  A+ +N  +R
Sbjct: 566 GDFVVCNLASLS-LGNIDLE--DEEELEEVVRTVVRALDNVIDLNFYPVPYAQITNKRYR 622

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
           +IGLG+ G+  AL    I + S E +E AD   E I++ AI AS+E+A+E+GAY  F+GS
Sbjct: 623 SIGLGVSGYHHALAKNGIRWESEEHLEFADRVFERINYAAIKASMEIAKEKGAYGYFEGS 682

Query: 715 LWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
            W  G +     G  +E              W  L + V   GMRN+  +A+APT++ + 
Sbjct: 683 DWQTGAY-FRKRGYTSE-------------EWQRLAREVAENGMRNAYLLAVAPTSSTSI 728

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           I G +  +DP                V+  + + E K                 G++  +
Sbjct: 729 IAGTTAGVDP----------------VMKRYFLEEKK-----------------GAL--M 753

Query: 835 ERIPDDLKK----IHATAFEIDPMWLIESASRRQKWIDQAQSLNLYL-DEPSGKKLDFIY 889
            R+  +L      ++  A  ID  W I +A  RQ+ IDQAQS+NLY+ +E + +++  +Y
Sbjct: 754 PRVAPELSDKTFWLYKNAHLIDQKWSIRAAGVRQRHIDQAQSVNLYITNEFTMRQVLDLY 813

Query: 890 RQAWLMGLKTTYYLRSRS 907
             AW  G+KT YY+RS+S
Sbjct: 814 LLAWEEGVKTIYYVRSKS 831


>gnl|CDD|180831 PRK07088, PRK07088, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 764

 Score =  458 bits (1181), Expect = e-129
 Identities = 272/818 (33%), Positives = 404/818 (49%), Gaps = 122/818 (14%)

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIF 204
           +KI   DG       ++ + +V+ AC GL       +  ++     DG++  +++ +LI 
Sbjct: 3   IKIKKRDGQYEPLQVEKTKKMVKLACEGLYGCDPLELELDSRIQFRDGMTTKEIQKSLI- 61

Query: 205 SSRTLIEK----------------EPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEM 248
             +T IEK                 PN+  V AR  +  L +E      +  +       
Sbjct: 62  --QTAIEKVIQNSKDNNGNNTKKTNPNWQYVAARLYVFDLYKEA-----RINRHYNSFGY 114

Query: 249 QCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLH 308
              Y E   + +EE +    L ++    ++  L   +K ERDF F Y GL++L DRY + 
Sbjct: 115 GD-YYELVKKLVEEKLYGEYLLQNYSKEEIKELEKYIKPERDFLFNYEGLKLLADRYLVK 173

Query: 309 -INGSRIEMPQAFFMRVAMGLALKETEKEKR---AVEFYNLLSSFHFMCSTPTLFNSGTR 364
             N   +E+PQ  FM +AM LA+ E  KEKR   A +FY+LLS      +TPTL N+GT 
Sbjct: 174 GFNREILELPQERFMGIAMHLAIPE-GKEKRVYYAKKFYDLLSELKATVATPTLSNAGTP 232

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
             QLSSCF++ V D+L+ I+   Q+ A ++K+ G LG     +R L + I G    S GV
Sbjct: 233 FYQLSSCFISVVDDNLWSIYDVNQKFAQVSKHGGALGIYTGKIRALNSEIRGFKNASGGV 292

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           IP++K+ NDTA+AV+Q GKRKG     L+ WH D+ EFLDL+ N GDDRR+ HD+     
Sbjct: 293 IPWIKLYNDTAIAVDQLGKRKGGAAITLDIWHKDIPEFLDLKTNNGDDRRKAHDIFPGVS 352

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSD-----LHDLYGKEFEIAYEN--YERQADRGEIKVF 537
            PDLFMKR+ +   W+LF P E+       L D Y +E    +     E + D    +  
Sbjct: 353 YPDLFMKRLEKRENWSLFDPHEIKKVKGYSLEDYYDEEDRKEFTKKYLECEEDTNIPR-- 410

Query: 538 RKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEET 597
           R +  + + +K++    ETG P+I F+D  N  +P +H G+++SSNLC EI  N S  E 
Sbjct: 411 RTVPVLDIMKKIMKSAVETGTPFIFFRDTVNKANPNKHKGMIYSSNLCHEIAQNMSESEL 470

Query: 598 A-----------------------VCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDN 634
                                    CNL SI L         D ++L   I T +R+LDN
Sbjct: 471 LEEEIIDENGYYEVVQKIKAGDMVTCNLNSIVL------GNVDDEELEEVIPTQIRMLDN 524

Query: 635 VIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHA 694
           VI +N + + +A+ ++  +RAIGLG  G+   L    I + S E ++ AD+  E I+++A
Sbjct: 525 VISLNYYPVPEAEITSDKYRAIGLGTSGYHHMLANNKIRWESDEHIKFADKIYEEIAYYA 584

Query: 695 ISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVK 754
           I AS+ELA+E+G+Y +FKGS W+ G +         E R        S   W +LK+ +K
Sbjct: 585 IKASMELAKEKGSYPAFKGSEWETGKY--------FERRG-----YNSE-RWKKLKEEIK 630

Query: 755 TIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRD 814
             GMRN    A+APT + +NI   +  IDP                V   F + E K   
Sbjct: 631 KYGMRNGYITAVAPTGSTSNIANTTAGIDP----------------VFKRFFMEEKK--- 671

Query: 815 LWDEAMISDLKYHDGSIGNIERIPDDLKK----IHATAFEIDPMWLIESASRRQKWIDQA 870
                         GS     +   DL +     +  A  ID  W I++   RQ+ IDQA
Sbjct: 672 --------------GSF--TPKTAPDLNEENFWYYKEAHTIDQQWSIKACGVRQRHIDQA 715

Query: 871 QSLNLYLD-EPSGKKLDFIYRQAWLMGLKTTYYLRSRS 907
           QS NLY+  E   K++  +Y +AW  G+KT YY+R++S
Sbjct: 716 QSFNLYITPEYKAKQILNLYIEAWKQGVKTIYYVRNKS 753


>gnl|CDD|181700 PRK09209, PRK09209, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 761

 Score =  446 bits (1149), Expect = e-125
 Identities = 257/808 (31%), Positives = 384/808 (47%), Gaps = 102/808 (12%)

Query: 142 APKLKIMMDDGTLISFNSKRLEMIVEEACSG-----LQDVSSKIVLSETYKNMYDGLSES 196
                +       + F+ +RL+  +++  +      ++D   ++      K   + ++  
Sbjct: 7   VTTWIVKEAGNRKLPFDKERLDRYIDQIHAEFPQLDVEDYKRRVFNFVERK---ESVTAD 63

Query: 197 DLETALIFSSRTLI-EKEPNYAKVTARFLLEKLRREVLTT-VYKKPQKATHHEMQCLYPE 254
           DL   LI  +   +  +EP +    AR  L +L +       Y   +K         +  
Sbjct: 64  DLVDYLIREAEARVDLEEPEWTFFAARLYLNRLYKRASRNRFYDASEKYGS------FVG 117

Query: 255 YFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRI 314
                 E G+ +  L +     +L+     +  ERD  F Y+GL +L DRY    +   +
Sbjct: 118 LQESLAERGIYSNDLLKRYSKEELIEAGKMIDPERDKLFTYIGLYLLADRYLATDSDRNV 177

Query: 315 -EMPQAFFMRVAMGLALKETEKEKR---AVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSS 370
            E+PQ  ++ +A+ L   E  +E+R     E Y  LS+ +   +TPTL N+G    QLSS
Sbjct: 178 YELPQERWLTIALYLMQNEP-RERRMQLVKEAYWALSNLYMTVATPTLANAGKVGGQLSS 236

Query: 371 CFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKV 430
           CF+ TV D L GI+ +  + A ++K+ GG+G     VR  G+ I G  G S GVIP++K 
Sbjct: 237 CFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGKVRSRGSDIRGFKGVSSGVIPWIKQ 296

Query: 431 ANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFM 490
            N+TAV+V+Q G+RKGA+  YL+ WH D+E FLDLR N GD+R R HD+ T   IPDLFM
Sbjct: 297 LNNTAVSVDQLGQRKGAIAVYLDVWHKDIESFLDLRLNNGDERLRAHDVFTGVCIPDLFM 356

Query: 491 KRVTQNAGWTLFSPDEVSD-----LHDLYGKEFEIAY--ENYERQADRGEIKVFRKISAV 543
           + V +   W LF P EV       L D Y ++       E YE       +   + + A+
Sbjct: 357 EAVERRGDWYLFDPHEVKKVMGWYLEDFYDEKKGDGSFREKYEECVADERLSR-KTVKAI 415

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSS----SEET-- 597
            + ++++    ETG+P++ ++D  N  +P +H G+++SSNLCTEI  N S     +E   
Sbjct: 416 DIMKRIMVSQLETGNPFMFYRDEVNRMNPNKHEGMIYSSNLCTEIMQNMSPTVMIQEIIS 475

Query: 598 -------------AVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIE 644
                         VCNL SINL           D L   I   VR+LDNVID+N   + 
Sbjct: 476 GGQIVITKQPGDFVVCNLSSINL-----GRAVTADVLERLIPIQVRMLDNVIDLNQLPVP 530

Query: 645 KAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQE 704
           +A  +N  +RAIGLG  G+   L L  I + S EAV+ ADE  E I++  I AS+ELA+E
Sbjct: 531 QATITNQKYRAIGLGTFGWHHLLALKGIAWESEEAVQYADELYERINYLTIQASMELAKE 590

Query: 705 RGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCM 764
           +GAY  FKGS W  G +         E R        +   WDEL  +V   G+RN+  M
Sbjct: 591 KGAYPVFKGSDWQTGEY--------FERRG------YNSPQWDELAAQVAENGVRNAYLM 636

Query: 765 AIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDL 824
           A+AP  + A I G + SIDP Y   Y +        V       +L              
Sbjct: 637 AVAPNMSTAQIAGSTASIDPIYSAFYYEEKKDYRRPVT----APDLSLDTWP-------- 684

Query: 825 KYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSG-- 882
            Y++                   A+++D  W I   + RQ+ +DQ+ S N Y+  PS   
Sbjct: 685 -YYEKG-----------------AYKVDQFWSIRQNAARQRHVDQSISFNFYV--PSTIR 724

Query: 883 -KKLDFIYRQAWLMGLKTTYYLRSRSAT 909
             +L  ++  AW  GLKTTYY+RS    
Sbjct: 725 ASELLDLHMTAWKEGLKTTYYVRSTDID 752


