BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780514|ref|YP_003064927.1| type II restriction endonuclease [Candidatus Liberibacter asiaticus str. psy62] (110 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780514|ref|YP_003064927.1| type II restriction endonuclease [Candidatus Liberibacter asiaticus str. psy62] gi|254040191|gb|ACT56987.1| type II restriction endonuclease [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Score = 224 bits (572), Expect = 2e-57, Method: Compositional matrix adjust. Identities = 110/110 (100%), Positives = 110/110 (100%) Query: 1 MQFNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLY 60 MQFNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLY Sbjct: 1 MQFNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLY 60 Query: 61 EWVLSNTQSRRSRDGQEFEYIIYSLYNINTFVTHLMHKKKSGKALSLSIM 110 EWVLSNTQSRRSRDGQEFEYIIYSLYNINTFVTHLMHKKKSGKALSLSIM Sbjct: 61 EWVLSNTQSRRSRDGQEFEYIIYSLYNINTFVTHLMHKKKSGKALSLSIM 110 >gi|319407457|emb|CBI81107.1| putative type II restriction endonuclease [Bartonella sp. 1-1C] Length = 302 Score = 90.1 bits (222), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 45/85 (52%), Positives = 54/85 (63%) Query: 3 FNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLYEW 62 FN IL IS +E+PK +I+ELS +LF L + F+ L FG Y KI PY+Y Sbjct: 84 FNSAILMEISQQFEMPKRVISELSLKLFQLNVCDSQKFNEQLVNCFGQYAEKIIPYIYAL 143 Query: 63 VLSNTQSRRSRDGQEFEYIIYSLYN 87 LSNTQSRRSR G+ FE IIY LYN Sbjct: 144 CLSNTQSRRSRAGKTFEDIIYFLYN 168 >gi|150026186|ref|YP_001297012.1| type II restriction endonuclease [Flavobacterium psychrophilum JIP02/86] gi|149772727|emb|CAL44210.1| Probable type II restriction endonuclease [Flavobacterium psychrophilum JIP02/86] Length = 298 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 2/84 (2%) Query: 3 FNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLYEW 62 FN I+++++ E PK ++ L + N+ T+ + G+Y ++ PY+Y Sbjct: 81 FNAILMRDLHKLLETPKDILEVLLNK--NITDKKGEELIETVKEICGEYAGRVFPYIYRL 138 Query: 63 VLSNTQSRRSRDGQEFEYIIYSLY 86 LSNTQSRRSR G+ FE IIY +Y Sbjct: 139 SLSNTQSRRSRAGKSFEAIIYKIY 162 >gi|283471714|emb|CAQ50925.1| type II restriction enzyme SsoII (Endonuclease SsoII)(R.SsoII) [Staphylococcus aureus subsp. aureus ST398] Length = 306 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 2/66 (3%) Query: 19 KMLITELSTELFN--LKTANQNFFHNTLTKKFGDYMSKITPYLYEWVLSNTQSRRSRDGQ 76 K + E S +L++ L ++N+ + T+ + + SK T +Y LSNTQSRRSR G+ Sbjct: 64 KKIEKEFSKKLYSHLLDQDSENYKNMTVKEGIEKFTSKHTDEIYALQLSNTQSRRSRAGK 123 Query: 77 EFEYII 82 EFE II Sbjct: 124 EFESII 129 >gi|119026300|ref|YP_910145.1| restriction endonuclease RKpn2kI [Bifidobacterium adolescentis ATCC 15703] gi|118765884|dbj|BAF40063.1| restriction endonuclease RKpn2kI [Bifidobacterium adolescentis ATCC 15703] Length = 300 Score = 41.6 bits (96), Expect = 0.039, Method: Compositional matrix adjust. Identities = 19/32 (59%), Positives = 24/32 (75%) Query: 51 YMSKITPYLYEWVLSNTQSRRSRDGQEFEYII 82 ++S ++YE LSNTQSRRSR G+EFE II Sbjct: 