>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2. Malic enzyme (ME), a member of the amino acid dehydrogenase (DH)-like domain family, catalyzes the oxidative decarboxylation of L-malate to pyruvate in the presence of cations (typically Mg++ or Mn++) with the concomitant reduction of cofactor NAD+ or NADP+. ME has been found in all organisms, and plays important roles in diverse metabolic pathways such as photosynthesis and lipogenesis. This enzyme generally forms homotetramers. The conversion of malate to pyruvate by ME typically involves oxidation of malate to produce oxaloacetate, followed by decarboxylation of oxaloacetate to produce pyruvate and CO2. This subfamily consists primarily of archaeal and bacterial ME. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydroph

Probab=92.66 E-value=0.38 Score=28.85 Aligned_cols=83 Identities=25% Similarity=0.393 Sum_probs=49.0 Q ss_pred HHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCC---EEECCCC--------------------------- Q ss_conf 9999999986787720012899616442034689999862045---3312467--------------------------- Q gi|254780506|r 145 AGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNAT---VTMAHSK--------------------------- 194 (306) Q Consensus 145 ~av~~ll~~y~~i~l~Gk~vvVvGrs~~VG~Pla~lL~~~~at---Vti~hs~--------------------------- 194 (306) T Consensus 10 Agll~a~r~-~g~~l~d~riv~~GAGs-Ag~gia~ll~~~g~~~~~i~lvD~~GLl~~~r~d~~~~~k~~~a~~~~~~~~ 87 (226) T cd05311 10 AGLLNALKL-VGKKIEEVKIVINGAGA-AGIAIARLLLAAGAKPENIVVVDSKGVIYEGREDDLNPDKNEIAKETNPEKT 87 (226) T ss_pred HHHHHHHHH-HCCCCCCCEEEEECHHH-HHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCC T ss_conf 999999998-49981030799987689-9999999999827760267999367852478864144999999987233566 Q ss_pred CCCHHHHHHHCCEEEEECCCCCCCCCCCCC---CCCEEE Q ss_conf 653477642235736522443212201047---662699 Q gi|254780506|r 195 TKNLPEICRTADILVVAVGRPRMVQVDWIK---TGSLVI 230 (306) Q Consensus 195 T~~l~~~~~~ADivIsAvG~p~~i~~~~vk---~gavvI 230 (306) T Consensus 88 ~~~l~e~v~~~~vLIG~S~-~g~Ft~evv~~M~~~PiIF 125 (226) T cd05311 88 GGTLKEALKGADVFIGVSR-PGVVKKEMIKKMAKDPIVF 125 (226) T ss_pred CCCHHHHHCCCCEEEECCC-CCCCCHHHHHHHCCCCEEE T ss_conf 6879998377757997268-9977999999747798898

HHsearch alignment for GI: 254780506 and conserved domain: cd05311