RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780510|ref|YP_003064923.1| hypothetical protein CLIBASIA_01985 [Candidatus Liberibacter asiaticus str. psy62] (137 letters) >gnl|CDD|36194 KOG0976, KOG0976, KOG0976, Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]. Length = 1265 Score = 26.2 bits (57), Expect = 3.0 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 6/95 (6%) Query: 36 KINILREKLKDSINSTALMNPALASHYLKFYHSLSQNDQKMASLQLVQENT--LLSEKIK 93 ++N + + + AL KF L + DQK L QENT +L E ++ Sbjct: 177 ELNEFNMEFQTKLAEANREKKALEEKLEKFKEDLIEKDQKSLELHKDQENTQKVLKEVMQ 236 Query: 94 I----DRLTEMKDETYLLEERQYDDENNNDNIEQR 124 + LT ++ ++EE+ D + + IE++ Sbjct: 237 LSSQKQTLTPLRKTCSMIEEQDMDLQASAKEIEEK 271 >gnl|CDD|143978 pfam00223, PsaA_PsaB, Photosystem I psaA/psaB protein. Length = 682 Score = 26.2 bits (58), Expect = 3.3 Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 110 RQYDDENNNDNIEQRIL 126 R YD E N +N+ R+L Sbjct: 363 RDYDPEANKNNVLDRVL 379 >gnl|CDD|35539 KOG0318, KOG0318, KOG0318, WD40 repeat stress protein/actin interacting protein [Cytoskeleton]. Length = 603 Score = 26.0 bits (57), Expect = 3.3 Identities = 17/95 (17%), Positives = 35/95 (36%), Gaps = 6/95 (6%) Query: 17 CCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALASHYLKFYHSLSQNDQK- 75 + +++ A I +L+++ K S + A+A ++ D K Sbjct: 409 KGLAVLSDGGTAVVACI-SDIVLLQDQTKVSSIPIGYESSAVAVSPDGSEVAVGGQDGKV 467 Query: 76 ----MASLQLVQENTLLSEKIKIDRLTEMKDETYL 106 ++ +L +E LL + I + D YL Sbjct: 468 HVYSLSGDELKEEAKLLEHRAAITDVAYSPDGAYL 502 >gnl|CDD|39129 KOG3926, KOG3926, KOG3926, F-box proteins [Amino acid transport and metabolism]. Length = 332 Score = 24.6 bits (53), Expect = 8.9 Identities = 23/100 (23%), Positives = 40/100 (40%), Gaps = 10/100 (10%) Query: 22 IAESNLAY--TISERKKINILREKLKDSINSTALMNPALASHYLK-FYHSLSQNDQKMAS 78 IA+S L +++ +NIL + + ++ NP L L+ H L Q +QK Sbjct: 106 IAKSQLTSLSGSAQKNLLNILEKVVSKVLDDQ--QNPRLIRDLLQKLEHILCQLNQKCGK 163 Query: 79 LQLVQENTLLSEKIKIDRLTEMKDETYLLEERQYDDENNN 118 LV L E R+ + +L + Q + + Sbjct: 164 SVLVSNINLWKE-----RMETILRWQQVLSQIQITEPDPA 198 >gnl|CDD|30456 COG0107, HisF, Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]. Length = 256 Score = 24.7 bits (54), Expect = 9.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 45 KDSINSTALMNPAL 58 K SINS A+ +P L Sbjct: 99 KVSINSAAVKDPEL 112 >gnl|CDD|58534 cd04365, IlGF_relaxin_like, IlGF_like family, relaxin_like subgroup, specific to vertebrates. Members include a number of active peptides including (pro)relaxin, mammalian Leydig cell-specific insulin-like peptide (gene INSL3), early placenta insulin-like peptide (ELIP; gene INSL4), and insulin-like peptides 5 (INSL5) and 6 (INSL6). Members of this subgroup are widely expressed in testes (INSL3, INSL6), decidua, placenta, prostate, corpus luteum, brain (various relaxins), GI tract, and kidney (INSL5) where they serve a variety of functions in parturition and development. Typically, the active forms of these peptide hormones are composed of two chains (A and B) linked by two disulfide bonds; the arrangement of four cysteines is conserved in the "A" chain: Cys1 is linked by a disulfide bond to Cys3, Cys2 and Cys4 are linked by interchain disulfide bonds to cysteines in the "B" chain. This alignment contains both chains, plus the intervening linker region, arranged as found in the propeptide form. Propeptides are cleaved to yield two separate chains linked covalently by the two disulfide bonds.. Length = 59 Score = 24.5 bits (53), Expect = 9.9 Identities = 6/17 (35%), Positives = 10/17 (58%) Query: 2 RSRKSRALYKIITAQCC 18 SRK R + ++ +CC Sbjct: 30 HSRKKRQFSRGLSEKCC 46 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.128 0.335 Gapped Lambda K H 0.267 0.0520 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,421,379 Number of extensions: 63213 Number of successful extensions: 185 Number of sequences better than 10.0: 1 Number of HSP's gapped: 185 Number of HSP's successfully gapped: 27 Length of query: 137 Length of database: 6,263,737 Length adjustment: 84 Effective length of query: 53 Effective length of database: 4,448,581 Effective search space: 235774793 Effective search space used: 235774793 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.3 bits)