Query         gi|254780513|ref|YP_003064926.1| hypothetical protein CLIBASIA_02000 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 66
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Wed Jun  1 09:43:22 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780513.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1dqea_ a.39.2.1 (A:) Moth phe  26.3     6.7 0.00049   17.9   0.1   10    8-17     44-53  (137)
  2 d2jpoa1 a.39.2.1 (A:1-142) Mot  26.2      16  0.0012   15.9   2.0   24   10-33    113-136 (142)
  3 d1hc1a2 a.86.1.1 (A:136-398) A  14.7      36  0.0026   14.1   1.7   21   33-53    152-172 (263)
  4 d1llaa2 a.86.1.1 (A:110-379) A  11.7      49  0.0036   13.4   1.7   23   31-53    156-178 (270)
  5 d1lrza2 d.108.1.4 (A:1-165) Me   8.7      61  0.0044   12.9   1.3   28    3-30      2-29  (165)
  6 d1icwa_ d.9.1.1 (A:) Interleuk   6.7      81  0.0059   12.3   1.9   30   16-45     40-69  (69)
  7 d1ooha_ a.39.2.1 (A:) Odorant    6.2      86  0.0063   12.1   1.4   10    8-17     42-51  (126)
  8 d1k8ua_ a.39.1.2 (A:) Calcycli   5.0      77  0.0056   12.4   0.2   48    5-52     26-73  (89)
  9 d2qtva2 b.2.8.1 (A:2-44,A:391-   3.8 1.3E+02  0.0093   11.2   0.9   13   45-59    102-114 (176)
 10 d1mgsa_ d.9.1.1 (A:) Melanoma    3.3 1.4E+02   0.011   10.9   1.1   30   16-45     44-73  (73)

No 1  
>d1dqea_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Silk moth (Bombyx mori) [TaxId: 7091]}
Probab=26.31  E-value=6.7  Score=17.94  Aligned_cols=10  Identities=20%  Similarity=0.497  Sum_probs=5.9

Q ss_pred             CHHHHHHHHH
Q ss_conf             7688899985
Q gi|254780513|r    8 NTKEFKCFLK   17 (66)
Q Consensus         8 ntkefkcflk   17 (66)
                      .+.+.|||+.
T Consensus        44 ~d~~~kC~~~   53 (137)
T d1dqea_          44 KNRETGCAIM   53 (137)
T ss_dssp             CCHHHHHHHH
T ss_pred             CCCCCCCEEE
T ss_conf             7867686503


No 2  
>d2jpoa1 a.39.2.1 (A:1-142) Moth pheromone-binding protein, PBP {Polyphemus moth (Antheraea polyphemus) [TaxId: 7120]}
Probab=26.25  E-value=16  Score=15.91  Aligned_cols=24  Identities=29%  Similarity=0.415  Sum_probs=14.1

Q ss_pred             HHHHHHHHHCCCCCCCHHHHHHHH
Q ss_conf             888999852110126702778999
Q gi|254780513|r   10 KEFKCFLKNSRKKHITPSKDVVAK   33 (66)
Q Consensus        10 kefkcflknsrkkhitpskdvvak   33 (66)
                      .-++||.+..++--|.||-|++-.
T Consensus       113 ~~~~C~~~~~~elg~ap~~~~~~~  136 (142)
T d2jpoa1         113 DVAMCFKKEIHKLNWVPNMDLVIG  136 (142)
T ss_dssp             HHHHHHHHHHHHHSSCCCHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCHHHHHH
T ss_conf             999999999998289983899999


No 3  
>d1hc1a2 a.86.1.1 (A:136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
Probab=14.70  E-value=36  Score=14.11  Aligned_cols=21  Identities=24%  Similarity=0.347  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHCCCCEEEE
Q ss_conf             999989999972003000376
Q gi|254780513|r   33 KSIKKYEDRIRSSIDKKTFLT   53 (66)
Q Consensus        33 ksikkyedrirssidkktflt   53 (66)
                      .-++.||+||+..||.--+.+
T Consensus       152 ~~~~~~e~Ri~daId~G~~~~  172 (263)
T d1hc1a2         152 HDLEITESRIHEAIDHGYITD  172 (263)
T ss_dssp             HHHHHHHHHHHHHHHHSEEEC
T ss_pred             HHHHHHHHHHHHHHHCCCEEC
T ss_conf             999999999999998096888


No 4  
>d1llaa2 a.86.1.1 (A:110-379) Arthropod hemocyanin {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
Probab=11.68  E-value=49  Score=13.39  Aligned_cols=23  Identities=17%  Similarity=0.247  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             99999989999972003000376
Q gi|254780513|r   31 VAKSIKKYEDRIRSSIDKKTFLT   53 (66)
Q Consensus        31 vaksikkyedrirssidkktflt   53 (66)
                      --.-++.+|+||+..||..-+.+
T Consensus       156 ~~~~~~~~e~Ri~daId~G~~~~  178 (270)
T d1llaa2         156 EISEMVRMRERILDSIHLGYVIS  178 (270)
T ss_dssp             CHHHHHHHHHHHHHHHHHTEEEC
T ss_pred             CHHHHHHHHHHHHHHHHCCCEEC
T ss_conf             29999999999999998298777


No 5  
>d1lrza2 d.108.1.4 (A:1-165) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]}
Probab=8.69  E-value=61  Score=12.92  Aligned_cols=28  Identities=29%  Similarity=0.411  Sum_probs=23.4

