BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780509|ref|YP_003064922.1| hypothetical protein CLIBASIA_01980 [Candidatus Liberibacter asiaticus str. psy62] (112 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780509|ref|YP_003064922.1| hypothetical protein CLIBASIA_01980 [Candidatus Liberibacter asiaticus str. psy62] Length = 112 Score = 226 bits (576), Expect = 9e-62, Method: Compositional matrix adjust. Identities = 112/112 (100%), Positives = 112/112 (100%) Query: 1 MQVLPISNISHSQSMGGNLAKISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMF 60 MQVLPISNISHSQSMGGNLAKISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMF Sbjct: 1 MQVLPISNISHSQSMGGNLAKISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMF 60 Query: 61 QYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVKQQRITLDLPEISK 112 QYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVKQQRITLDLPEISK Sbjct: 61 QYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVKQQRITLDLPEISK 112 >gi|254780178|ref|YP_003064591.1| queuine tRNA-ribosyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 378 Score = 20.8 bits (42), Expect = 6.6, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 30/66 (45%), Gaps = 8/66 (12%) Query: 2 QVLPISNISHSQSMG--------GNLAKISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQ 53 QV+ +S + G G+L ++S ++S L D+Q D+ ++P + Sbjct: 98 QVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDK 157 Query: 54 KLQGIM 59 +L+ M Sbjct: 158 ELKRAM 163 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.132 0.363 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,365 Number of Sequences: 1233 Number of extensions: 2425 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 112 length of database: 328,796 effective HSP length: 63 effective length of query: 49 effective length of database: 251,117 effective search space: 12304733 effective search space used: 12304733 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 32 (16.9 bits)