BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780505|ref|YP_003064918.1| 6-phosphogluconolactonase [Candidatus Liberibacter asiaticus str. psy62] (234 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780505|ref|YP_003064918.1| 6-phosphogluconolactonase [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Score = 485 bits (1248), Expect = e-139, Method: Compositional matrix adjust. Identities = 234/234 (100%), Positives = 234/234 (100%) Query: 1 MLQYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVD 60 MLQYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVD Sbjct: 1 MLQYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVD 60 Query: 61 WHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEK 120 WHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEK Sbjct: 61 WHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEK 120 Query: 121 ICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMT 180 ICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMT Sbjct: 121 ICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMT 180 Query: 181 FSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS 234 FSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS Sbjct: 181 FSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS 234 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 25.0 bits (53), Expect = 1.1, Method: Compositional matrix adjust. Identities = 9/31 (29%), Positives = 17/31 (54%) Query: 57 INVDWHKVVVTLVDERFVPLENLRSNQSFIS 87 I DW K ++ + F P+ N+R + ++S Sbjct: 444 IEADWRKKIIGPLGILFTPIANIRGDLHYLS 474 >gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter asiaticus str. psy62] Length = 223 Score = 24.3 bits (51), Expect = 2.1, Method: Compositional matrix adjust. Identities = 8/13 (61%), Positives = 9/13 (69%) Query: 117 ANEKICQLIHFPF 129 NE ICQL+ PF Sbjct: 65 TNETICQLLDLPF 77 >gi|254780353|ref|YP_003064766.1| DNA topoisomerase IV subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 753 Score = 23.9 bits (50), Expect = 2.7, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 142 TASFFPKGDTLSIALDTHTPRSVI 165 +A F +GD+L IAL HT ++ Sbjct: 541 SALHFKEGDSLKIALHAHTTDRIL 564 >gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 954 Score = 23.5 bits (49), Expect = 3.5, Method: Compositional matrix adjust. Identities = 20/82 (24%), Positives = 35/82 (42%), Gaps = 8/82 (9%) Query: 127 FPFDVVVLGMGI---DGHTASFFPKGDTLSI-----ALDTHTPRSVIAIKDYTSNEQRMT 178 +PF + G+ + +G SF P + +I A++ I ++D N T Sbjct: 20 YPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQT 79 Query: 179 MTFSALHDAQFLALHIEGTQKK 200 +T H+ L +HIE Q + Sbjct: 80 VTRLLQHNKSALIVHIEDIQDQ 101 >gi|254780575|ref|YP_003064988.1| hypothetical protein CLIBASIA_02310 [Candidatus Liberibacter asiaticus str. psy62] Length = 316 Score = 23.5 bits (49), Expect = 3.8, Method: Compositional matrix adjust. Identities = 11/27 (40%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Query: 44 GLTPRF--FLEELSIINVDWHKVVVTL 68 G+TP + FLE++S++ V H+V+ +L Sbjct: 38 GITPLYTQFLEQVSVLEVISHRVLWSL 64 >gi|254780709|ref|YP_003065122.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 321 Score = 22.7 bits (47), Expect = 5.5, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Query: 156 LDTHTPRSVIAIKDYTS--NEQRMTMTFSALHDAQFLAL-HIEGTQK 199 LD H P SV+ + D T+ N R F A+ L + ++GT + Sbjct: 225 LDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTAR 271 >gi|254780725|ref|YP_003065138.1| response regulator receiver protein [Candidatus Liberibacter asiaticus str. psy62] Length = 427 Score = 22.7 bits (47), Expect = 5.5, Method: Compositional matrix adjust. Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 134 LGMGIDGHTASFFPKGDTLS 153 + +G DGH + F D LS Sbjct: 1 MNIGYDGHNSDFLENEDNLS 20 >gi|254780573|ref|YP_003064986.1| cysteinyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 22.3 bits (46), Expect = 8.2, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 10/19 (52%) Query: 216 PIRAILWNAQSPLEVHWTS 234 P ILW +P+E W S Sbjct: 188 PADFILWKRSTPMEPGWES 206 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.134 0.387 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 143,724 Number of Sequences: 1233 Number of extensions: 5594 Number of successful extensions: 22 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 12 length of query: 234 length of database: 328,796 effective HSP length: 71 effective length of query: 163 effective length of database: 241,253 effective search space: 39324239 effective search space used: 39324239 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 37 (18.9 bits)