>gnl|CDD|181648 PRK09102, PRK09102, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 601

 Score =  411 bits (1058), Expect = e-115
 Identities = 229/687 (33%), Positives = 325/687 (47%), Gaps = 119/687 (17%)

Query: 287 YERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLL 346
             RD      G   L DRY L   G   E  Q  F R+A   A  + E  +R   FY+ +
Sbjct: 15  RSRDAWLTEFGKATLRDRYLL--EG---ESYQDLFARIAEAYADIDPEHAQR---FYDYM 66

Query: 347 SSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTP 406
           S   FM +TP L N GT      SCFL  V D L GI     EN  LAK  GG+G+ W  
Sbjct: 67  SRGWFMPATPVLSNGGTDRGLPISCFLNYVEDSLEGIVNTWNENVWLAKRGGGIGSYWGN 126

Query: 407 VRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLR 466
           VR +G  I   NGKS G+IPF+KV +   +A++QG  R+G+   YL+  H ++EEFLD+R
Sbjct: 127 VRSIGEPIRN-NGKSSGIIPFIKVMDSLTLAISQGSLRRGSFAVYLDIEHPEIEEFLDIR 185

Query: 467 KNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYE 526
           K TGD  R+  +++    + D FM+ V     W L SP + S                  
Sbjct: 186 KPTGDPNRKALNLHHGVCVTDEFMEAVEDGDEWDLISPKDKS------------------ 227

Query: 527 RQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQH--VGV-VHSSN 583
                    V R + A  LW K+L    ETG P++ F D  N   P+ +  +G+ V +SN
Sbjct: 228 ---------VIRTVKARDLWAKILETRIETGEPYLLFIDNVNRALPEVYKDLGLKVKASN 278

Query: 584 LCTEITLNS-----SSEETAVCNLGSINLLAHFANNQFDYDKLAST---IRTAVRVLDNV 635
           LC+EITL +       + TAVC L S+NL          YD+   T   I   +R LDNV
Sbjct: 279 LCSEITLPTGIDHLGEDRTAVCCLSSLNLEY--------YDEWKDTDAFIEDLMRFLDNV 330

Query: 636 ----IDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFIS 691
               ID     +E+AK S    R++GLG+MGF S L    IP+ S  A +   +  + I 
Sbjct: 331 LQDFIDKAPDEMERAKYSAMRERSVGLGVMGFHSYLQSKMIPFESVMAKQWNKKIFKHIR 390

Query: 692 FHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKK 751
             A  AS ELA+E+G                 D+ G          + R           
Sbjct: 391 EQADKASKELAKEKGE--------------CPDAAG--------YGVMR----------- 417

Query: 752 RVKTIGMRNSNCMAIAPTATIANICG-VSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNEL 810
                  R S  MAIAPTA+I+ I G  S  I+P   N Y    + G FTV N +L   L
Sbjct: 418 -------RFSTKMAIAPTASISIILGNTSPGIEPIAANYYTHKTLKGSFTVKNKYLEKLL 470

Query: 811 KQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQA 870
           +++    + + S +  ++GS+ +++ + ++ K +  TAFEID  W+IE A+ RQK+IDQA
Sbjct: 471 EEKGKDTDEVWSSILTNEGSVQHLDFLSEEEKDVFKTAFEIDQRWIIELAADRQKYIDQA 530

Query: 871 QSLNLYLDEPSG---KKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           QSLNL+L  P+    + L+ ++ +AW  G+K+ YY RS+S    +K +   +  +L    
Sbjct: 531 QSLNLFL--PANVPKRDLNKLHFEAWKKGVKSLYYQRSKSVQRADKVSHDVLKKRLVEKS 588

Query: 928 VTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             + +                EC  CQ
Sbjct: 589 AFNRDYD--------------ECLACQ 601


>gnl|CDD|162892 TIGR02504, NrdJ_Z, ribonucleoside-diphosphate reductase,
           adenosylcobalamin-dependent.  This model identifies
           genes in a wide range of deeply branching bacteria. All
           are structurally related to the class I (non-heme iron
           dependent) RNRs. In most species this gene is known as
           NrdJ, while in mycobacteria it is called NrdZ.
          Length = 586

 Score =  383 bits (985), Expect = e-106
 Identities = 200/628 (31%), Positives = 304/628 (48%), Gaps = 66/628 (10%)

Query: 300 ILYDRYFLHI-NGSRIEMPQAFFMRVAMGLALKE-----TEKEKRAVEFYNLLSSFHFMC 353
           +L  RY L   +G  IE P+  F RVA  LA  E        ++    FY+L+ +  FM 
Sbjct: 1   VLAARYLLKDEDGGIIESPEDLFRRVARALAAAEDKYNSPVWKQWYERFYDLMVNLGFMP 60

Query: 354 STPTLFN-SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGA 412
           ++PTL N  GTR  QLS+CF+  V DD+  IF A +E A++ K  GG+G +++ +R  GA
Sbjct: 61  NSPTLMNAGGTRLGQLSACFVLPVEDDMESIFEAAKEAALIFKRGGGVGYNFSTLRPKGA 120

Query: 413 HIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDD 472
            + GT G + G + F++V +  A  + QGG R+GA    L+ WH D+EEF++ +K  G  
Sbjct: 121 KVSGTGGVASGPVSFMRVFDAAAGVIKQGGTRRGAQMGILDVWHPDIEEFIEAKKKEGK- 179

Query: 473 RRRTHDMNTANW---IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQA 529
                 +   N    + D FM+ V  +  + L +P                  E  E   
Sbjct: 180 ------LTNFNISVGVTDAFMEAVEADEEYKLRNPRT--------------GEEIEELAE 219

Query: 530 DRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEIT 589
              + KV++++ A  LW K++   +++  P + F D  N   P  + G ++++N C E  
Sbjct: 220 LDPKNKVYKEVPARELWDKIVEAAWKSAEPGLLFIDTINKWHPCPYGGRINATNPCGEQP 279

Query: 590 LNSSSEETAVCNLGSINLLAHFANNQ---FDYDKLASTIRTAVRVLDNVIDINCHTIEKA 646
           L         CNLGSINL A F  N    FD+++L   +R A R LDNVID+N   + + 
Sbjct: 280 L----LPYESCNLGSINL-AKFVKNGFGSFDFERLREVVRLATRFLDNVIDLNRFPLPEI 334

Query: 647 KKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERG 706
            ++    R IGLG+MG    L  L IPY S EA   A+E M FI+  A  AS ELA+ERG
Sbjct: 335 AEATKKTRRIGLGIMGLADLLIKLGIPYDSEEARAFAEELMAFIADAAYRASAELAKERG 394

Query: 707 AYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAI 766
            +  F+ S ++ G      I               S LP  EL++ +   G+RN+    I
Sbjct: 395 PFPLFEASRYEMGRAMGARIP--------------SALPA-ELREAIAKYGIRNAQLTTI 439

Query: 767 APTATIANICGVSQSIDPSYQNLYVKSNMSGD-FTVVNSFLVNELKQRDLWDEAMISDLK 825
           APT TI+ I G S  I+P +  +Y ++   G     VN  +   L++   + + ++  + 
Sbjct: 440 APTGTISLIAGTSSGIEPVFALVYFRNVTVGGELLEVNPIVELALRELGYYSDQIVKYVD 499

Query: 826 YHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQS--LNLYLDEPSGK 883
                 G     P++L K+  TA ++ P   +   +  Q W+D + S  +N+  D     
Sbjct: 500 EKGTVEGAPG--PEELPKVFVTANDVSPEDHVLMQAAIQPWVDSSISKTINMPSDAT--- 554

Query: 884 KLDF--IYRQAWLMGLK--TTYYLRSRS 907
             D    Y  AW +GLK  T Y   SRS
Sbjct: 555 VEDVKAAYLLAWKLGLKGITVYRDGSRS 582


>gnl|CDD|181531 PRK08665, PRK08665, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 752

 Score =  314 bits (806), Expect = 9e-86
 Identities = 188/621 (30%), Positives = 294/621 (47%), Gaps = 106/621 (17%)

Query: 310 NGSRIEMPQAFFMRVAMGLALKET------EKEKRAVEFYNLLSSFHFMCSTPTLFNSGT 363
           +G  IE P+  F RVA  +A  E       + E  A  FY+L++S  F+ ++PTL N+G 
Sbjct: 30  DGKPIETPEDMFRRVARTIAAAELIYDSKADVEALADRFYDLMTSLEFLPNSPTLMNAGR 89

Query: 364 RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG 423
              QLS+CF+  V D +  IF A++  A++ K  GG G  ++ +R     +  T G + G
Sbjct: 90  ELGQLSACFVLPVGDSIEEIFDAVKHAALIHKSGGGTGFSFSRLRPKNDRVGSTGGVASG 149

Query: 424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTAN 483
            + F++V +    A+ QGG R+GA    L   H D+ EF+  +++ G+       +   N
Sbjct: 150 PVSFMRVFDAATEAIKQGGTRRGANMGILRVDHPDIMEFITCKEDNGE-------LTNFN 202

Query: 484 W---IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
               I + FM+ V  +  + L +P                           GE  V  ++
Sbjct: 203 ISVAITEAFMEAVEADEEYDLINP------RT-------------------GE--VVGRL 235

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
           +A  ++  ++ M +E G P I F D  N  +P  H+G + S+N C E  L         C
Sbjct: 236 NAREVFDLIVEMAWENGEPGIVFIDRINRDNPTPHLGEIESTNPCGEQPLLPYE----SC 291

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGSINL     N   D++KL   +  AVR LDNVID N + + + ++    +R IGLG+
Sbjct: 292 NLGSINLSKMVKNGDVDWEKLREVVHLAVRFLDNVIDANKYPLPQIEEMTKGNRKIGLGV 351

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MG+   L  L IPY S EAVE+A++ M+FI   A +AS ELA+ERG + +++GS++D+  
Sbjct: 352 MGWADMLIQLGIPYDSEEAVELAEKVMKFIQDEAHAASRELAEERGPFPNYEGSIYDK-- 409

Query: 721 FPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
                                     D L        MRN+    IAPT TI+ I G S 
Sbjct: 410 --------------------------DGLGP------MRNATVTTIAPTGTISIIAGCSS 437

Query: 781 SIDPSYQNLYVKSNMSGDFTV-VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
            I+P +   + ++ M G+  V VN       K+   + E ++  +    GSI +I+ +P+
Sbjct: 438 GIEPLFALSFTRNVMDGERLVEVNPVFEAAAKEEGFYSEELMEKIAEK-GSIQDIDEVPE 496