95 FVSDYPQHIYELTLSNTQSRRSRAGKEFEAII 126 >gi|1657419|gb|AAC45970.1| truncated restrictase R.SenPI [Salmonella enterica subsp. enterica serovar Enteritidis] Length = 264 Score = 38.5 bits (88), Expect = 0.30, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 24/33 (72%) Query: 50 DYMSKITPYLYEWVLSNTQSRRSRDGQEFEYII 82 D+ + ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 96 DFTMEYPTHIYDLALSNTQSRRSRAGKEFESIL 128 >gi|323974124|gb|EGB69258.1| EcoRII [Escherichia coli TW10509] Length = 305 Score = 38.1 bits (87), Expect = 0.35, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 24/33 (72%) Query: 50 DYMSKITPYLYEWVLSNTQSRRSRDGQEFEYII 82 D+ + ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 96 DFTMEYPTHIYDLALSNTQSRRSRAGKEFESIL 128 >gi|32470130|ref|NP_863574.1| restriction endonuclease RKpn2kI [Klebsiella pneumoniae] gi|464833|sp|P34880|T2S2_SHISO RecName: Full=Type-2 restriction enzyme SsoII; Short=R.SsoII; AltName: Full=Endonuclease SsoII; AltName: Full=Type II restriction enzyme SsoII gi|11559817|gb|AAG38100.1|AF300473_1 restriction endonuclease RKpn2kI [Klebsiella pneumoniae] gi|294245|gb|AAA98280.1| restriction endonuclease [Plasmid P4] gi|323968853|gb|EGB64189.1| EcoRII [Escherichia coli TA007] Length = 305 Score = 38.1 bits (87), Expect = 0.36, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 24/33 (72%) Query: 50 DYMSKITPYLYEWVLSNTQSRRSRDGQEFEYII 82 D+ + ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 96 DFTMEYPTHIYDLALSNTQSRRSRAGKEFESIL 128 >gi|3421012|emb|CAA76527.1| R.Ecl18kI (restriction endonuclease) [Enterobacter cloacae] Length = 305 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 24/33 (72%) Query: 50 DYMSKITPYLYEWVLSNTQSRRSRDGQEFEYII 82 D+ + ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 96 DFTMEYPTHIYDLALSNTQSRRSRAGKEFESIL 128 >gi|1871452|dbj|BAA11168.1| restriction endonuclease [Salmonella enterica subsp. enterica serovar Typhi] Length = 318 Score = 38.1 bits (87), Expect = 0.38, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 24/33 (72%) Query: 50 DYMSKITPYLYEWVLSNTQSRRSRDGQEFEYII 82 D+ + ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 109 DFTMEYPTHIYDLALSNTQSRRSRAGKEFESIL 141 >gi|110590214|pdb|2GB7|A Chain A, Metal-Depleted Ecl18ki In Complex With Uncleaved, Modified Dna gi|110590215|pdb|2GB7|B Chain B, Metal-Depleted Ecl18ki In Complex With Uncleaved, Modified Dna gi|110590216|pdb|2GB7|C Chain C, Metal-Depleted Ecl18ki In Complex With Uncleaved, Modified Dna gi|110590217|pdb|2GB7|D Chain D, Metal-Depleted Ecl18ki In Complex With Uncleaved, Modified Dna gi|110591455|pdb|2FQZ|A Chain A, Metal-Depleted Ecl18ki In Complex With Uncleaved Dna gi|110591456|pdb|2FQZ|B Chain B, Metal-Depleted Ecl18ki In Complex With Uncleaved Dna gi|110591457|pdb|2FQZ|C Chain C, Metal-Depleted Ecl18ki In Complex With Uncleaved Dna gi|110591458|pdb|2FQZ|D Chain D, Metal-Depleted Ecl18ki In Complex With Uncleaved Dna Length = 305 Score = 38.1 bits (87), Expect = 