RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780508|ref|YP_003064921.1| hypothetical protein CLIBASIA_01975 [Candidatus Liberibacter asiaticus str. psy62] (123 letters) >gnl|CDD|148175 pfam06413, Neugrin, Neugrin. This family consists of several mouse and human neugrin proteins. Neugrin and m-neugrin are mainly expressed in neurons in the nervous system, and are thought to play an important role in the process of neuronal differentiation. Length = 225 Score = 27.2 bits (60), Expect = 1.0 Identities = 6/14 (42%), Positives = 11/14 (78%) Query: 59 ISWDHLEQIRTLHE 72 ++W+ +EQIR L + Sbjct: 11 LTWEAIEQIRYLKQ 24 >gnl|CDD|180331 PRK05972, ligD, ATP-dependent DNA ligase; Reviewed. Length = 860 Score = 26.8 bits (60), Expect = 1.7 Identities = 12/47 (25%), Positives = 21/47 (44%), Gaps = 8/47 (17%) Query: 59 ISWDHLEQ--------IRTLHEKLALNSSLLESYLDAARVVADLFKK 97 ++W+ L+ IRT+ +LA S Y DA + + K+ Sbjct: 808 LTWEELKALLDPKQWTIRTVPARLAKLSDPWADYADARQSLTAAMKR 854 >gnl|CDD|148155 pfam06378, DUF1071, Protein of unknown function (DUF1071). This family consists of several hypothetical bacterial and phage proteins of unknown function. Length = 162 Score = 26.6 bits (59), Expect = 1.9 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 9/60 (15%) Query: 19 VIDNENKNLKNNSQFDISISNDHKGRCL------HELSVLILSCEEISWDHLEQIRTLHE 72 V+D NK + + FDI N RCL H L + I + E++ D + L E Sbjct: 85 VMDYRNKPIAKPTAFDI---NKSIMRCLVKAIALHGLGLYIYAGEDLPNDEDKDSPKLPE 141 >gnl|CDD|183348 PRK11867, PRK11867, 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed. Length = 286 Score = 26.0 bits (58), Expect = 2.5 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Query: 88 ARVVADLFKKQLQEIDADGTYHDGFC--ESLNPCKT 121 AR D KQL E+ H GF E L PC T Sbjct: 171 ARGF-DSDVKQLTELIKAAINHKGFSFVEILQPCPT 205 >gnl|CDD|178562 PLN02981, PLN02981, glucosamine:fructose-6-phosphate aminotransferase. Length = 680 Score = 25.9 bits (57), Expect = 2.9 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 15/73 (20%) Query: 14 KRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHE----------LSVLILSCEEI---S 60 KRV+ + DNE +LK+ I + KGR LS L + E+I + Sbjct: 255 KRVLVIEDNEVVHLKDGG-VGIYKFENEKGRGGGGLSRPASVERALSTLEMEVEQIMKGN 313 Query: 61 WDHLEQIRTLHEK 73 +DH Q + +HE+ Sbjct: 314 YDHYMQ-KEIHEQ 325 >gnl|CDD|148953 pfam07626, PSD3, Protein of unknown function (DUF1587). A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also match pfam07624. Length = 68 Score = 26.0 bits (58), Expect = 2.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 74 LALNSSLLESYLDAARVVADLF 95 L+++ LLE YL AAR D Sbjct: 42 LSMSPLLLEQYLQAARKALDEA 63 >gnl|CDD|132329 TIGR03286, methan_mark_15, putative methanogenesis marker protein 15. Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. Related proteins include the BadF/BadG/BcrA/BcrD ATPase family (pfam01869), which includes an activator for (R)-2-hydroxyglutaryl-CoA dehydratase. Length = 404 Score = 24.4 bits (53), Expect = 7.7 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 67 IRTLHEKLALNSSLLESYLDAARVVAD-LFKKQLQEID 103 I+ L LA +S + A VA+ ++++QLQEID Sbjct: 317 IQDLVTALAEGASPEDVAAAACHSVAEQVYEQQLQEID 354 >gnl|CDD|183723 PRK12753, PRK12753, transketolase; Reviewed. Length = 663 Score = 24.3 bits (53), Expect = 7.8 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query: 37 ISNDHKGRCLHELSVLILSCEEISWDHLEQIRTLHEK 73 +SN H L+ S+L L+ ++ + L+ R LH K Sbjct: 62 LSNGHASMLLY--SLLHLTGYDLPIEELKNFRQLHSK 96 >gnl|CDD|162902 TIGR02520, pilus_B_mal_scr, type IVB pilus formation outer membrane protein, R64 PilN family. Several related protein families encode outer membrane pore proteins for type II secretion, type III secretion, and type IV pilus formation. This protein family appears to encode a secretin for pilus formation, although it is quite different from PilQ. Members include the PilN lipoprotein of the plasmid R64 thin pilus, a type IV pilus. Scoring between the trusted and noise cutoffs are examples of bundle-forming pilus B (bfpB). Length = 497 Score = 24.5 bits (53), Expect = 8.1 Identities = 8/28 (28%), Positives = 16/28 (57%) Query: 12 VLKRVIAVIDNENKNLKNNSQFDISISN 39 VL RV + ID++N+ L ++ + + Sbjct: 242 VLDRVASYIDSQNRRLTRQVLLNVKVLS 269 >gnl|CDD|182846 PRK10929, PRK10929, putative mechanosensitive channel protein; Provisional. Length = 1109 Score = 24.2 bits (53), Expect = 8.7 Identities = 8/18 (44%), Positives = 14/18 (77%) Query: 88 ARVVADLFKKQLQEIDAD 105 AR+ ++L KK+ Q++DA Sbjct: 206 ARLRSELAKKRSQQLDAY 223 >gnl|CDD|183325 PRK11820, PRK11820, hypothetical protein; Provisional. Length = 288 Score = 24.0 bits (53), Expect = 9.7 Identities = 7/23 (30%), Positives = 12/23 (52%) Query: 73 KLALNSSLLESYLDAARVVADLF 95 +L+LN L + YL+A + Sbjct: 77 ELSLNEDLAKQYLEALEELKAEL 99 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.131 0.374 Gapped Lambda K H 0.267 0.0628 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,874,163 Number of extensions: 103540 Number of successful extensions: 227 Number of sequences better than 10.0: 1 Number of HSP's gapped: 227 Number of HSP's successfully gapped: 24 Length of query: 123 Length of database: 5,994,473 Length adjustment: 82 Effective length of query: 41 Effective length of database: 4,222,617 Effective search space: 173127297 Effective search space used: 173127297 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.6 bits)