BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780513|ref|YP_003064926.1| hypothetical protein
CLIBASIA_02000 [Candidatus Liberibacter asiaticus str. psy62]
         (66 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780513|ref|YP_003064926.1| hypothetical protein CLIBASIA_02000 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 66

 Score =  131 bits (330), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 66/66 (100%), Positives = 66/66 (100%)

Query: 1  MDKLDELNTKEFKCFLKNSRKKHITPSKDVVAKSIKKYEDRIRSSIDKKTFLTLSVYFEN 60
          MDKLDELNTKEFKCFLKNSRKKHITPSKDVVAKSIKKYEDRIRSSIDKKTFLTLSVYFEN
Sbjct: 1  MDKLDELNTKEFKCFLKNSRKKHITPSKDVVAKSIKKYEDRIRSSIDKKTFLTLSVYFEN 60

Query: 61 HLIRIF 66
          HLIRIF
Sbjct: 61 HLIRIF 66


>gi|254780293|ref|YP_003064706.1| 30S ribosomal protein S9 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 170

 Score = 20.4 bits (41), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 14/23 (60%)

Query: 31  VAKSIKKYEDRIRSSIDKKTFLT 53
           VAK++  ++  +R  I K  FLT
Sbjct: 123 VAKALTYFQPDLRPQIKKGGFLT 145


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.321    0.136    0.377 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 41,317
Number of Sequences: 1233
Number of extensions: 1251
Number of successful extensions: 3
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of query: 66
length of database: 328,796
effective HSP length: 37
effective length of query: 29
effective length of database: 283,175
effective search space:  8212075
effective search space used:  8212075
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)
S2: 31 (16.5 bits)