RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780507|ref|YP_003064920.1| hypothetical protein CLIBASIA_01970 [Candidatus Liberibacter asiaticus str. psy62] (176 letters) >gnl|CDD|146406 pfam03748, FliL, Flagellar basal body-associated protein FliL. This FliL protein controls the rotational direction of the flagella during chemotaxis. FliL is a cytoplasmic membrane protein associated with the basal body. Length = 145 Score = 33.4 bits (77), Expect = 0.038 Identities = 16/80 (20%), Positives = 33/80 (41%), Gaps = 5/80 (6%) Query: 62 QAYFLVKLSFIVNDSQERSYLKE---IATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIK 118 Y + ++ V D + L++ + D + LLS D + G + L++++ Sbjct: 65 TRYLKISIALEVRDPKAAEELEKHMPLIRDAILMLLSSKTAEDLSTPE--GKEKLKEELL 122 Query: 119 EDLNSRLGSQFISEVLIDEL 138 E +N L + +VL Sbjct: 123 ERINEVLLEGEVEDVLFTSF 142 >gnl|CDD|31393 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription]. Length = 677 Score = 31.0 bits (70), Expect = 0.21 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 5/67 (7%) Query: 38 LAIKNTNIIKSELVSIPSVSNGVLQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGP 97 L++ + + IP +NG L A FL L F + ++Q+R +KEI D L S Sbjct: 228 LSLLLRRAKRQKRSGIPLPANGELLAKFLAALPFKLTNAQKRV-IKEILAD----LASPV 282 Query: 98 PMGDFVQ 104 PM +Q Sbjct: 283 PMNRLLQ 289 >gnl|CDD|147559 pfam05434, Tmemb_9, TMEM9. This family contains several eukaryotic transmembrane proteins which are homologous to human transmembrane protein 9. The TMEM9 gene encodes a 183 amino-acid protein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites and three conserved cys-rich domains in the N-terminus, but no known functional domains. The protein is highly conserved between species from Caenorhabditis elegans to man and belongs to a novel family of transmembrane proteins. The exact function of TMEM9 is unknown although it has been found to be widely expressed and localized to the late endosomes and lysosomes. Members of this family contain pfam03128 repeats in their N-terminal region. Length = 149 Score = 29.1 bits (65), Expect = 0.70 Identities = 10/28 (35%), Positives = 18/28 (64%) Query: 9 IWISVVTLISFYMLFLRSMDTMVENHVP 36 I++S++ L+ YMLFL +D ++ V Sbjct: 60 IYLSIIGLLLLYMLFLMLLDPLLRKRVK 87 >gnl|CDD|177025 CHL00093, groEL, chaperonin GroEL. Length = 529 Score = 27.0 bits (60), Expect = 3.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Query: 103 VQIKAFGFDNLRKKIKEDLNSRLGSQFISE 132 V ++A GF + RK + ED+ G Q I+E Sbjct: 274 VAVRAPGFGDRRKAMLEDIAILTGGQVITE 303 >gnl|CDD|31620 COG1431, COG1431, Uncharacterized protein containing piwi/argonaute domain [Translation, ribosomal structure and biogenesis]. Length = 685 Score = 26.5 bits (58), Expect = 4.7 Identities = 17/73 (23%), Positives = 29/73 (39%), Gaps = 2/73 (2%) Query: 67 VKLSFIVNDSQERSYLKEIATDYLYTL-LSGPPMGDFVQIKAFGFDNLRKKIKEDLNSRL 125 ++S IV DS+ + LK +Y S V+ R K+K+DL + Sbjct: 343 NEISPIVTDSELLTRLKSTIKKVVYGFKNSNGIDWK-VEGLTLHVAGKRPKMKDDLTKII 401 Query: 126 GSQFISEVLIDEL 138 + E+ E+ Sbjct: 402 KEIDVEELKKQEM 414 >gnl|CDD|48161 cd03344, GroEL, GroEL_like type I chaperonin. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. The symmetry of type I is seven-fold and they are found in eubacteria (GroEL) and in organelles of eubacterial descent (hsp60 and RBP). With the aid of cochaperonin GroES, GroEL encapsulates non-native substrate proteins inside the cavity of the GroEL-ES complex and promotes folding by using energy derived from ATP hydrolysis.. Length = 520 Score = 26.2 bits (58), Expect = 5.4 Identities = 15/44 (34%), Positives = 24/44 (54%) Query: 103 VQIKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDM 146 +KA GF + RK + ED+ G ISE L +L +++ D+ Sbjct: 271 CAVKAPGFGDRRKAMLEDIAILTGGTVISEELGLKLEDVTLEDL 314 >gnl|CDD|31768 COG1580, FliL, Flagellar basal body-associated protein [Cell motility and secretion]. Length = 159 Score = 26.0 bits (57), Expect = 5.6 Identities = 25/135 (18%), Positives = 52/135 (38%), Gaps = 8/135 (5%) Query: 11 ISVVTLISFYMLFLRSMDTMVENHVPPLAIKNTNIIKSELVSIPSVSNGVLQAYFLVKLS 70 +++ F+ +S D E+ P+ I + E + ++ +G Y + ++ Sbjct: 29 LALAGAGYFFWFGSKSEDAEAESAQTPVEILAYYYLLEEFTT--NLLDGPKDRYVKIAIT 86 Query: 71 FIVNDSQERSYLKE---IATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKEDLNSRLGS 127 V + L+E D L L S + + G + L+ +IK+ +N+ L Sbjct: 87 LEVANKALLEELEEKKPEVRDALLMLFSSKTAAELSTPE--GKEKLKAEIKDRINTILKE 144 Query: 128 -QFISEVLIDELNYL 141 Q + +VL Sbjct: 145 GQVVKDVLFTNFIIQ 159 >gnl|CDD|39210 KOG4007, KOG4007, KOG4007, Uncharacterized conserved protein [Function unknown]. Length = 229 Score = 25.8 bits (56), Expect = 6.2 Identities = 8/23 (34%), Positives = 16/23 (69%) Query: 9 IWISVVTLISFYMLFLRSMDTMV 31 I IS++ ++ YM+FL +D ++ Sbjct: 139 IVISIIGILLLYMVFLMCLDPLL 161 >gnl|CDD|114310 pfam05580, Peptidase_S55, SpoIVB peptidase S55. The protein SpoIVB plays a key role in signalling in the final sigma-K checkpoint of Bacillus subtilis. Length = 219 Score = 25.5 bits (56), Expect = 9.5 Identities = 13/23 (56%), Positives = 15/23 (65%) Query: 37 PLAIKNTNIIKSELVSIPSVSNG 59 L+IKN IIKS + SI SNG Sbjct: 50 ILSIKNGEIIKSSITSIDKGSNG 72 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.138 0.382 Gapped Lambda K H 0.267 0.0668 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,012,568 Number of extensions: 99914 Number of successful extensions: 282 Number of sequences better than 10.0: 1 Number of HSP's gapped: 282 Number of HSP's successfully gapped: 26 Length of query: 176 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 89 Effective length of database: 4,383,754 Effective search space: 390154106 Effective search space used: 390154106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.7 bits)