RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780510|ref|YP_003064923.1| hypothetical protein CLIBASIA_01985 [Candidatus Liberibacter asiaticus str. psy62] (137 letters) >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 32.7 bits (73), Expect = 0.026 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 11/31 (35%) Query: 33 ERKKINILREKLK----DSINSTALMNPALA 59 E++ + L+ LK DS A PALA Sbjct: 18 EKQALKKLQASLKLYADDS----A---PALA 41 Score = 25.3 bits (54), Expect = 4.9 Identities = 8/24 (33%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 71 QNDQKM-ASLQLVQENTLLSEKIK 93 Q +K+ ASL+L +++ + IK Sbjct: 20 QALKKLQASLKLYADDSAPALAIK 43 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 31.5 bits (71), Expect = 0.072 Identities = 19/149 (12%), Positives = 43/149 (28%), Gaps = 42/149 (28%) Query: 21 SIAESNLAYTISERKKINILREKLKDSINSTALMNPA--------------LASHYLKFY 66 +++ +L + + + +L++ N L P L +L + Sbjct: 10 TLSHGSLEHVLLVPTASFFIASQLQEQFNKI-LPEPTEGFAADDEPTTPAELVGKFLGYV 68 Query: 67 -HSLSQNDQKMAS--LQLV-QE-----------NTLLSEKIKIDRLTEMKDETYLLEERQ 111 + + L L E + L ++ ++ + T +K + + + Sbjct: 69 SSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTLVKTKELI---KN 125 Query: 112 Y-------DDENNNDNIEQRILFNAVSRK 133 Y D LF AV Sbjct: 126 YITARIMAKR--PFDKKSNSALFRAVGEG 152 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.315 0.128 0.335 Gapped Lambda K H 0.267 0.0617 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,019,970 Number of extensions: 40839 Number of successful extensions: 120 Number of sequences better than 10.0: 1 Number of HSP's gapped: 119 Number of HSP's successfully gapped: 21 Length of query: 137 Length of database: 5,693,230 Length adjustment: 83 Effective length of query: 54 Effective length of database: 3,680,978 Effective search space: 198772812 Effective search space used: 198772812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.7 bits)