Q ss_pred             HHHHCCHHHHHHHHHHCCCCCCCHHHHH
Q ss_conf             1443176888999852110126702778
Q gi|254780513|r    3 KLDELNTKEFKCFLKNSRKKHITPSKDV   30 (66)
Q Consensus         3 kldelntkefkcflknsrkkhitpskdv   30 (66)
                      ++.+++.+||.-|.+++...|+.-|-.-
T Consensus         2 ~f~~it~~e~d~f~~~~~~~~~lQs~~w   29 (165)
T d1lrza2           2 KFTNLTAKEFGAFTDSMPYSHFTQTVGH   29 (165)
T ss_dssp             EEEECCHHHHHHHHHTSTTCCTTSSHHH
T ss_pred             CCEECCHHHHHHHHHHCCCCCCCCCHHH
T ss_conf             6656899999999981999990208899


No 6  
>d1icwa_ d.9.1.1 (A:) Interleukin-8, IL-8 {Human (Homo sapiens) [TaxId: 9606]}
Probab=6.70  E-value=81  Score=12.27  Aligned_cols=30  Identities=23%  Similarity=0.485  Sum_probs=24.0

Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             852110126702778999999899999720
Q gi|254780513|r   16 LKNSRKKHITPSKDVVAKSIKKYEDRIRSS   45 (66)
Q Consensus        16 lknsrkkhitpskdvvaksikkyedrirss   45 (66)
                      +|+.++--..|...-|.+-|++...+-++|
T Consensus        40 tk~g~~vC~dP~~~WVk~~i~~l~~k~~~~   69 (69)
T d1icwa_          40 LSDGRELALDPKENWVQRVVEKFLKRAENS   69 (69)
T ss_dssp             ETTSCEEEECTTSHHHHHHHHHHHHHHTTC
T ss_pred             ECCCCEEECCCCHHHHHHHHHHHHHHCCCC
T ss_conf             728978976988079999999998641489


No 7  
>d1ooha_ a.39.2.1 (A:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
Probab=6.23  E-value=86  Score=12.12  Aligned_cols=10  Identities=20%  Similarity=0.796  Sum_probs=5.9

Q ss_pred             CHHHHHHHHH
Q ss_conf             7688899985
Q gi|254780513|r    8 NTKEFKCFLK   17 (66)
Q Consensus         8 ntkefkcflk   17 (66)
                      +..+.|||+.
T Consensus        42 ~d~~~kC~~~   51 (126)
T d1ooha_          42 PSQDLMCYTK   51 (126)
T ss_dssp             CCHHHHHHHH
T ss_pred             CCCCCCCHHH
T ss_conf             7801087999


No 8  
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}
Probab=4.97  E-value=77  Score=12.37  Aligned_cols=48  Identities=10%  Similarity=0.223  Sum_probs=26.4

Q ss_pred             HHCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             431768889998521101267027789999998999997200300037
Q gi|254780513|r    5 DELNTKEFKCFLKNSRKKHITPSKDVVAKSIKKYEDRIRSSIDKKTFL   52 (66)
Q Consensus         5 delntkefkcflknsrkkhitpskdvvaksikkyedrirssidkktfl   52 (66)
                      +.|+..||+-.+++...-...++.+.+.+-++.....--..||=.-|+
T Consensus        26 ~~ls~~Elk~Ll~~e~~~~~~~~~~~~~~~~~~lD~d~Dg~IdF~EF~   73 (89)
T d1k8ua_          26 HTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYV   73 (89)
T ss_dssp             TEEEHHHHHHHHHHHSCCGGGTTSHHHHHHHHHHHHTTTCEEEHHHHH
T ss_pred             CEECHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCHHHHH
T ss_conf             843699999999998875423879999999998669999979699999


No 9  
>d2qtva2 b.2.8.1 (A:2-44,A:391-523) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=3.83  E-value=1.3e+02  Score=11.20  Aligned_cols=13  Identities=23%  Similarity=0.613  Sum_probs=7.8

Q ss_pred             HCCCCEEEEEEEEEE
Q ss_conf             003000376654350
Q gi|254780513|r   45 SIDKKTFLTLSVYFE   59 (66)
Q Consensus        45 sidkktfltlsvyfe   59 (66)
                      ++|..|  |+.+|||
T Consensus       102 ~ldp~T--T~a~yFe  114 (176)
T d2qtva2         102 SLSPYH--SYAIFFE  114 (176)
T ss_dssp             EECTTC--CEEEEEE
T ss_pred             CCCCCC--EEEEEEE
T ss_conf             528998--8999999


No 10 
>d1mgsa_ d.9.1.1 (A:) Melanoma growth stimulating activity (MGSA) {Human (Homo sapiens) [TaxId: 9606]}
Probab=3.29  E-value=1.4e+02  Score=10.92  Aligned_cols=30  Identities=37%  Similarity=0.511  Sum_probs=21.2

Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             852110126702778999999899999720
Q gi|254780513|r   16 LKNSRKKHITPSKDVVAKSIKKYEDRIRSS   45 (66)
Q Consensus        16 lknsrkkhitpskdvvaksikkyedrirss   45 (66)
                      +|+.++--..|...-|.+-|++...+-++|
T Consensus        44 tk~g~~iC~dP~~~WVkk~i~~l~~~~~~~   73 (73)
T d1mgsa_          44 LKNGRKACLNPASPIVKKIIEKMLNSDKSN   73 (73)
T ss_dssp             ETTSCEEEECTTSHHHHHHHHHHHHHTSCC
T ss_pred             EECCCEEECCCCHHHHHHHHHHHHHCCCCC
T ss_conf             807988978988089999999998504699


Done!