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDF-----------I 888
           D++++  TA +I P W +   +  QK  D A S          K ++F           +
Sbjct: 497 DVRRVFVTAHDISPEWHVRMQAAFQKHTDNAVS----------KTVNFPNEATIEDVREV 546

Query: 889 YRQAWLMGLK--TTYYLRSRS 907
           YR A+ +G K  T Y   SR 
Sbjct: 547 YRLAYELGCKGVTIYRDGSRD 567


>gnl|CDD|177401 PHA02572, nrdA, ribonucleoside-diphosphate reductase subunit alpha;
           Provisional.
          Length = 753

 Score =  312 bits (801), Expect = 3e-85
 Identities = 225/799 (28%), Positives = 349/799 (43%), Gaps = 99/799 (12%)

Query: 151 DGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLI 210
            G    F+ +++  ++E AC G   V    +   +   + DG++  D++  LI S+  LI
Sbjct: 10  SGVSQPFDLEKIHKVLEWACEGTG-VDPSELEENSKIQLRDGMTTKDIQEILIKSAADLI 68

Query: 211 E-KEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
             +EP+Y  V AR L+  LR++V    Y +       E      ++  + + EG     +
Sbjct: 69  SVEEPDYQYVAARLLMFALRKQV----YGQ------FEPPSFI-DHISKCVNEGKYDPEI 117

Query: 270 HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLH--INGSRIEMPQAFFMRVAMG 327
                  ++ YL + + ++RDF F Y G   L ++Y +     G   E PQ  +M +AM 
Sbjct: 118 LSKYSAEEITYLESFIDHDRDFEFTYAGAMQLKEKYLVQDRSTGEIYETPQFAYMLIAMA 177

Query: 328 LALKETEKEKR---AVEFYNLLSSFHFMCSTPTLFNSGTRHP--QLSSCFLTTVPDDLYG 382
           L   E  KE R    + FYN +S+     S PT   +G R P  Q SSC +    D L  
Sbjct: 178 LHQDEP-KEDRLEHVIRFYNAVSTRKI--SLPTPIMAGVRTPTRQFSSCVVIESGDSLDS 234

Query: 383 IFGALQENAMLAKY---SGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVN 439
           I         + KY     G+G +   +R  G+ I G   +  GVIPF K       + +
Sbjct: 235 INKT---AMAIVKYISKRAGIGINAGMIRAEGSKIRGGEVRHTGVIPFWKHFQTAVKSCS 291

Query: 440 QGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGW 499
           QGG R GA  AY   WH++VE+ L L+ N G +  R   ++    I DL  +R  +N   
Sbjct: 292 QGGIRGGAATAYYPIWHLEVEDLLVLKNNKGVEENRIRHLDYGVQINDLMYERFIKNDYI 351

Query: 500 TLFSPDEVSD-LHDLYGK---EFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFE 555
           TLFSP +V   L+D Y      F   YE  E+     +    ++I A  L+  +L    E
Sbjct: 352 TLFSPHDVGGELYDAYFADQDRFRELYEALEKDPSVRK----KRIKAQELFLLLLKERSE 407

Query: 556 TGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSS-------SEETAVCNLGSINLL 608
           TG  +I F D CN  SP      +  SNLC EI L +          E A+C L +I L 
Sbjct: 408 TGRIYIMFIDHCNNHSP--FKDPIRQSNLCCEIALPTKPLNHIDGEGEIALCTLSAIVL- 464

Query: 609 AHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALH 668
                N  D D++      AVR LDN++D   + +  A K+    R++G+G+  +   L 
Sbjct: 465 ----GNFEDQDEIEELAEVAVRALDNLLDYQDYPVPAALKAKK-RRSLGVGVTNYAHYLA 519

Query: 669 LLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGL 728
                Y    A ++  E  E + ++ I AS +LA+E+GA   F  + + +G  PID    
Sbjct: 520 KNFASYEDANA-DLVHELFERLQYYLIKASNKLAKEKGACEYFSDTKYSRGELPID---W 575

Query: 729 LAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQN 788
             +  DEL   + +   W+ L++ +K  G+RNS   A+ P  + + +   +  I+P    
Sbjct: 576 YKKKVDELVAPKYN-CDWESLREDLKKYGIRNSTLSALMPCESSSQVSNSTNGIEPPRGP 634

Query: 789 LYVKSNMSGDFT-VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHAT 847
           + +K +  G F  VV +  V  LK  DL+      DL +     GN              
Sbjct: 635 VSIKKSKEGPFNQVVPN--VETLK--DLY------DLLWDLAKKGNKG------------ 672

Query: 848 AFEIDPMWLIESASRRQKWIDQAQSLNLYLDE---PSGK------KLDFIYRQAWLMGLK 898
                    +   +  QK++DQA S N   D    P+GK        D +Y   +  G K
Sbjct: 673 --------YLTQVAIMQKFVDQAISANTSYDPENYPNGKVPMSVMLDDLLY--FYYYGGK 722

Query: 899 TTYYLRSRSATSVEKSTLK 917
           T YY  +R     E   ++
Sbjct: 723 TLYYHNTRDGKGTEDYEIE 741


>gnl|CDD|180555 PRK06406, PRK06406, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 771

 Score =  287 bits (736), Expect = 1e-77
 Identities = 182/592 (30%), Positives = 291/592 (49%), Gaps = 78/592 (13%)

Query: 321 FMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDL 380
           F+     L  K    E+   +F  ++S+  F+ ++PTL N+GT+  QLS+CF+  VPD +
Sbjct: 205 FLDF---LKTKWDSIEEYINKFEEVMSNLKFVPNSPTLMNAGTKLGQLSACFVLPVPDSI 261

Query: 381 YGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQ 440
            GIF AL+  AM+ K  GG G  ++ +R     +  T G + G + F+++ + T   + Q
Sbjct: 262 EGIFNALKYTAMIHKSGGGTGFSFSRLRPKDDIVASTKGVASGPLSFMRIFDVTTDVIKQ 321

Query: 441 GGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
           GGKR+GA    L   H D+ EF+   K++  + +   + N +  + D F  ++  +  + 
Sbjct: 322 GGKRRGANMGILSYHHPDIMEFI-TSKDS--ENKVLSNFNISVAVTDEFFDKLDNDDYYP 378

Query: 501 LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
           L +P                      R       K  ++I A  +W  ++T  ++TG P 
Sbjct: 379 LRNP----------------------RNG-----KEVKRIKARQVWDLIITQAWKTGDPG 411

Query: 561 ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDK 620
           + F D  N ++P +++G + S+N C E  L         CNLGSINL     N + D+D+
Sbjct: 412 VIFLDEINRKNPVKNLGEIESTNPCGEQPLLPYES----CNLGSINLSKFVENGKIDWDR 467

Query: 621 LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
           L  T+  A R LDNVID N   + + K+     R IGLG+MGF   L  L IPY S EA+
Sbjct: 468 LRETVHIATRFLDNVIDANKFPVPQIKEMTRMTRKIGLGVMGFADMLIKLGIPYNSEEAL 527

Query: 681 EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNR 740
           EIA++ M+FI+  +  AS +LA+ERG + ++ GS W++                      
Sbjct: 528 EIAEKVMKFINEESHRASQKLAEERGVFPAWYGSEWEK---------------------- 565

Query: 741 TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG-DF 799
                        K I MRNS    IAPT TI+ I G S SI+P +   +V+  ++G + 
Sbjct: 566 -------------KGIKMRNSTTTTIAPTGTISIIAGCSSSIEPLFAIAFVRHVLNGQEL 612

Query: 800 TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
             VN       ++R L+ E ++  +    G++ NI+ +P+D+K+I  TA EIDP W +  
Sbjct: 613 LEVNPLFEEITRKRGLYSEELMRKVA-ETGNLQNID-VPEDIKRIFVTAHEIDPQWHVLM 670

Query: 860 ASRRQKWIDQAQS--LNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSAT 909
            +  Q++ D   S  +NL  D  + + +   YR A  +  K     R +S T
Sbjct: 671 QATFQRYCDSGVSKTINLRYD-ATPEDIAKAYRLAKDLHCKGITVYRDKSKT 721



 Score = 62.6 bits (152), Expect = 4e-10
 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 16/108 (14%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VIKR+G V  FD  KI+ AI KA ++V+      +  + D +       V RL    K 
Sbjct: 6   EVIKRDGTVVPFDKKKIAMAIYKAMLSVKNGSMEDAEELTDKV-------VERL----KK 54

Query: 90  ALIVHIEDIQDQVECSLMQSGHH-----KITREYVLYREERSDVRAAQ 132
                +E IQD VE  LM    +      + + Y+LYRE+R  +R  +
Sbjct: 55  YERPTVEQIQDIVEKVLMTKKINGKDFTDVAKSYILYREKRRKIREEK 102


>gnl|CDD|181649 PRK09103, PRK09103, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 758

 Score =  232 bits (594), Expect = 3e-61
 Identities = 233/804 (28%), Positives = 355/804 (44%), Gaps = 115/804 (14%)

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIF 204
           L +   DG     N  ++  ++  A  GL +VS   V   ++   YDG+  SD+   +I 
Sbjct: 2   LLVTKRDGRTERINLDKIHRVITWAAEGLHNVSVSQVELRSHIQFYDGIKTSDIHETIIK 61

Query: 205 SSRTLIEKE-PNYAKVTARFLLEKLRREVLTTVYKKPQKA-THHEMQCLYPEYFCRYIEE 262
           ++  LI ++ P+Y  + AR  +  LR+           KA    E   LY ++  + +E 
Sbjct: 62  AAADLISRDAPDYQYLAARLAIFHLRK-----------KAYGQFEPPALY-DHVVKMVEM 109

Query: 263 GVKARLLHE--SMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLH--INGSRIEMPQ 318
           G   + L E  +  +FD   +   + + RD  F Y  ++ L  +Y +   + G   E  Q
Sbjct: 110 GKYDKHLLEDYTEEEFDQ--MDTFIDHWRDMNFSYAAVKQLEGKYLVQNRVTGEIYESAQ 167

Query: 319 AFFMRVAMGLALKETEKEKR---AVEFYNLLSSFHFMCSTPTLFNSGTRHP--QLSSCFL 373
             ++ VA  L      KE R      FY+ +S+F    S PT   SG R P  Q SSC L
Sbjct: 168 FLYILVAACL-FSNYPKETRLDYVKRFYDAVSTFKI--SLPTPIMSGVRTPTRQFSSCVL 224

