BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780507|ref|YP_003064920.1| hypothetical protein CLIBASIA_01970 [Candidatus Liberibacter asiaticus str. psy62] (176 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780507|ref|YP_003064920.1| hypothetical protein CLIBASIA_01970 [Candidatus Liberibacter asiaticus str. psy62] Length = 176 Score = 355 bits (910), Expect = e-100, Method: Compositional matrix adjust. Identities = 176/176 (100%), Positives = 176/176 (100%) Query: 1 MLKFLFSGIWISVVTLISFYMLFLRSMDTMVENHVPPLAIKNTNIIKSELVSIPSVSNGV 60 MLKFLFSGIWISVVTLISFYMLFLRSMDTMVENHVPPLAIKNTNIIKSELVSIPSVSNGV Sbjct: 1 MLKFLFSGIWISVVTLISFYMLFLRSMDTMVENHVPPLAIKNTNIIKSELVSIPSVSNGV 60 Query: 61 LQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKED 120 LQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKED Sbjct: 61 LQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKED 120 Query: 121 LNSRLGSQFISEVLIDELNYLSIVDMRSNCLRLGSNASDLMTQKGSLIEKNKEPLK 176 LNSRLGSQFISEVLIDELNYLSIVDMRSNCLRLGSNASDLMTQKGSLIEKNKEPLK Sbjct: 121 LNSRLGSQFISEVLIDELNYLSIVDMRSNCLRLGSNASDLMTQKGSLIEKNKEPLK 176 >gi|254780849|ref|YP_003065262.1| chaperonin GroEL [Candidatus Liberibacter asiaticus str. psy62] Length = 551 Score = 26.6 bits (57), Expect = 0.24, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 8/71 (11%) Query: 83 KEIATDYLYTLL-----SGPPMGDFVQIKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDE 137 +++ D L TL+ G P+ + +KA F + RK++ D+ + +G+ ISE + + Sbjct: 252 EDVEGDALATLVVNRVRCGLPV---LAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLK 308 Query: 138 LNYLSIVDMRS 148 L +I D+ S Sbjct: 309 LEKATIADLGS 319 >gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Score = 23.9 bits (50), Expect = 1.8, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 16/29 (55%) Query: 50 LVSIPSVSNGVLQAYFLVKLSFIVNDSQE 78 L IP V+ G Q Y L+ I++ S+E Sbjct: 68 LSKIPKVTGGGAQVYLSQPLAVILSKSEE 96 >gi|254780601|ref|YP_003065014.1| ATP-dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 573 Score = 22.3 bits (46), Expect = 5.0, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 102 FVQIKAFGFDNLRKKIKED 120 FV++ A G D LR+ +K D Sbjct: 510 FVEVSADGVDLLRRTVKLD 528 >gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] Length = 374 Score = 21.9 bits (45), Expect = 7.1, Method: Compositional matrix adjust. Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Query: 25 RSMDTMVENHVPP--LAIKNTNIIKSELVSIPSVSNGV 60 RSM++ ++ + +AIK+ N + E+ IP V+N V Sbjct: 182 RSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219 >gi|254780949|ref|YP_003065362.1| tyrosyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 418 Score = 21.9 bits (45), Expect = 7.4, Method: Compositional matrix adjust. Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Query: 51 VSIPSVSNGVLQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGF 110 +S VS G+ +VK F + ++ R +LK A +++S + QIK F Sbjct: 341 ISKDEVSRGMGLLTLIVKAGFATSTNEARRHLKSNAIKINNSIISNEKL----QIKLQDF 396 Query: 111 DN 112 D+ Sbjct: 397 DS 398 >gi|254781131|ref|YP_003065544.1| hypothetical protein CLIBASIA_05165 [Candidatus Liberibacter asiaticus str. psy62] Length = 150 Score = 21.6 bits (44), Expect = 7.8, Method: Compositional matrix adjust. Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 68 KLSFIVNDSQERSYLKEIATDYLYTLLSGP 97 +L+ +V+D + + +K +A Y Y LS P Sbjct: 69 QLAPLVSDRRMKCNVKPVANLYQYRYLSDP 98 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.138 0.382 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 108,415 Number of Sequences: 1233 Number of extensions: 4144 Number of successful extensions: 12 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 9 length of query: 176 length of database: 328,796 effective HSP length: 68 effective length of query: 108 effective length of database: 244,952 effective search space: 26454816 effective search space used: 26454816 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 35 (18.1 bits)