RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780508|ref|YP_003064921.1| hypothetical protein
CLIBASIA_01975 [Candidatus Liberibacter asiaticus str. psy62]
         (123 letters)



>d2vgla_ a.118.1.10 (A:) Adaptin alpha C subunit N-terminal fragment
           {Mouse (Mus musculus) [TaxId: 10090]}
          Length = 584

 Score = 26.3 bits (57), Expect = 0.72
 Identities = 19/92 (20%), Positives = 40/92 (43%), Gaps = 10/92 (10%)

Query: 18  AVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEISWDHLEQIR-----TLHE 72
             I+ E  N+++  + D ++    K + + +L  + L   +I + H+E +         E
Sbjct: 23  KRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNRYTE 82

Query: 73  K----LALNSSLLESYLDAARVVADLFKKQLQ 100
           K    L + S L+ S  +  R++ +  K  L 
Sbjct: 83  KQIGYLFI-SVLVNSNSELIRLINNAIKNDLA 113


>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase,
           PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]}
          Length = 447

 Score = 26.1 bits (57), Expect = 0.88
 Identities = 6/36 (16%), Positives = 11/36 (30%), Gaps = 2/36 (5%)

Query: 88  ARVVADLFKKQLQEIDADGTYHDGFC--ESLNPCKT 121
           A V     K+Q  ++  +     G     +   C  
Sbjct: 253 ATVSMGYSKQQFLKVLKEAESFPGPSLVIAYATCIN 288


>d1x7fa1 b.62.1.2 (A:245-361) Outer surface protein, C-terminal
          domain {Bacillus cereus [TaxId: 1396]}
          Length = 117

 Score = 24.3 bits (53), Expect = 2.8
 Identities = 8/49 (16%), Positives = 19/49 (38%), Gaps = 1/49 (2%)

Query: 4  SSDYRIQTVLKRVI-AVIDNENKNLKNNSQFDISISNDHKGRCLHELSV 51
           ++Y +++   R      D   +      +  + I N+  G+   EL +
Sbjct: 31 ITEYMVRSTEVRKKYKDYDFPVRESVLQERGQVVIGNNSFGKYKGELQI 79


>d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse
           (Mus musculus) [TaxId: 10090]}
          Length = 332

 Score = 24.5 bits (53), Expect = 2.9
 Identities = 15/81 (18%), Positives = 31/81 (38%)

Query: 38  SNDHKGRCLHELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKK 97
           S D K   LH L+ L  +         +++  + +   +++  L+  LD  +      ++
Sbjct: 167 SADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVER 226

Query: 98  QLQEIDADGTYHDGFCESLNP 118
            +Q   A     D F E +  
Sbjct: 227 DVQNFPAATDEKDKFVEKMTS 247


>d1j77a_ a.132.1.2 (A:) Heme oxygenase HemO (PigA) {Neisseria
           meningitidis [TaxId: 487]}
          Length = 200

 Score = 24.2 bits (52), Expect = 3.3
 Identities = 8/41 (19%), Positives = 11/41 (26%)

Query: 62  DHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEI 102
            H          L L        +  AR     +K  L+E 
Sbjct: 144 KHWRAFVEHLNALNLTPEAEAEAIQGAREAFAFYKVVLRET 184


>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta
           subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
          Length = 326

 Score = 24.2 bits (51), Expect = 3.6
 Identities = 7/24 (29%), Positives = 12/24 (50%)

Query: 81  LESYLDAARVVADLFKKQLQEIDA 104
           L   + A +V+  L    + EID+
Sbjct: 295 LMENIGAIQVLPKLSSSIVHEIDS 318


>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase
           {Bacillus sp. GL1 [TaxId: 84635]}
          Length = 377

 Score = 23.1 bits (49), Expect = 6.4
 Identities = 7/32 (21%), Positives = 13/32 (40%)

Query: 82  ESYLDAARVVADLFKKQLQEIDADGTYHDGFC 113
           E Y + A      F+++L   +    +  GF 
Sbjct: 61  EQYREGAVRTVASFRERLDRFENLDHHDIGFL 92


>d1m1fa_ b.34.6.2 (A:) Kid toxin protein (ParD) {Plasmid R1, from
           Escherichia coli [TaxId: 2482]}
          Length = 110

 Score = 23.0 bits (49), Expect = 7.0
 Identities = 6/70 (8%), Positives = 20/70 (28%), Gaps = 11/70 (15%)

Query: 35  ISISNDHKGRCLHELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADL 94
           ++   +        +S+  +          +Q RT+  K               + +  +
Sbjct: 45  VTSGGNFARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARG-----------GKRLERV 93

Query: 95  FKKQLQEIDA 104
            +  + E+  
Sbjct: 94  PETIMNEVLG 103


>d1qgoa_ c.92.1.2 (A:) Cobalt chelatase CbiK {Salmonella typhimurium
           [TaxId: 90371]}
          Length = 257

 Score = 23.0 bits (49), Expect = 8.1
 Identities = 5/46 (10%), Positives = 16/46 (34%)

Query: 57  EEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEI 102
            +++ D  +  +       + ++   S L     +  +F   L + 
Sbjct: 209 NDMASDDGDSWKMRFNAAGIPATPWLSGLGENPAIRAMFVAHLHQA 254


>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia
           coli [TaxId: 562]}
          Length = 131

 Score = 22.7 bits (48), Expect = 8.3
 Identities = 6/34 (17%), Positives = 12/34 (35%)

Query: 56  CEEISWDHLEQIRTLHEKLALNSSLLESYLDAAR 89
             E +W   + +  L     +   L+E  +   R
Sbjct: 95  LLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCR 128


>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium
           tuberculosis [TaxId: 1773]}
          Length = 182

 Score = 23.0 bits (48), Expect = 8.4
 Identities = 8/35 (22%), Positives = 12/35 (34%)

Query: 20  IDNENKNLKNNSQFDISISNDHKGRCLHELSVLIL 54
           +D     L     FD  + N        EL  L++
Sbjct: 148 LDTARIELAAQGDFDKVVVNRRLESACAELVSLLV 182


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.316    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0421    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 443,786
Number of extensions: 17443
Number of successful extensions: 64
Number of sequences better than 10.0: 1
Number of HSP's gapped: 64
Number of HSP's successfully gapped: 17
Length of query: 123
Length of database: 2,407,596
Length adjustment: 75
Effective length of query: 48
Effective length of database: 1,377,846
Effective search space: 66136608
Effective search space used: 66136608
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)