RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780507|ref|YP_003064920.1| hypothetical protein CLIBASIA_01970 [Candidatus Liberibacter asiaticus str. psy62] (176 letters) >gnl|CDD|183792 PRK12850, groEL, chaperonin GroEL; Reviewed. Length = 544 Score = 30.1 bits (68), Expect = 0.31 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Query: 103 VQIKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDMRSNCLRL 153 V +KA GF + RK + ED+ G Q ISE L +L +++ DM R+ Sbjct: 274 VAVKAPGFGDRRKAMLEDIAVLTGGQVISEDLGIKLENVTL-DMLGRAKRV 323 >gnl|CDD|171770 PRK12851, groEL, chaperonin GroEL; Reviewed. Length = 541 Score = 28.6 bits (64), Expect = 0.94 Identities = 12/30 (40%), Positives = 16/30 (53%) Query: 103 VQIKAFGFDNLRKKIKEDLNSRLGSQFISE 132 +KA GF + RK + ED+ G ISE Sbjct: 274 AAVKAPGFGDRRKAMLEDIAILTGGTVISE 303 >gnl|CDD|77219 PRK09519, recA, DNA recombination protein RecA; Reviewed. Length = 790 Score = 28.1 bits (62), Expect = 1.3 Identities = 21/86 (24%), Positives = 36/86 (41%), Gaps = 6/86 (6%) Query: 95 SGPPMGDFVQIKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDM----RSNC 150 SG P G Q+ G LR+ + L L +F+ ++L +EL Y I ++ R+ Sbjct: 614 SGDPRGGMKQV--LGASRLRRDRVQALADALDDKFLHDMLAEELRYSVIREVLPTRRART 671 Query: 151 LRLGSNASDLMTQKGSLIEKNKEPLK 176 L + +G ++ P K Sbjct: 672 FDLEVEELHTLVAEGVVVHNCSPPFK 697 >gnl|CDD|171771 PRK12852, groEL, chaperonin GroEL; Reviewed. Length = 545 Score = 27.5 bits (61), Expect = 1.8 Identities = 14/30 (46%), Positives = 18/30 (60%) Query: 105 IKAFGFDNLRKKIKEDLNSRLGSQFISEVL 134 +KA GF + RK + ED+ G Q ISE L Sbjct: 276 VKAPGFGDRRKAMLEDIAILTGGQLISEDL 305 >gnl|CDD|115257 pfam06587, DUF1137, Protein of unknown function (DUF1137). This family consists of several hypothetical proteins specific to Chlamydia species. The function of this family is unknown. Length = 159 Score = 27.5 bits (61), Expect = 1.9 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 11/58 (18%) Query: 1 MLKFLFSGIWISVVTLISFY--MLFLRSMD-----TMVENHV---PP-LAIKNTNIIK 47 M KFLF G++ S+V L+ + + +D + + H PP L IK + K Sbjct: 1 MTKFLFHGLFCSLVLLLCACVTAVAIIKVDDICDVSCMNKHFTPAPPFLKIKKLGVRK 58 >gnl|CDD|184933 PRK14969, PRK14969, DNA polymerase III subunits gamma and tau; Provisional. Length = 527 Score = 26.6 bits (59), Expect = 3.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Query: 73 VNDSQERSYLKEIATDYLYTLL 94 VN+S+ R+ L I DYL+ LL Sbjct: 232 VNESEVRAMLGAIDQDYLFALL 253 >gnl|CDD|182715 PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional. Length = 413 Score = 26.6 bits (59), Expect = 3.6 Identities = 11/23 (47%), Positives = 16/23 (69%) Query: 66 LVKLSFIVNDSQERSYLKEIATD 88 L+K S I+ D Q R+ L++IA D Sbjct: 273 LLKPSPIMTDEQARAKLEQIAAD 295 >gnl|CDD|182376 PRK10319, PRK10319, N-acetylmuramoyl-l-alanine amidase I; Provisional. Length = 287 Score = 26.3 bits (58), Expect = 4.6 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 9/28 (32%) Query: 52 SIPSVSNGVLQAYFLVKLSFIVNDSQER 79 SIPSV LV+ SFI N +ER Sbjct: 235 SIPSV---------LVETSFITNPEEER 253 >gnl|CDD|180157 PRK05595, PRK05595, replicative DNA helicase; Provisional. Length = 444 Score = 25.6 bits (56), Expect = 7.3 Identities = 14/42 (33%), Positives = 24/42 (57%) Query: 112 NLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDMRSNCLRL 153 NL K E++ G +++ ID+ +S+++MRS C RL Sbjct: 265 NLEDKDWENIARASGPLAAAKIFIDDTAGVSVMEMRSKCRRL 306 >gnl|CDD|162814 TIGR02348, GroEL, chaperonin GroL. This family consists of GroEL, the larger subunit of the GroEL/GroES cytosolic chaperonin. It is found in bacteria, organelles derived from bacteria, and occasionally in the Archaea. The bacterial GroEL/GroES group I chaperonin is replaced a group II chaperonin, usually called the thermosome in the Archaeota and CCT (chaperone-containing TCP) in the Eukaryota. GroEL, thermosome subunits, and CCT subunits all fall under the scope of Pfam model pfam00118. Length = 524 Score = 25.3 bits (56), Expect = 7.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Query: 103 VQIKAFGFDNLRKKIKEDLNSRLGSQFISE 132 +KA GF + RK + ED+ G Q ISE Sbjct: 272 CAVKAPGFGDRRKAMLEDIAILTGGQVISE 301 >gnl|CDD|163415 TIGR03703, plsB, glycerol-3-phosphate O-acyltransferase. Members of this protein family are PlsB, glycerol-3-phosphate O-acyltransferase, present in E. coli and numerous related species. In many bacteria, PlsB is not found, and appears to be replaced by a two enzyme system for 1-acyl-glycerol-3-phosphate biosynthesis, the PlsX/Y system. Length = 799 Score = 25.3 bits (56), Expect = 9.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Query: 79 RSYLKEIATDYLYTLL 94 YL EIA DY Y+L+ Sbjct: 243 LKYLDEIAADYSYSLI 258 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.138 0.382 Gapped Lambda K H 0.267 0.0761 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,750,437 Number of extensions: 165733 Number of successful extensions: 319 Number of sequences better than 10.0: 1 Number of HSP's gapped: 319 Number of HSP's successfully gapped: 22 Length of query: 176 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 89 Effective length of database: 4,114,577 Effective search space: 366197353 Effective search space used: 366197353 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.5 bits)