Query: 374 TTVPDDLYGIFGALQENAM---LAKY---SGGLGNDWTPVRGLGAHIHGTNGKSQGVIPF 427
               D L  I      NA    + KY     G+G +   +R LG+ I G      G IPF
Sbjct: 225 IECGDSLDSI------NATSSAIVKYVSQRAGIGINAGRIRALGSPIRGGEAFHTGCIPF 278

Query: 428 LKVANDTAV-AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIP 486
            K    TAV + +QGG R GA   +   WH++VE  L L+ N G +  R   M+    I 
Sbjct: 279 YKHFQ-TAVKSCSQGGVRGGAATLFYPIWHLEVESLLVLKNNRGVEENRVRHMDYGVQIN 337

Query: 487 DLFMKRVTQNAGWTLFSPDEVSDLHDLY---GKEFEIAYENYERQADRGEIKVFRKISAV 543
            L  +R+ +    TLFSP +V  L+D +     EFE  Y  YE   D    K  +++ AV
Sbjct: 338 KLMYQRLIKGGDITLFSPSDVPGLYDAFFADQDEFERLYTKYE--QDDSIRK--KRVKAV 393

Query: 544 ALWRKMLTMLFETGHPWITFKDPCNIRSP-QQHVGVVHSSNLCTEITL--------NSSS 594
            L+  M+     TG  +I   D CN  SP    V  V  SNLC EI L        N  +
Sbjct: 394 ELFSLMMQERASTGRIYIQNVDHCNTHSPFDPKVAPVRQSNLCLEIALPTKPLNDVNDEN 453

Query: 595 EETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHR 654
            E A+C L + NL A   N+  + ++LA     AVR LD ++D   + I  AK+     R
Sbjct: 454 GEIALCTLSAFNLGA--INSLDELEELADL---AVRALDALLDYQDYPIPAAKRGAMGRR 508

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGS 714
            +G+G++ F   L    + Y+   A  +  ++ E I ++ + AS ELA+E+GA   F  +
Sbjct: 509 TLGIGVINFAYYLAKNGVRYSDGSANNLTHKTFEAIQYYLLKASNELAKEQGACPWFNET 568

Query: 715 LWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
            + QG+ PID+     +  D +  N      W+ L++ +KT G+RNS   A+ P+ T + 
Sbjct: 569 TYAQGILPIDT---YKKDLDAIC-NEPLHYDWETLREEIKTHGLRNSTLSALMPSETSSQ 624

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDF-TVVNSFLVNELKQRD--LWDEAMISDLKYHDGSI 831
           I   +  I+P    + +K++  G    VV  +    LK     LW+              
Sbjct: 625 ISNATNGIEPPRGYVSIKASKDGILKQVVPDY--ERLKDAYELLWE-------------- 668

Query: 832 GNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDE---PSGK---KL 885
                +P++   +         M         QK++DQ+ S N   D    PSGK   K 
Sbjct: 669 -----MPNNDGYLQLVGI----M---------QKFVDQSISANTNYDPSRFPSGKVPMKQ 710

Query: 886 ---DFIYRQAWLMGLKTTYYLRSR 906
              D +   A+  G+KT YY  +R
Sbjct: 711 LLKDLLT--AYKFGVKTLYYHNTR 732


>gnl|CDD|162895 TIGR02510, NrdE-prime, ribonucleoside-diphosphate reductase, alpha
           chain.  This model represents a small clade of
           ribonucleoside-diphosphate reductase, alpha chains which
           are sufficiently divergent from the usual Class I RNR
           alpha chains (NrdE or NrdA, TIGR02506) as to warrant
           their own model. The genes from Thermus thermophilus,
           Dichelobacter and Salinibacter are adjacent to the usual
           RNR beta chain.
          Length = 571

 Score =  228 bits (582), Expect = 6e-60
 Identities = 179/607 (29%), Positives = 248/607 (40%), Gaps = 114/607 (18%)

Query: 321 FMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDL 380
           F  +A   A     +E+   +F++LL+      +TP   N+G       SC  + V DD 
Sbjct: 41  FKEIAQRAA-AHDIREEAEEKFFDLLARGKLALATPIFANTGLDRGLPISCAGSYVEDDT 99

Query: 381 YGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVN- 439
                A  E AMLAK   G       +R  GA I   NG+  G   F  + ++     N 
Sbjct: 100 ADFLEAQAEVAMLAKNGFGTALYLGDIRPRGADIR-DNGEHNGADAFAPLFDNFIETFNK 158

Query: 440 -QGGKRKGAVCAYLETWHIDVEEFLDL-RKNTGDDRRRTHDMNTANWIPDLFMKRVTQNA 497
                R+G   AYL+  H D EE L +  ++                         + + 
Sbjct: 159 VAAAGRRGECAAYLDFEHGDFEELLGIQLEHPA-----------------------SAHL 195

Query: 498 GWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETG 557
            W                  FE      E        K+ R       W ++L M  ETG
Sbjct: 196 FWG-----------------FEKEDRWLEELIAGDGEKMAR-------WAELLKMRAETG 231

Query: 558 HPWITFKDPCNIRSPQ--QHVGV-VHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN 614
             ++ F D  N ++P+  + +G+ + +SNLCTEI L S  EE+  C L S+NLL      
Sbjct: 232 IGYLFFNDIANEKAPEAFKALGIPIRASNLCTEIALPSDDEESFTCCLSSLNLL------ 285

Query: 615 QFDYDKLASTIRTAVRVLDNVID--------INCHTIEKAKKSNHTHRAIGLGLMGFQSA 666
            +D  K A  I T V  LD+V D        I   T+EKA +     RAIGLG +GF S 
Sbjct: 286 HWDEIKDADAIETLVIFLDSVCDDFIAKAEEIPYDTLEKAIRFAEKARAIGLGTLGFHSY 345

Query: 667 LHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSI 726
           L +  I + S  A  +  E    I   A  AS ELA+E G                    
Sbjct: 346 LQMNDIAFESGAAFILNAEIFAEIKEAAEEASRELAEEHG-------------------- 385

Query: 727 GLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICG-VSQSIDPS 785
                  DELA          E K       MRN+  +AIAP  + A I G VS  I+P 
Sbjct: 386 ------EDELA-------EVCEGK------EMRNATLIAIAPNKSSAFIAGGVSPGIEPL 426

Query: 786 YQNLYVKSNMSGDFTVVNSFLVNELKQR---DLWDEAMISDLKYHDGSIGNIERIPDDLK 842
             N ++K   + DF   N FL   LK +      +E M      H+GS+ +++ + D+ K
Sbjct: 427 TCNSFIKDLNAADFPFKNPFLAEVLKDKGKDKEIEEKMEDIALEHNGSVQHLDFLTDEEK 486

Query: 843 KIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYL--DEPSGKKLDFIYRQAWLMGLKTT 900
            +  TA EID   +I  A+ RQK IDQAQS+NL+   DE   +  +     A   GLK  
Sbjct: 487 AVFKTAAEIDQHAIINLAAARQKHIDQAQSINLFFHADEAEPRDANAHRAFADDPGLKAL 546

Query: 901 YYLRSRS 907
           YYL S  
Sbjct: 547 YYLFSER 553


>gnl|CDD|180867 PRK07187, PRK07187, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 721

 Score =  222 bits (567), Expect = 4e-58
 Identities = 188/672 (27%), Positives = 308/672 (45%), Gaps = 91/672 (13%)

Query: 276 FDLVYLANDLKYERDFAF-EYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG---LALK 331
           FD +       Y+ +  F  ++G    Y+ Y L     + +  + F  R  M    LA  
Sbjct: 74  FDQIEELFHYAYQYNHRFLSFMGAMKFYNSYALKTFDGK-QYLETFEDRAVMNALFLADG 132

Query: 332 ETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHP-QLSSCFLTTVPDDLYGIFGALQEN 390
           +  K    ++   +L    F  +TPT  N+G +   +  SC+L  V D++  I  A+  +
Sbjct: 133 DFTKAFDLLD--QILLG-RFQPATPTFLNAGKKRRGEYISCYLLRVEDNMESISRAISTS 189

Query: 391 AMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCA 450
             L+K  GG+    T +R +GA I G   ++ G+IP +K+  D+    NQ G+R+GA   
Sbjct: 190 LQLSKRGGGVALCLTNLREIGAPIKGIENQATGIIPVMKLLEDSFSYANQLGQRQGAGAV 249

Query: 451 YLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDL 510
           YL   H DV  FLD ++   D++ R   ++    IPD+  +   +N    LFSP    D+
Sbjct: 250 YLHAHHPDVLTFLDTKRENADEKIRIKSLSLGLVIPDITFELAKENKDMALFSP---YDI 306

Query: 511 HDLYGKEF---EIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
              YGK      I  E Y   A+    K +  ISA  L++ +  + FE+G+P++ F D  
Sbjct: 307 KREYGKPMSDISITEEYYNLLANPAIKKTY--ISARKLFQTIAELHFESGYPYLLFDDTV 364

Query: 568 NIRSPQQHVGVVHSSNLCTEIT-LNSSSE-----------ETAVCNLGSINLLAHFANNQ 615
           N R+P    G +  SNLC+EI  +++ S            E   CNLGS+N+    A   
Sbjct: 365 NKRNPHAKKGRIVMSNLCSEIAQVSTPSTFNEDLSFKKIGEDICCNLGSLNI----AKAM 420

Query: 616 FDYDKLASTIRTAVRVLDNV---IDINCH-TIEKAKKSNHTHRAIGLGLMGFQSALHLLH 671
               +    I T++R LD V    D++C  +IEK   +NH   A+GLG M     L   H
Sbjct: 421 ESGPEFEQLIYTSIRALDRVSRVSDLSCAPSIEKGNAANH---AVGLGAMNLHGFLATNH 477

Query: 672 IPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFK------GSLWDQGV----- 720
           I Y S EAV+  D     ++++A  AS +LA+E+GA++ F+      GS +D+       
Sbjct: 478 IYYDSKEAVDFTDLFFYTMAYYAFKASNQLAKEKGAFAGFELSKYADGSYFDKYTKEDAK 537

Query: 721 FPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
                   + E+  +  +   ++  W EL + +K  G+ NS+ +A+APT +I+ +   + 
Sbjct: 538 KWTPKTAKVKELLQKYGVTIPTQADWQELVEDIKKTGLANSHLLAVAPTGSISYLSSCTP 597

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI----ER 836
           S+ P                VV    V +                  +G +G I     +
Sbjct: 598 SLQP----------------VVAPVEVRK------------------EGKLGRIYVPAYK 623

