BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780513|ref|YP_003064926.1| hypothetical protein CLIBASIA_02000 [Candidatus Liberibacter asiaticus str. psy62] (66 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254780513|ref|YP_003064926.1| hypothetical protein CLIBASIA_02000 [Candidatus Liberibacter asiaticus str. psy62] gi|254040190|gb|ACT56986.1| hypothetical protein CLIBASIA_02000 [Candidatus Liberibacter asiaticus str. psy62] Length = 66 Score = 107 bits (266), Expect = 6e-22, Method: Composition-based stats. Identities = 66/66 (100%), Positives = 66/66 (100%) Query: 1 MDKLDELNTKEFKCFLKNSRKKHITPSKDVVAKSIKKYEDRIRSSIDKKTFLTLSVYFEN 60 MDKLDELNTKEFKCFLKNSRKKHITPSKDVVAKSIKKYEDRIRSSIDKKTFLTLSVYFEN Sbjct: 1 MDKLDELNTKEFKCFLKNSRKKHITPSKDVVAKSIKKYEDRIRSSIDKKTFLTLSVYFEN 60 Query: 61 HLIRIF 66 HLIRIF Sbjct: 61 HLIRIF 66 >gi|126700355|ref|YP_001089252.1| putative histidyl-tRNA synthetase [Clostridium difficile 630] gi|254976335|ref|ZP_05272807.1| putative histidyl-tRNA synthetase [Clostridium difficile QCD-66c26] gi|255093720|ref|ZP_05323198.1| putative histidyl-tRNA synthetase [Clostridium difficile CIP 107932] gi|255101911|ref|ZP_05330888.1| putative histidyl-tRNA synthetase [Clostridium difficile QCD-63q42] gi|255307780|ref|ZP_05351951.1| putative histidyl-tRNA synthetase [Clostridium difficile ATCC 43255] gi|255315472|ref|ZP_05357055.1| putative histidyl-tRNA synthetase [Clostridium difficile QCD-76w55] gi|255518135|ref|ZP_05385811.1| putative histidyl-tRNA synthetase [Clostridium difficile QCD-97b34] gi|255651251|ref|ZP_05398153.1| putative histidyl-tRNA synthetase [Clostridium difficile QCD-37x79] gi|255656727|ref|ZP_05402136.1| putative histidyl-tRNA synthetase [Clostridium difficile QCD-23m63] gi|260684315|ref|YP_003215600.1| putative histidyl-tRNA synthetase [Clostridium difficile CD196] gi|260687974|ref|YP_003219108.1| putative histidyl-tRNA synthetase [Clostridium difficile R20291] gi|296452446|ref|ZP_06894147.1| histidine--tRNA ligase [Clostridium difficile NAP08] gi|296877795|ref|ZP_06901821.1| histidine--tRNA ligase [Clostridium difficile NAP07] gi|306521095|ref|ZP_07407442.1| histidyl-tRNA synthetase [Clostridium difficile QCD-32g58] gi|122973671|sp|Q183H5|SYH_CLOD6 RecName: Full=Histidyl-tRNA synthetase; AltName: Full=Histidine--tRNA ligase; Short=HisRS gi|115251792|emb|CAJ69627.1| Histidyl-tRNA synthetase (Histidine--tRNA ligase) (HisRS) [Clostridium difficile] gi|260210478|emb|CBA64951.1| putative histidyl-tRNA synthetase [Clostridium difficile CD196] gi|260213991|emb|CBE06103.1| putative histidyl-tRNA synthetase [Clostridium difficile R20291] gi|296258776|gb|EFH05670.1| histidine--tRNA ligase [Clostridium difficile NAP08] gi|296431246|gb|EFH17067.1| histidine--tRNA ligase [Clostridium difficile NAP07] Length = 420 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Query: 5 DELNTKEFKCFLKNSRKKHITPSKDVVAKSIK---KYEDRIRS 44 +E NT+ FK LK+ R+ HI+ KD + +S+K KY D+I S Sbjct: 337 EEANTRSFK-LLKDLRQNHISADKDHIERSVKAQFKYSDKINS 378 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.321 0.136 0.377 Lambda K H 0.267 0.0450 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 720,052,954 Number of Sequences: 14124377 Number of extensions: 26061352 Number of successful extensions: 75363 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 75362 Number of HSP's gapped (non-prelim): 2 length of query: 66 length of database: 4,842,793,630 effective HSP length: 38 effective length of query: 28 effective length of database: 4,306,067,304 effective search space: 120569884512 effective search space used: 120569884512 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 76 (33.7 bits)