BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780511|ref|YP_003064924.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter asiaticus str. psy62] (248 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780511|ref|YP_003064924.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter asiaticus str. psy62] Length = 248 Score = 489 bits (1258), Expect = e-140, Method: Compositional matrix adjust. Identities = 248/248 (100%), Positives = 248/248 (100%) Query: 1 MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60 MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL Sbjct: 1 MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60 Query: 61 QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120 QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA Sbjct: 61 QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120 Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM Sbjct: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180 Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS Sbjct: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240 Query: 241 HSFLYGFF 248 HSFLYGFF Sbjct: 241 HSFLYGFF 248 >gi|254780280|ref|YP_003064693.1| glucokinase [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 23.1 bits (48), Expect = 4.7, Method: Compositional matrix adjust. Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 204 NKLVPQIPIYFISTPYL 220 +L+ QIP Y I+ PY+ Sbjct: 302 KELMRQIPTYVITNPYI 318 >gi|254780494|ref|YP_003064907.1| cation diffusion facilitator family transporter, putative [Candidatus Liberibacter asiaticus str. psy62] Length = 314 Score = 22.3 bits (46), Expect = 8.5, Method: Compositional matrix adjust. Identities = 20/92 (21%), Positives = 40/92 (43%), Gaps = 7/92 (7%) Query: 139 IDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNI 198 I+F V Y+ V S+ + +G ++ + N + I L S + Y++ + Sbjct: 122 INFEKAVIYSCVASFICLMMG-------VYENRCNREIKSDFIALDAKSWIVAGYLLLAV 174 Query: 199 SIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230 I L ++ + Y PY+ + +F+CL Sbjct: 175 VIAFLCAMLLRDSAYDWIIPYVDSMVLMFICL 206 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.334 0.148 0.450 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 155,000 Number of Sequences: 1233 Number of extensions: 6283 Number of successful extensions: 35 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 30 Number of HSP's gapped (non-prelim): 10 length of query: 248 length of database: 328,796 effective HSP length: 72 effective length of query: 176 effective length of database: 240,020 effective search space: 42243520 effective search space used: 42243520 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 37 (18.9 bits)