RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780513|ref|YP_003064926.1| hypothetical protein CLIBASIA_02000 [Candidatus Liberibacter asiaticus str. psy62] (66 letters) >gnl|CDD|180799 PRK07028, PRK07028, bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated. Length = 430 Score = 25.8 bits (57), Expect = 2.6 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Query: 32 AKSIKKYEDRIRSSIDKKTFLTLS 55 A +KK EDRIR I + TLS Sbjct: 397 ALEVKKTEDRIREEIRRGR--TLS 418 >gnl|CDD|148132 pfam06333, Med13_C, Mediator complex subunit 13 C-terminal. Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Med13 is part of the ancillary kinase module, together with Med12, CDK8 and CycC, which in yeast is implicated in transcriptional repression, though most of this activity is likely attributable to the CDK8 kinase. The large Med12 and Med13 proteins are required for specific developmental processes in Drosophila, zebrafish, and Caenorhabditis elegans but their biochemical functions are not understood. Length = 408 Score = 25.8 bits (57), Expect = 2.9 Identities = 13/51 (25%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Query: 12 FKCFLKNSRKKHITPSKDVVAK-----SIKKYEDRIRSSIDKKTFLTLSVY 57 F+C+ K K P ++V + I + S D+ L L VY Sbjct: 25 FRCYAKMLEAKPKLPLSELVLQIIPLDFIASPTSLVVPSQDEYLSLALEVY 75 >gnl|CDD|148590 pfam07065, D123, D123. This family contains a number of eukaryotic D123 proteins approximately 330 residues long. It has been shown that mutated variants of D123 exhibit temperature-dependent differences in their degradation rate. D123 proteins are regulators of eIF2, the central regulator of translational initiation. Length = 297 Score = 25.4 bits (56), Expect = 3.3 Identities = 12/56 (21%), Positives = 27/56 (48%), Gaps = 8/56 (14%) Query: 11 EFKCFLKNSRKKHITPSKDVVAKSIKKYEDRIRSSIDKKTFLTLSVYFENHLIRIF 66 EF+CF+KN++ I+ + + + ++ I+ +I +FE ++ F Sbjct: 163 EFRCFVKNNKLVGISQRDLNYYEYLAELKEDIKDAIQ--------EFFEEKILPHF 210 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.136 0.377 Gapped Lambda K H 0.267 0.0642 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 988,895 Number of extensions: 46479 Number of successful extensions: 113 Number of sequences better than 10.0: 1 Number of HSP's gapped: 113 Number of HSP's successfully gapped: 11 Length of query: 66 Length of database: 5,994,473 Length adjustment: 37 Effective length of query: 29 Effective length of database: 5,194,977 Effective search space: 150654333 Effective search space used: 150654333 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.2 bits)