RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780507|ref|YP_003064920.1| hypothetical protein CLIBASIA_01970 [Candidatus Liberibacter asiaticus str. psy62] (176 letters) >d1ioka2 c.8.5.1 (A:191-366) GroEL, A domain {Paracoccus denitrificans [TaxId: 266]} Length = 176 Score = 28.9 bits (65), Expect = 0.26 Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 105 IKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDEL 138 +KA GF + RK + +D+ G Q ISE L +L Sbjct: 86 VKAPGFGDRRKAMLQDIAILTGGQVISEDLGMKL 119 >d1dl2a_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 511 Score = 26.2 bits (57), Expect = 1.6 Identities = 8/49 (16%), Positives = 20/49 (40%) Query: 106 KAFGFDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDMRSNCLRLG 154 +G+D N G+Q + +++D ++ L ++ S + Sbjct: 23 HGWGYDVYGPIEHTSHNMPRGNQPLGWIIVDSVDTLMLMYNSSTLYKSE 71 >d1su7a_ e.26.1.2 (A:) Ni-containing carbon monoxide dehydrogenase {Carboxydothermus hydrogenoformans [TaxId: 129958]} Length = 633 Score = 24.0 bits (52), Expect = 7.2 Identities = 8/43 (18%), Positives = 14/43 (32%) Query: 90 LYTLLSGPPMGDFVQIKAFGFDNLRKKIKEDLNSRLGSQFISE 132 + + G P V G + + + + G FI E Sbjct: 566 TWAVTIGLPTHIGVLPPITGSLPVTQILTSSVKDITGGYFIVE 608 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.321 0.138 0.382 Gapped Lambda K H 0.267 0.0442 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 609,970 Number of extensions: 26950 Number of successful extensions: 62 Number of sequences better than 10.0: 1 Number of HSP's gapped: 62 Number of HSP's successfully gapped: 7 Length of query: 176 Length of database: 2,407,596 Length adjustment: 79 Effective length of query: 97 Effective length of database: 1,322,926 Effective search space: 128323822 Effective search space used: 128323822 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.8 bits)