Query: 837 IPDDLKKIHAT-AFEIDPMWLIESASRRQKWIDQAQSLNLYL-DEPSGKKLDFIYRQAWL 894
           I  D    +   A+E+ P  +I+  +  QK +DQA SL L++ D+ + + L+  Y QA+ 
Sbjct: 624 IDQDNYAYYERGAYEVGPKPIIDIVAAAQKHVDQAISLTLFMTDQATTRDLNKAYIQAFK 683

Query: 895 MGLKTTYYLRSR 906
               + YY+R R
Sbjct: 684 QKCASIYYVRVR 695


>gnl|CDD|181062 PRK07632, PRK07632, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 699

 Score =  209 bits (534), Expect = 2e-54
 Identities = 180/703 (25%), Positives = 303/703 (43%), Gaps = 110/703 (15%)

Query: 252 YPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHING 311
           Y   F  Y EE +     +   + F+     +  K+ +D+A +    +   + Y  H+  
Sbjct: 64  YFNVFDIYSEEDLIEVTDYAYSIKFNFASYMSASKFYKDYALKTNDKKQYLEDYEDHVA- 122

Query: 312 SRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSG-TRHPQLSS 370
                       VA+ LA  +  K K   +F + +    +  +TPT  N+G  R  +L S
Sbjct: 123 -----------IVALYLANGDKAKAK---QFISAMVEQRYQPATPTFLNAGRARRGELVS 168

Query: 371 CFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKV 430
           CFL  V D L  I         L+K  GG+  + + +R  G  I G  G ++GV+P  K+
Sbjct: 169 CFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGAAKGVLPVAKL 228

Query: 431 ANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFM 490
                   +Q G+R GA   YL  +H DVEEFLD +K   D+  R   ++T   +P  F 
Sbjct: 229 LEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTISTGLIVPSKFF 288

Query: 491 KRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKML 550
           +   +   + +F+P  V   + +   + ++  E Y+       +K  +K +A    R+ML
Sbjct: 289 ELAKEGKDFYMFAPHTVYKEYGVTLDDIDLE-EMYDDLVANPNVKK-KKKNA----REML 342

Query: 551 TML----FETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEI-------TLNSSSEETAV 599
             +     ++G+P++ FKD  N   P  ++G +  SNLCTEI        +N    E  +
Sbjct: 343 NKIAQTQLQSGYPYLMFKDNANKVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGIEDEI 402

Query: 600 -----CNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDI-NCHTIEKAKKSNHTH 653
                CNLGS+N++     N  +  K   ++ + +  L  V D+ N       +K+N   
Sbjct: 403 KRDISCNLGSLNIV-----NVMESKKFRDSVHSGMDALTVVSDVANIQNAPGVRKANSEL 457

Query: 654 RAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERG-AYSSFK 712
            ++GLG+M     L    I Y S EA + A+     ++F++I  S+E+A+ERG  Y  F+
Sbjct: 458 HSVGLGVMNLHGYLAKNKIGYESEEAKDFANTFFMMMNFYSIERSMEIAKERGETYQDFE 517

Query: 713 GSLWDQGVF-----------PIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNS 761
            S +  G +             + +  L E      M+  ++  W +L++ V+  G+ ++
Sbjct: 518 KSDYANGKYFEKYTTQDFEPKFEKVRELFE-----GMHIPTKEDWKKLQQDVEQYGLYHA 572

Query: 762 NCMAIAPTATIANICGVSQSIDP--------SYQNLYVKSNMSGDFTVVNSFLVNELKQR 813
             +AIAPT +I+ +   + S+ P        +Y N      M              L  +
Sbjct: 573 YRLAIAPTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPF------------LSPQ 620

Query: 814 DLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSL 873
            +W                            + +AF  D M LI+  +  Q  IDQ  S 
Sbjct: 621 TMW---------------------------YYKSAFNTDQMKLIDLIATIQTHIDQGIST 653

Query: 874 NLYL-DEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKST 915
            LY+  E S ++L  +Y  A   GLK+ YY R++   SVE+ T
Sbjct: 654 ILYVNSEISTRELARLYVYAHHKGLKSLYYTRNKL-LSVEECT 695


>gnl|CDD|181278 PRK08188, PRK08188, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 714

 Score =  208 bits (532), Expect = 5e-54
 Identities = 190/630 (30%), Positives = 290/630 (46%), Gaps = 96/630 (15%)

Query: 324 VAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHP-QLSSCFLTTVPDDL-- 380
           VA+ LA      E  A +  + + S  F  +TPT  N G +   +L SCFL  + D++  
Sbjct: 133 VALTLA---QGDETLARQLVDEIISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMES 189

Query: 381 --YGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
               I  ALQ    L+K  GG+    + +R  GA I     +S GVIP +K+  D     
Sbjct: 190 IGRSINSALQ----LSKRGGGVALLLSNLREAGAPIKRIENQSSGVIPVMKLLEDAFSYA 245

Query: 439 NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
           NQ G R+GA   YL   H D+  FLD ++   D++ R   ++    IPD+  +   +N  
Sbjct: 246 NQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKENED 305

Query: 499 WTLFSPDEVSDLHDLYGKEF-EIAY-ENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             LFSP    D+  +YGK F +I+  E Y+       I+  +KI+A   ++ +  + FE+
Sbjct: 306 MYLFSP---YDVERVYGKPFADISVTEKYDEMVADERIRK-KKINAREFFQTLAEIQFES 361

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEI-TLNSSSE-----------ETAVCNLGS 604
           G+P+I F+D  N  +P    G ++ SNLC+EI  +NS+SE           +   CNLGS
Sbjct: 362 GYPYIMFEDTVNRANPIA--GRINMSNLCSEILQVNSASEYNEDLSYAHIGKDISCNLGS 419

Query: 605 INLLAHFANNQFDYDKLASTIRTAVRVLDNVID---INC-HTIEKAKKSNHTHRAIGLGL 660
           +N +AH      D      T+ TA+R L  V D   I    +IEK   ++H   AIGLG 
Sbjct: 420 LN-IAH----TMDSPDFGRTVETAIRALTAVSDMSHIRSVPSIEKGNAASH---AIGLGQ 471

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERG-AYSSFKGSLWDQG 719
           M     L    I Y S EA++  +     +++HA+ AS  LA+ERG  ++ F+ S +  G
Sbjct: 472 MNLHGYLAREGIFYGSEEALDFTNIYFYTVTYHALRASNLLARERGETFAGFEQSKYASG 531

Query: 720 VF-----PIDSIGLLAEVRDELAMNRTSRLP----WDELKKRVKTIGMRNSNCMAIAPTA 770
            +       D     A+VR EL       +P    W +L+  V   G+ N N  A+ PT 
Sbjct: 532 EYFDKYTQQDWQPKTAKVR-ELFARAGITIPTQEDWAQLRDDVMRHGIYNQNLQAVPPTG 590

Query: 771 TIANICGVSQSIDPSYQNLYV-KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDG 829
           +I+ I   + SI P    + + K    G       ++ N+                    
Sbjct: 591 SISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAPYMTND-------------------- 630

Query: 830 SIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYL-DEPSGKKLDF- 887
              N+E   D        A+EI P  +I++ +   + +DQ  SL L+  D  + + ++  
Sbjct: 631 ---NLEYYQD--------AYEIGPEKIIDTYAAATQHVDQGLSLTLFFPDTATTRDINKA 679

Query: 888 -IYRQAWLMGLKTTYYLRSR----SATSVE 912
            IY  AW  G+KT YY+R R      T VE
Sbjct: 680 QIY--AWRKGIKTLYYIRLRQMALEGTEVE 707


>gnl|CDD|180921 PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 720

 Score =  202 bits (515), Expect = 4e-52
 Identities = 163/595 (27%), Positives = 263/595 (44%), Gaps = 89/595 (14%)

Query: 354 STPTLFNSG-TRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGA 412
           +TP+  N+G  R  +L SCFL  V DD+  I  ++     L++  GG+G + + +R  GA
Sbjct: 154 ATPSFLNAGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGINLSNLREAGA 213

Query: 413 HIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDD 472
            I G  G + GV+P +K+  D+    NQ G+R+GA   YL  +H D+  FL  +K   D+
Sbjct: 214 PIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADE 273

Query: 473 RRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAY----ENYERQ 528
           + R   ++    +PD F +   +N    LFSP  V      YG  F   Y    + Y+  
Sbjct: 274 KVRVKTLSLGVTVPDKFYELARKNEDMYLFSPYSV---EKEYGVPF--NYVDITKEYDEL 328

Query: 529 ADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEI 588
                I+   KI A  L  ++  +  E+G+P+I   D  N  +P    G +  SNLC+EI
Sbjct: 329 VANPNIRKT-KIKARDLETEISKLQQESGYPYIINIDTANRANPID--GKIIMSNLCSEI 385

Query: 589 -------TLNSSSEETAV-----CNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVI 636
                   +N + E   +     CNLGS N++    +  F       +I T VR L  V 
Sbjct: 386 LQVQTPSLINDAQEYVKMGTDISCNLGSTNIVNMMTSPDFG-----RSIETMVRALTFVT 440

Query: 637 DI-NCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAI 695
           D  N   +   K  N     IGLG MG  S L   HI Y SPE++E        +++  +
Sbjct: 441 DSSNIDAVPSIKHGNSQAHTIGLGAMGLHSYLAQNHIEYGSPESLEFTSIYFMLLNYWTL 500

Query: 696 SASVELAQERGA-YSSFK------GSLWDQ---GVFPIDSIGLLAEVRDELAMNRTSRLP 745
            AS  +A+ERG  + +F+      GS +D+   G F   S   + E+   + +   +   
Sbjct: 501 VASNNIARERGETFHNFEKSKYADGSYFDKYVTGDFVPKS-DKVKELFKGIFIPTAA--D 557

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  L+  V   G+ + N +A+AP  +I+ I   S SI P                     
Sbjct: 558 WAALRDAVMKDGLYHQNRLAVAPNGSISYINDTSASIHP--------------------- 596

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           +   +++R    E  I  + Y    +   E IP      + +A+++D   +I+  +   +
Sbjct: 597 ITQRIEER---QEKKIGKIYYPAPGLST-ETIP-----YYTSAYDMDMRKVIDVYAAATE 647

Query: 866 WIDQAQSLNLYL--DEPSG-------------KKLDFIYRQAWLMGLKTTYYLRS 905
            +DQ  SL L++    P G             + L  +   A+  G+K+ YY+R+
Sbjct: 648 HVDQGLSLTLFMRSTLPKGLYEWKDRTNKMTTRDLSILRNYAFNKGIKSIYYIRT 702


>gnl|CDD|181392 PRK08332, PRK08332, ribonucleotide-diphosphate reductase subunit
            alpha; Validated.
          Length = 1740

