RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780512|ref|YP_003064925.1| flagellar biosynthesis protein FlhA [Candidatus Liberibacter asiaticus str. psy62] (692 letters) >2obd_A Cholesteryl ester transfer protein; lipid transfer protein, lipid transport; HET: NDG FU4 2OB PCW EPE 1PE PG4; 2.10A {Homo sapiens} (A:282-439) Length = 158 Score = 31.0 bits (70), Expect = 0.48 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Query: 618 VDFNVEPRAVEMFSENATNSIRQYIDKGIPLTIVTLPEIRSYIRMIL 664 +DF + P+ V +E+++ SI+ ++ I T V +PE+ S + ++ Sbjct: 104 LDFQITPKTVSNLTESSSESIQSFLQSMI--TAVGIPEVMSRLEVVF 148 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 30.1 bits (68), Expect = 0.79 Identities = 9/36 (25%), Positives = 16/36 (44%), Gaps = 14/36 (38%) Query: 583 CGDLAPTGILNILKLGNHWDMIFY-----Q-AIQRD 612 D +++I L +++FY Q A+ RD Sbjct: 2 LAD-----VMSIESLV---EVVFYRGMTMQVAVPRD 29 >1jk0_A RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} (A:104-227) Length = 124 Score = 29.5 bits (66), Expect = 1.5 Identities = 11/74 (14%), Positives = 23/74 (31%), Gaps = 2/74 (2%) Query: 503 KDVKNLISRLDPEYQKLAEETCSSHISYSGIQA-VLKLLLAEHVSIRNLPLILESIA-EV 560 KD+ + +R++ + + + GI L + V I Sbjct: 34 KDIHDWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIE 93 Query: 561 APHSRKTSHIVEQV 574 HS S +++ Sbjct: 94 NIHSETYSLLIDTY 107 >1v54_A Cytochrome C oxidase polypeptide I; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} (A:1-89) Length = 89 Score = 27.8 bits (63), Expect = 4.0 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 7/24 (29%) Query: 294 AFFMIVLSVMPNLPAFPFIMLGGF 317 AF MI VMP IM+GGF Sbjct: 62 AFVMIFFMVMP-------IMIGGF 78 >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus HB8} PDB: 2yvz_A (A:56-137) Length = 82 Score = 27.8 bits (62), Expect = 4.1 Identities = 9/39 (23%), Positives = 17/39 (43%) Query: 477 PIDNLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPE 515 P A VL+HLS + + L ++ ++ L + Sbjct: 1 PKAKAAEVLSHLSPEEQAEYLKTLPPWRLREILEELSLD 39 >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} (A:168-250) Length = 83 Score = 27.0 bits (60), Expect = 8.0 Identities = 8/35 (22%), Positives = 16/35 (45%) Query: 619 DFNVEPRAVEMFSENATNSIRQYIDKGIPLTIVTL 653 +P V++ S ++ +S+ G LT V + Sbjct: 34 QNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGM 68 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.324 0.139 0.392 Gapped Lambda K H 0.267 0.0687 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 4,958,127 Number of extensions: 223315 Number of successful extensions: 800 Number of sequences better than 10.0: 1 Number of HSP's gapped: 797 Number of HSP's successfully gapped: 20 Length of query: 692 Length of database: 4,956,049 Length adjustment: 95 Effective length of query: 597 Effective length of database: 1,744,574 Effective search space: 1041510678 Effective search space used: 1041510678 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 58 (26.2 bits)