BLAST/PSIBLAST alignment of GI: 254780508 and GI: 325291973 at iteration 1
>gi|325291973|ref|YP_004277837.1| hypothetical protein AGROH133_04008 [Agrobacterium sp. H13-3] Length = 122
>gi|325059826|gb|ADY63517.1| hypothetical protein AGROH133_04008 [Agrobacterium sp. H13-3] Length = 122
 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 53/107 (49%), Positives = 76/107 (71%), Gaps = 2/107 (1%)

Query: 4   SSDYRIQTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSC--EEISW 61
           S+D+RI++VL R+  +IDNEN N+  + QFD  +SN HK RCL+EL++L      EEI+ 
Sbjct: 5   SNDHRIKSVLGRLEMIIDNENDNIGKDPQFDFKVSNAHKSRCLYELTMLFRDTPHEEIAA 64

Query: 62  DHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTY 108
            HL+Q++ +  KLA N+S +E++L+A R VADL K  +QE D DGTY
Sbjct: 65  GHLDQVQGIKSKLATNASRVEAHLNAVRAVADLLKTAIQEADTDGTY 111