 Score =  157 bits (398), Expect = 1e-38
 Identities = 90/292 (30%), Positives = 147/292 (50%), Gaps = 28/292 (9%)

Query: 596  ETAVCNLGSINLLAHFANNQ------FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKS 649
            E   CNL SINL A F          FD+D+ A  I+   + LDN ID+N   + +   +
Sbjct: 1304 EYESCNLASINL-AKFVKYDENGKPYFDWDEYAYVIQKVAKYLDNAIDVNKFPLPEIDYN 1362

Query: 650  NHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYS 709
                R IG+G+MG   AL  L IPY S E  +   +  E+++F+A   SVE A++RG + 
Sbjct: 1363 TKLTRRIGVGMMGLADALFKLGIPYNSEEGFKFMRKVTEYLTFYAYKYSVEAAKKRGTFP 1422

Query: 710  SFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPT 769
             ++ + + +G  P++                   LPWD+L + +K  G+RN+      PT
Sbjct: 1423 LYEKTEYPKGELPVEG----------FYHPEIWNLPWDKLVEEIKKYGVRNAMVTTCPPT 1472

Query: 770  ATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDG 829
             +++ I   S  I+P +  +Y KS   G+F  V+     ELK+R L+ E ++  +  + G
Sbjct: 1473 GSVSMIADTSSGIEPIFALVYKKSVTVGEFYYVDPVFEAELKKRGLYSEELLKKISDNYG 1532

Query: 830  SIGNIERIPDDLKKIHATAFEID-----------PMWLIESASRRQKWIDQA 870
            S+  +E IP+D++++  TA +I             MWL +SAS+    I++A
Sbjct: 1533 SVQGLEEIPEDMQRVFVTALDIHWLDHILAQANIQMWLTDSASKTINMINEA 1584



 Score = 60.2 bits (145), Expect = 2e-09
 Identities = 32/100 (32%), Positives = 59/100 (59%), Gaps = 8/100 (8%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +V+KR+G +  FD S+I  A+ +A   V   G     ++ +++K +  Q +  L      
Sbjct: 5   KVMKRDGRIVPFDESRIRWAVQRAMWEV---GVRDEKKLDEVVKRIV-QRINELY----D 56

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVR 129
             I HIE+IQD VE  LM++G  ++ + Y+LYR++++++R
Sbjct: 57  GKIPHIENIQDIVELELMRAGLFEVAKAYILYRKKKAEIR 96



 Score = 52.8 bits (126), Expect = 4e-07
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 9/126 (7%)

Query: 280 YLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEK---- 335
           YL N  +++  ++   +G   L   +F  +     E+ +   M+V++   LK  E+    
Sbjct: 179 YLENFEEFDGKYS---IGKYKLNKYHFERMVNLYRELAEKGKMKVSIDEFLKMLERGEFD 235

Query: 336 --EKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAML 393
             EK   E++ L+++  FM +TP L NSG     LS+CF+  + DD+  I  A  + AM+
Sbjct: 236 KYEKEIEEYFRLMTNQIFMPNTPALINSGRPLGMLSACFVVPIEDDMESIMKAAHDVAMI 295

Query: 394 AKYSGG 399
            K  GG
Sbjct: 296 QKAGGG 301



 Score = 51.3 bits (122), Expect = 1e-06
 Identities = 39/149 (26%), Positives = 75/149 (50%), Gaps = 8/149 (5%)

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           EN M+  ++ GL  +++ +R  G  +  T G + G + F+ + +  +  + QGG R+GA 
Sbjct: 747 ENGMIFVHNTGL--NFSKLRPEGDIVGTTTGAASGPVSFMHLIDAVSDVIKQGGVRRGAN 804

Query: 449 CAYLETWHIDVEEFLDLR-KNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
              LE WH D+E+F+  + KN G +     +++   W  + F + + +   + L +P   
Sbjct: 805 MGILEIWHPDIEKFIHAKEKNIGTNVLSNFNISVGIW--EDFWEALKEGKKYPLINPRTG 862

Query: 508 SDLHDLYGKEF--EIAYENYERQADRGEI 534
             + ++  K    E+AY  + + AD G I
Sbjct: 863 EVVKEIDPKSLFEELAYMAWAK-ADPGVI 890


>gnl|CDD|181232 PRK08115, PRK08115, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 858

 Score =  139 bits (351), Expect = 4e-33
 Identities = 114/436 (26%), Positives = 192/436 (44%), Gaps = 56/436 (12%)

Query: 489 FMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGE-------IKVFRKIS 541
           FM+ V  +  + L  PD    + +   +E EI  E +    D  E       ++ +RKI 
Sbjct: 379 FMEAVENDEEYELRFPD----VENYTEEEMEIYNEEWHEVGDVREWEKMGYPVRTYRKIK 434

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVG-VVHSSNLCTEITLNSSSEETAVC 600
           A  LW  +      +  P I F D  N  +  +  G  V ++N C E  L   S    VC
Sbjct: 435 AKELWNLINICATYSAEPGIFFIDNANEMTNAKAYGQKVVATNPCGEQPLAPYS----VC 490

Query: 601 NLGSINLLAHFANNQ---FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIG 657
           NL +INL A+ A+ +    DY+KL  T+   VR+ DNVID   + +E+ KK     R +G
Sbjct: 491 NLAAINL-ANMADKETKTVDYEKLKRTVEVGVRMQDNVIDATPYFLEENKKQALGERRVG 549

Query: 658 LGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWD 717
           LG+MG    L      Y S E  ++ D+  E I+  A   S+ELA+E+G++    G   +
Sbjct: 550 LGVMGLHDLLIYCETVYGSEEGNQLVDQIFETIATTAYRTSIELAKEKGSFPFLVGQTEE 609

Query: 718 QGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICG 777
           +     ++          +      ++P D +++ +   G+RNS+ + +APT +   + G
Sbjct: 610 ETAKLREAF---------INTGYMKKMPED-IREDILKYGIRNSHLLTVAPTGSTGTMVG 659

Query: 778 VSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERI 837
           VS  ++P +   Y +S   G F  V + +V E   +    +                   
Sbjct: 660 VSTGLEPYFSFSYYRSGRLGKFIEVKADIVQEYLDKHPEAD------------------- 700

Query: 838 PDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSG---KKLDFIYRQAWL 894
            + L +   +A E+ P    +     Q+W+D   SL+  ++ P G   +++  +Y + + 
Sbjct: 701 ENHLPEWFISAMELKPEAHADVQCIIQRWVD--SSLSKTVNAPKGYTVEQVQKVYERLYR 758

Query: 895 MGLK--TTYYLRSRSA 908
            G K  T Y   SR A
Sbjct: 759 GGAKGGTVYVDGSRDA 774



 Score = 56.8 bits (137), Expect = 3e-08
 Identities = 44/146 (30%), Positives = 69/146 (47%), Gaps = 5/146 (3%)

Query: 323 RVAMGLALKETEKEKRAV---EFYNLLSSFHFMCSTPTLFNSGTRHP-QLSSCF-LTTVP 377
           R A GLA  E  +EKR     +FY  L + +F+ +   L+ +G++      +C+ +  V 
Sbjct: 137 RNATGLAAVEKTEEKRKESFEKFYQELVNMNFVPAGRVLYGAGSKTDVTYFNCYVMPFVK 196

Query: 378 DDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVA 437
           D   GI    ++   +    GG+G + + +R       G NGKS G + +L         
Sbjct: 197 DSREGISEHRKQVMEIMSRGGGVGTNGSTLRPRNTLARGVNGKSSGSVSWLDDIAKLTHL 256

Query: 438 VNQGGKRKGAVCAYLETWHIDVEEFL 463
           V QGG R+GA    L  WH D+ EF+
Sbjct: 257 VEQGGSRRGAQMIMLADWHPDILEFI 282


>gnl|CDD|180772 PRK06948, PRK06948, ribonucleotide reductase-like protein;
           Provisional.
          Length = 595

 Score =  121 bits (304), Expect = 1e-27
 Identities = 147/623 (23%), Positives = 240/623 (38%), Gaps = 91/623 (14%)

Query: 300 ILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVE--FY-NLLSSFHFMCSTP 356
           +  DRY L    SR       F RVA  LAL E    +      FY NLL+    + +  
Sbjct: 19  VFADRYALPGETSR----AQVFARVARALALAEPPDTRAGAARRFYRNLLNGA--IGAGR 72

Query: 357 TLFNSGT-RHPQLSSCF---------LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTP 406
            + N+G      + +CF         LT V  +L     AL +  +     GG+G D++ 
Sbjct: 73  IMANAGAAPDQTMVNCFVHPIRAPAALTAVHPNLDR---ALDDARLTLLMGGGIGYDFSA 129

Query: 407 VRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLR 466
           +    A     +  S GV   L   +    A+     R+GA  A L   H D+  F+  +
Sbjct: 130 IPPADARPDADHPDSPGVCAALDRFDRICAALPFRDGRRGAQMAVLRCDHPDLLAFVAAK 189

Query: 467 KNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYE 526
           +     R R    N +  + D FM+ V Q+  W L             G     A   + 
Sbjct: 190 RG----RARWTTFNLSVAVTDAFMQAVAQDLPWALRHRAPP---RRAAGGALRGADGAW- 241

Query: 527 RQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCT 586
                     +  + A  LWR++++   ++  P + F D  +  +P +    + ++N C 
Sbjct: 242 ---------TYATVPARHLWREIVSAARDSAEPGLLFVDTIDAANPLREHERIDATNPCG 292

Query: 587 EITLNSSSEETAVCNLGSINLLAHFANN--------QFDYDKLASTIRTAVRVLDNVIDI 638
           E  L         C LG I+L + F  +        +FD+  LA+ +R  VR+LDN +D+
Sbjct: 293 EQPLPPYGS----CVLGPIDL-SRFVRHPFGVGGEPRFDFAALATAVRIQVRMLDNALDL 347

Query: 639 NCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISAS 698
               +    +     R IG+G+ G   AL ++ + Y SP A E+A      +  HA +AS
Sbjct: 348 TRWPLAAHAREARQKRRIGVGVTGLADALTMMRLRYDSPAAREMARYIASDLRHHAYAAS 407

Query: 699 VELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGM 758
             LA ERGAY             P   +  L              LP   +   +   G+
Sbjct: 408 AALAAERGAYPLCD---------PAAHLDALRAG---------PPLP-HAVCHAIARHGL 448

Query: 759 RNSNCMAIAPTATIANICG--VSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLW 816
           RNS+ ++ AP  +++   G   S  I+P+   +  +   +G               R   
Sbjct: 449 RNSHLLSFAPVGSVSLAFGDNCSPGIEPARAWIEHRPVRAGA-GGARGMRAENHAYR--- 504

Query: 817 DEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLY 876
              +   L+      G    +PD       TA ++ P   +   +  Q ++D   S  + 
Sbjct: 505 ---LFRSLR------GERAALPD----YFVTAADVAPADHLAMRAALQPYVDAGISKTVT 551

Query: 877 L-DEPSGKKLDFIYRQAWLMGLK 898
           L +  S  ++D +  QAW  GLK
Sbjct: 552 LPNHYSLAEVDALLFQAWRAGLK 574


>gnl|CDD|180621 PRK06556, PRK06556, vitamin B12-dependent ribonucleotide reductase;
           Validated.
          Length = 953

 Score =  105 bits (265), Expect = 4e-23
 Identities = 143/611 (23%), Positives = 243/611 (39%), Gaps = 116/611 (18%)

Query: 350 HFMCS--TPTLFNSGT-RHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTP 406
           H   S  +P  FN GT    Q+S+CF+ +V D +  I    +E  ML K   G G + + 
Sbjct: 128 HQKFSFNSPVWFNVGTESPQQVSACFILSVDDSMESILNWYKEEGMLFKGGSGTGTNLSR 187

Query: 407 VRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGK-RKGAVCAYLETWHIDVEEFLDL 465
           +R     + G  G + G + F++ A+ +A  +  GG  R+ A    L+  H D+EEF++ 
Sbjct: 188 IRSSKELLSG-GGTASGPVSFMRGADASAGTIKSGGATRRAAKMVILDVDHPDIEEFIET 246

Query: 466 RKNTGDDRRRT-----HDMN------------TAN---WIPDLFMKRVTQNAGWTLFSPD 505
            K   +D+ R      +DM+             AN    + D FM+ V  +  + L +  
Sbjct: 247 -KAKEEDKIRALRDAGYDMDLGGEAYSSVQYQNANNSVRVSDEFMRAVENDGEFGLRA-- 303

Query: 506 EVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKD 565
                                    R + +V   + A  L+RK+    +E   P I + D
Sbjct: 304 -------------------------RTDGEVIETVDAKELFRKIAEAAWECADPGIQYDD 338

Query: 566 PCNIRSPQQHVGVVHSSNLCTE-ITLNSSSEETAVCNLGSINLLAHF--ANNQFDYDKLA 622
             N        G +++SN C+E + L++SS     CNL S+NL+  F   +  FD +   
Sbjct: 339 TINDWHTCPESGRINASNPCSEYMFLDNSS-----CNLASLNLM-KFLRDDGTFDVESFR 392

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             +   +  ++  I       EK  ++    R +GLG     + L    +PY S     +
Sbjct: 393 HAVELVITAMEISICFADFPTEKIARNTRAFRQLGLGYANLGALLMATGLPYDSDGGRAL 452

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFK-----------------GSLWDQGVFPIDS 725
           A      ++  A   S ELA   G +  +                   ++  + +  +D+
Sbjct: 453 AAAITSLMTGEAYRRSAELAGVVGPFEGYARNAEPHLRVMRKHAAANDAI--RPLGEVDA 510

Query: 726 IGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANI--CGVSQSID 783
             LL   ++           WD+  +  +  G RN+    +APT TI  +  C  +  I+
Sbjct: 511 -ALLEAAKEA----------WDDALELGEKNGYRNAQASVLAPTGTIGFMMDCD-TTGIE 558

Query: 784 PSYQNL--YVKSNMSGDFTVVNSFLVNELKQRDL-WDEAMISDLKYHDGSIGNIERIPDD 840
           P +  L  Y K    G   +VN  +   LK+  L + E  I  +  +    G+IE  P  
Sbjct: 559 PDF-ALVKYKKLVGGGSMKIVNQTVPRALKK--LGYSEEQIEAIVEYIAEHGHIEGAP-G 614

Query: 841 LKKIHATAFE-----------IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDF-- 887
           LK  H   F+           I PM  +   +  Q ++  A S  + + E +  + D   
Sbjct: 615 LKPEHYAVFDCAMKPASGERSISPMGHVRMMAAVQPFLSGAISKTVNMPEDATVE-DIEE 673

Query: 888 IYRQAWLMGLK 898
           +Y + W +GLK
Sbjct: 674 VYLEGWKLGLK 684


>gnl|CDD|181341 PRK08270, PRK08270, anaerobic ribonucleoside triphosphate
           reductase; Provisional.
          Length = 656

 Score = 95.7 bits (239), Expect = 5e-20
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 11/105 (10%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++IKR+G +  FD  KI+ AI KAF A                + L  + V   L+    
Sbjct: 4   KIIKRDGRIVPFDAEKITEAIAKAFKATGEFDP-------SEAERLALR-VIEKLEDED- 54

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSH 134
             I  +E+IQD VE  L+++G+ K  + Y+LYRE+ + +R  +  
Sbjct: 55  --IPSVEEIQDIVEKVLIEAGYFKTAKAYILYREQHARLRNDKKT 97


>gnl|CDD|180846 PRK07111, PRK07111, anaerobic ribonucleoside triphosphate
           reductase; Provisional.
          Length = 735

 Score = 86.2 bits (214), Expect = 4e-17
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 8/104 (7%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA 90
           ++KR+G    FD  KI+ AI KA  AV G+     +   + I  LT++ +  L +  K  
Sbjct: 5   IVKRDGREVPFDEEKITNAIFKAAEAVGGE-----LDESEAI-ELTQKVIKYLEEKYKEE 58

Query: 91  LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSH 134
           + V  EDIQD VE  L+++GH +  + Y+LYR ER+ +R  +S 
Sbjct: 59  VTV--EDIQDLVEKVLIENGHAETAKAYILYRAERTRIREIKSD 100


>gnl|CDD|181736 PRK09263, PRK09263, anaerobic ribonucleoside triphosphate
           reductase; Provisional.
          Length = 711

 Score = 85.7 bits (213), Expect = 5e-17
 Identities = 34/106 (32%), Positives = 49/106 (46%), Gaps = 11/106 (10%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
            +VIKR+G    FD  KI  AI KA  AVE       +  +D    +  +  +R+   + 
Sbjct: 3   PKVIKRDGRKVPFDSEKIKNAIEKAAKAVE-------VDDEDYCATVAAEIASRVEGRD- 54

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSH 134
               V IE+IQD VE  LM   +  + R Y+ YR +R   R   + 
Sbjct: 55  ---EVDIEEIQDAVENQLMAGPYKALARAYIEYRHDRDIAREKATD 97


>gnl|CDD|181031 PRK07562, PRK07562, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 1220

 Score = 57.7 bits (140), Expect = 1e-08
 Identities = 40/104 (38%), Positives = 59/104 (56%), Gaps = 5/104 (4%)

Query: 365 HPQLSSCFLTTVPDDLY---GIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           HPQ  +CF+ +V DDL    GI       A L KY  G G++++ +RG G  + G  GKS
Sbjct: 193 HPQPHACFIQSVEDDLVNEGGIMDLWVREARLFKYGSGTGSNFSNLRGEGEKLSG-GGKS 251

Query: 422 QGVIPFLKVANDTAVAVNQGG-KRKGAVCAYLETWHIDVEEFLD 464
            G++ FLK+ +  A A+  GG  R+ A    ++  H D+EEF+D
Sbjct: 252 SGLMSFLKIGDRAAGAIKSGGTTRRAAKMVIVDIDHPDIEEFID 295



 Score = 48.8 bits (117), Expect = 7e-06
 Identities = 75/330 (22%), Positives = 123/330 (37%), Gaps = 95/330 (28%)

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           + D F++ V  +  W L +                           R + KV + + A  
Sbjct: 403 VTDEFLRAVENDGDWNLTA---------------------------RTDGKVAKTLKARD 435

Query: 545 LWRKMLTMLFETGHPWITFKDPCNI--RSPQQHVGVVHSSNLCTEITLNSSSEETAVCNL 602
           LW K+    + +  P + F    N     P    G + +SN C+E       ++TA CNL
Sbjct: 436 LWEKIGYAAWASADPGLQFNTTINDWHTCPAS--GPIRASNPCSEYMF---LDDTA-CNL 489

Query: 603 GSINLLAHFAN---NQFDYDKLASTIRTAVRVLDNVIDINC-----HTIEKAKKSNHTHR 654
            S+NLL  F +    +FD +        A R+   V++I+       + E A+ S +  R
Sbjct: 490 ASLNLL-TFRDEDTKRFDVEAY----EHACRLWTVVLEISVLMAQFPSKEIAELS-YEFR 543

Query: 655 AIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISA---------SVELAQER 705
            +GLG       L  + IPY S E   I           A+SA         S E+A+E 
Sbjct: 544 TLGLGYANIGGLLMTMGIPYDSDEGRAICG---------ALSAIMTGVAYATSAEMAKEL 594

Query: 706 GAYSSFKGSLWD-------------------QGV----FPIDSIGLLAEVRDELAMNRTS 742
           G +  ++ +                      +G+     P+D     A   D+  +   +
Sbjct: 595 GPFPGYEKNADHMLRVIRNHRRAAHGESEGYEGLSVNPVPLDH----ANCPDQDLVAH-A 649

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATI 772
           +  WD+  +  +  G RN+    IAPT TI
Sbjct: 650 KAAWDKALELGEKHGYRNAQVTVIAPTGTI 679


>gnl|CDD|162893 TIGR02505, RTPR, ribonucleoside-triphosphate reductase,
           adenosylcobalamin-dependent.  This model represents a
           group of adenosylcobalamin(B12)-dependent ribonucleotide
           reductases (RNR) related to the characterized species
           from Lactococcus leichmannii. RNR's are responsible for
           the conversion of the ribose sugar of RNA into the
           deoxyribose sugar of DNA. This is the rate-limiting step
           of DNA biosynthesis. Thus model identifies NrdJ enzymes
           only in cyanobacteria, lactococcus and certain
           bacteriophage. A separate model (TIGR02504) identifies a
           larger group of divergent B12-dependent RNR's.
          Length = 713

 Score = 40.7 bits (95), Expect = 0.002
 Identities = 37/210 (17%), Positives = 63/210 (30%), Gaps = 50/210 (23%)

Query: 579 VHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDK--LASTIRTAVRVLDNVI 636
           V  +N C EI L         CNL  +NL        F+ D   L      A R    V 
Sbjct: 363 VEGTNPCGEILL----ANGEPCNLFEVNL------LAFEEDGWGLQRAFALAARYAKRVT 412

Query: 637 DINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAIS 696
               +  E +++    +R IG+ + G Q  L                             
Sbjct: 413 FSP-YDDEISREIIQKNRRIGVSMSGIQDFLL------------------------LRGG 447

Query: 697 ASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTI 756
              +   +   + + K       V+   +   L  +     + + ++    EL       
Sbjct: 448 TGFKDDFDPETHEAIKVR-----VYDKRAAKFLDRMYKI--VVKAAQDYSKELGCP---- 496

Query: 757 GMRNSNCMAIAPTATIANICGVSQSIDPSY 786
                    + P+ TI+ + G S+ I P Y
Sbjct: 497 --EPIKHTTVKPSGTISKLAGASEGIHPPY 524


>gnl|CDD|130551 TIGR01487, SPP-like, sucrose-phosphate phosphatase-like hydrolase,
           Archaeal.  TIGR01482, in turn, is a member of the IIB
           subfamily (TIGR01484) of the Haloacid Dehalogenase (HAD)
           superfamily of aspartate-nucleophile hydrolases.
          Length = 215

 Score = 33.2 bits (76), Expect = 0.31
 Identities = 11/59 (18%), Positives = 23/59 (38%), Gaps = 8/59 (13%)

Query: 140 PIAPKLKIMM--------DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMY 190
           P A  L +++        ++G +I +N + + +   E    L +   K    +   N Y
Sbjct: 46  PFARALAVLIGTSGPVVAENGGVIFYNKEDIFLANMEEEWFLDEEKKKRFPRDRLSNEY 104


>gnl|CDD|179038 PRK00464, nrdR, transcriptional regulator NrdR; Validated.
          Length = 154

 Score = 33.2 bits (77), Expect = 0.34
 Identities = 9/25 (36%), Positives = 15/25 (60%)

Query: 29 VQVIKRNGGVTSFDPSKISRAIMKA 53
          + VIK++G    FD  K+ R + +A
Sbjct: 49 LLVIKKDGRREPFDREKLRRGLRRA 73


>gnl|CDD|131651 TIGR02602, 8TM_EpsH, eight transmembrane protein EpsH (proposed
           exosortase).  Members of this family are integral
           membrane proteins with eight predicted transmembrane
           helices in common. Some members of this family have long
           trailing sequences past the region described by this
           model. This model does not include the region of the
           first predicted transmembrane region. The best
           characterized member is EpsH of Methylobacillus sp. 12S,
           where it is part of a locus associated with biosynthesis
           of the exopolysaccharide methanolan.
          Length = 241

 Score = 31.2 bits (71), Expect = 1.2
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 151 DGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLI 210
           +G +I   S  LE  V EACSGL+ + + + L      ++  L+   L    IF S  ++
Sbjct: 135 EGNVIHLPSGTLE--VVEACSGLRSLFTSLALG----TLFAYLNLRSLWRRAIFLSVAIL 188


>gnl|CDD|178286 PLN02682, PLN02682, pectinesterase family protein.
          Length = 369

 Score = 30.1 bits (68), Expect = 2.6
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 13/68 (19%)

Query: 4   SKDVNKGD----EDAFPSLAYPFPEKIKGVQV-IKRNGGVTSFDPSKISRAIMKAFMAVE 58
            K    GD    + A  SL  P    I  V+V IK N G       K++   +KA++ +E
Sbjct: 74  DKKPAAGDFTTIQAAIDSL--PV---INLVRVVIKVNAGTYR---EKVNIPPLKAYITLE 125

Query: 59  GKGASRSI 66
           G GA ++I
Sbjct: 126 GAGADKTI 133


>gnl|CDD|138835 PRK12279, PRK12279, 50S ribosomal protein L22/unknown domain fusion
           protein; Provisional.
          Length = 311

 Score = 29.7 bits (66), Expect = 3.9
 Identities = 23/113 (20%), Positives = 47/113 (41%), Gaps = 14/113 (12%)

Query: 165 IVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSS--------RTLIEKEPNY 216
           +VE+  S  ++ +++ ++  T       L + DLE  +IF          R L+      
Sbjct: 175 VVEKTASQKEEETTETIMISTSPKNAQVLFD-DLEKNVIFYKTTPVNKVLRVLVYVTSPT 233

Query: 217 AKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
            KV   F LE +    ++++++K     + +   +  + +  Y E   KA  L
Sbjct: 234 KKVVGEFDLESVEIGAISSIWRK-----YGKQSVISKKEYDAYYEGKDKAHAL 281


>gnl|CDD|129694 TIGR00606, rad50, rad50.  This family is based on the phylogenomic
           analysis of JA Eisen (1999, Ph.D. Thesis, Stanford
           University).
          Length = 1311

 Score = 29.6 bits (66), Expect = 4.1
 Identities = 42/242 (17%), Positives = 79/242 (32%), Gaps = 55/242 (22%)

Query: 62  ASRSIRVQDIIKNL---------TEQTVTRLLQHNKSALIVHIEDI----QDQVECSLMQ 108
           A+R I+  + ++ +           Q   + L+  K      I D     + Q+E S   
Sbjct: 181 ATRYIKALETLRQVRQTQGQKVQEHQMELKYLKQYKEK-ACEIRDQITSKEAQLESS--- 236

Query: 109 SGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEE 168
               +I + Y    +   +      H+ S        KIM  D  + +  S++ +M    
Sbjct: 237 ---REIVKSYENELDPLKNRLKEIEHNLS--------KIMKLDNEIKALKSRKKQM---- 281

Query: 169 ACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKL 228
                +  +S+  L    + ++ G ++  L        RT+ EKE           LEKL
Sbjct: 282 -----EKDNSE--LELKMEKVFQG-TDEQLNDLYHNHQRTVREKERELVDCQRE--LEKL 331

Query: 229 RREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYE 288
            +E      +K              E         ++A    E +   D +  +   + E
Sbjct: 332 NKERRLLNQEK-------------TELLVEQGRLQLQADRHQEHIRARDSLIQSLATRLE 378

Query: 289 RD 290
            D
Sbjct: 379 LD 380


>gnl|CDD|185247 PRK15349, PRK15349, type III secretion system protein SsaT;
           Provisional.
          Length = 259

 Score = 29.1 bits (65), Expect = 4.9
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 22/98 (22%)

Query: 214 PNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCR--YIEEGVKARLLHE 271
           P +A   A FLL+ LR   + T++    +A       L+ ++ C   +I  G        
Sbjct: 91  PFWAVDMAGFLLDTLRGATMGTIFNSTIEAETSLFGLLFSQFLCVIFFISGG-------- 142

Query: 272 SMMDFDLVYLANDLKYERDFAFEYL--GLQILYDRYFL 307
             M+F L     ++ YE   +++YL  G  +L+DR FL
Sbjct: 143 --MEFIL-----NILYE---SYQYLPPGRTLLFDRQFL 170


>gnl|CDD|150401 pfam09721, Exosortase_EpsH, Transmembrane exosortase
           (Exosortase_EpsH).  Members of this family are
           designated exosortase, analogous to sortase in cell wall
           sorting mediated by LPXTG domains in Gram-positive
           bacteria. The phylogenetic distribution of the proteins
           in this entry is nearly perfectly correlated with the
           distribution of the proteins having the PEP-CTERM anchor
           motif, IPR013424. Members of this entry are integral
           membrane proteins with eight predicted transmembrane
           helices in common. Some members of this family have long
           trailing sequences past the region described by this
           model. This model does not include the region of the
           first predicted transmembrane region. The best
           characterized member is EpsH of Methylobacillus sp. 12S,
           where it is part of a locus associated with biosynthesis
           of the exopolysaccharide methanol-an.
          Length = 258

 Score = 28.8 bits (65), Expect = 6.6
 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 2/24 (8%)

Query: 151 DGTLISFNSKRLEMIVEEACSGLQ 174
           +G +I+     +E  V EACSGL+
Sbjct: 150 EGNVITLPGGTVE--VAEACSGLR 171


>gnl|CDD|178262 PLN02656, PLN02656, tyrosine transaminase.
          Length = 409

 Score = 28.7 bits (64), Expect = 6.9
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 643 IEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELA 702
           +E      +  R I LG MG  +A    H  + + EAV  A +S +F   +  + +V L 
Sbjct: 21  MESIDDEENGKRVISLG-MGDPTAYSCFHTTHVAQEAVVDALQSNKF---NGYAPTVGLP 76

Query: 703 QERGAYSSF 711
           Q R A + +
Sbjct: 77  QARRAIAEY 85


>gnl|CDD|162689 TIGR02081, metW, methionine biosynthesis protein MetW.  This
           protein is found alongside MetX, of the enzyme that
           acylates homoserine as a first step toward methionine
           biosynthesis, in many species. It appears to act in
           methionine biosynthesis but is not fully characterized.
          Length = 194

 Score = 28.9 bits (65), Expect = 7.4
 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 3/39 (7%)

Query: 608 LAHFANNQFDYDKLASTI---RTAVRVLDNVIDINCHTI 643
           L  F +  FDY  L+ T+   R    +LD ++ +  H I
Sbjct: 68  LEAFPDKSFDYVILSQTLQATRNPEEILDEMLRVGRHAI 106


>gnl|CDD|178532 PLN02946, PLN02946, cysteine-tRNA ligase.
          Length = 557

 Score = 28.7 bits (64), Expect = 7.7
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 113 KITREYVLYR-EERSDVRAAQSHSKSDA 139
           K+T E VL + EER+  R  + + KSDA
Sbjct: 494 KLTEEQVLQKIEERTVARKNKEYEKSDA 521


>gnl|CDD|131313 TIGR02260, benz_CoA_red_B, benzoyl-CoA reductase, bcr type, subunit
           B.  This model describes B, or beta, subunit of the bcr
           type of benzoyl-CoA reductase, a 4-subunit enzyme. Many
           aromatic compounds are metabolized by way of
           benzoyl-CoA.
          Length = 413

 Score = 28.4 bits (63), Expect = 8.6
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
            F+V +LK+  +     IS +K+      +I+R+ + LKK  +   E D +W++ESA  +
Sbjct: 157 DFMVKQLKEDVIPKFEQISGVKF------DIDRLREYLKK--SAKAEDDHVWVLESAKHK 208

Query: 864 QKWID 868
              ID
Sbjct: 209 PSPID 213


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.319    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0695    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 15,391,816
Number of extensions: 1007189
Number of successful extensions: 2024
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1862
Number of HSP's successfully gapped: 76
Length of query: 954
Length of database: 5,994,473
Length adjustment: 103
Effective length of query: 851
Effective length of database: 3,768,849
Effective search space: 3207290499
Effective search space used: 3207290499
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (27.7 bits)