0.39, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 24/33 (72%) Query: 50 DYMSKITPYLYEWVLSNTQSRRSRDGQEFEYII 82 D+ + ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 96 DFTMEYPTHIYDLALSNTQSRRSRAGKEFESIL 128 >gi|319893524|ref|YP_004150399.1| restriction endonuclease [Staphylococcus pseudintermedius HKU10-03] gi|317163220|gb|ADV06763.1| restriction endonuclease [Staphylococcus pseudintermedius HKU10-03] Length = 298 Score = 37.4 bits (85), Expect = 0.60, Method: Compositional matrix adjust. Identities = 17/32 (53%), Positives = 22/32 (68%) Query: 51 YMSKITPYLYEWVLSNTQSRRSRDGQEFEYII 82 ++ ++Y LSNTQSRRSR G+EFE II Sbjct: 94 FVENFPDHIYRLSLSNTQSRRSRAGKEFEIII 125 >gi|255941182|ref|XP_002561360.1| Pc16g10500 [Penicillium chrysogenum Wisconsin 54-1255] gi|211585983|emb|CAP93720.1| Pc16g10500 [Penicillium chrysogenum Wisconsin 54-1255] Length = 2162 Score = 35.4 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 29/90 (32%), Positives = 39/90 (43%), Gaps = 13/90 (14%) Query: 18 PKMLITELSTEL---FNLKTANQNFFHNT-LTKKFGDYMSKITPYLYEWVLSNTQSRRSR 73 PK LI L T + NL+ AN F + T DY S +T + R R Sbjct: 2052 PKALILNLGTSMAAGLNLQCANHVIFLSPYFTTSHHDYDSGMTQAI---------GRARR 2102 Query: 74 DGQEFEYIIYSLYNINTFVTHLMHKKKSGK 103 GQE E +Y L NT+ ++ K +S K Sbjct: 2103 FGQEREVYVYHLLVKNTYDVNIFQKAQSSK 2132 Searching..................................................done Results from round 2 >gi|254780514|ref|YP_003064927.1| type II restriction endonuclease [Candidatus Liberibacter asiaticus str. psy62] gi|254040191|gb|ACT56987.1| type II restriction endonuclease [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Score = 159 bits (401), Expect = 2e-37, Method: Composition-based stats. Identities = 110/110 (100%), Positives = 110/110 (100%) Query: 1 MQFNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLY 60 MQFNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLY Sbjct: 1 MQFNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLY 60 Query: 61 EWVLSNTQSRRSRDGQEFEYIIYSLYNINTFVTHLMHKKKSGKALSLSIM 110 EWVLSNTQSRRSRDGQEFEYIIYSLYNINTFVTHLMHKKKSGKALSLSIM Sbjct: 61 EWVLSNTQSRRSRDGQEFEYIIYSLYNINTFVTHLMHKKKSGKALSLSIM 110 >gi|319407457|emb|CBI81107.1| putative type II restriction endonuclease [Bartonella sp. 1-1C] Length = 302 Score = 129 bits (323), Expect = 2e-28, Method: Composition-based stats. Identities = 45/85 (52%), Positives = 54/85 (63%) Query: 3 FNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLYEW 62 FN IL IS +E+PK +I+ELS +LF L + F+ L FG Y KI PY+Y Sbjct: 84 FNSAILMEISQQFEMPKRVISELSLKLFQLNVCDSQKFNEQLVNCFGQYAEKIIPYIYAL 143 Query: 63 VLSNTQSRRSRDGQEFEYIIYSLYN 87 LSNTQSRRSR G+ FE IIY LYN Sbjct: 144 CLSNTQSRRSRAGKTFEDIIYFLYN 168 >gi|150026186|ref|YP_001297012.1| type II restriction endonuclease [Flavobacterium psychrophilum JIP02/86] gi|149772727|emb|CAL44210.1| Probable type II restriction endonuclease [Flavobacterium psychrophilum JIP02/86] Length = 298 Score = 115 bits (288), Expect = 2e-24, Method: Composition-based stats. Identities = 31/86 (36%), Positives = 49/86 (56%), Gaps = 2/86 (2%) Query: 1 MQFNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLY 60 + FN I+++++ E PK ++ L + N+ T+ + G+Y ++ PY+Y Sbjct: 79 VNFNAILMRDLHKLLETPKDILEVLLNK--NITDKKGEELIETVKEICGEYAGRVFPYIY 136 Query: 61 EWVLSNTQSRRSRDGQEFEYIIYSLY 86 LSNTQSRRSR G+ FE IIY +Y Sbjct: 137 RLSLSNTQSRRSRAGKSFEAIIYKIY 162 >gi|119026300|ref|YP_910145.1| restriction endonuclease RKpn2kI [Bifidobacterium adolescentis ATCC 15703] gi|118765884|dbj|BAF40063.1| restriction endonuclease RKpn2kI [Bifidobacterium adolescentis ATCC 15703] Length = 300 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Query: 36 NQNFFHNTLTKKFGDYMSKITPYLYEWVLSNTQSRRSRDGQEFEYII 82 + + K DY ++YE LSNTQSRRSR G+EFE II Sbjct: 84 KGMEAVDAIKKFVSDYPQ----HIYELTLSNTQSRRSRAGKEFEAII 126 >gi|283471714|emb|CAQ50925.1| type II restriction enzyme SsoII (Endonuclease SsoII)(R.SsoII) [Staphylococcus aureus subsp. aureus ST398] Length = 306 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 3/81 (3%) Query: 5 EIILKNISNNYEVP-KMLITELSTELF-NLKTANQNFFHN-TLTKKFGDYMSKITPYLYE 61 II+ + N + K + E S +L+ +L + + N T+ + + SK T +Y Sbjct: 49 SIIIDELRNQSWIEFKKIEKEFSKKLYSHLLDQDSENYKNMTVKEGIEKFTSKHTDEIYA 108 Query: 62 WVLSNTQSRRSRDGQEFEYII 82 LSNTQSRRSR G+EFE II Sbjct: 109 LQLSNTQSRRSRAGKEFESII 129 >gi|319893524|ref|YP_004150399.1| restriction endonuclease [Staphylococcus pseudintermedius HKU10-03] gi|317163220|gb|ADV06763.1| restriction endonuclease [Staphylococcus pseudintermedius HKU10-03] Length = 298 Score = 42.7 bits (99), Expect = 0.015, Method: Composition-based stats. Identities = 23/71 (32%), Positives = 34/71 (47%) Query: 12 SNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLYEWVLSNTQSRR 71 ++N+E L E S E++ + ++ ++Y LSNTQSRR Sbjct: 55 TSNWEEYLKLEEEFSGEMYESLIDKNKILGLDNIESIKWFVENFPDHIYRLSLSNTQSRR 114 Query: 72 SRDGQEFEYII 82 SR G+EFE II Sbjct: 115 SRAGKEFEIII 125 >gi|1657419|gb|AAC45970.1| truncated restrictase R.SenPI [Salmonella enterica subsp. enterica serovar Enteritidis] Length = 264 Score = 41.2 bits (95), Expect = 0.045, Method: Composition-based stats. Identities = 16/25 (64%), Positives = 21/25 (84%) Query: 58 YLYEWVLSNTQSRRSRDGQEFEYII 82 ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 104 HIYDLALSNTQSRRSRAGKEFESIL 128 >gi|32470130|ref|NP_863574.1| restriction endonuclease RKpn2kI [Klebsiella pneumoniae] gi|464833|sp|P34880|T2S2_SHISO RecName: Full=Type-2 restriction enzyme SsoII; Short=R.SsoII; AltName: Full=Endonuclease SsoII; AltName: Full=Type II restriction enzyme SsoII gi|11559817|gb|AAG38100.1|AF300473_1 restriction endonuclease RKpn2kI [Klebsiella pneumoniae] gi|294245|gb|AAA98280.1| restriction endonuclease [Plasmid P4] gi|323968853|gb|EGB64189.1| EcoRII [Escherichia coli TA007] Length = 305 Score = 40.8 bits (94), Expect = 0.061, Method: Composition-based stats. Identities = 16/25 (64%), Positives = 21/25 (84%) Query: 58 YLYEWVLSNTQSRRSRDGQEFEYII 82 ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 104 HIYDLALSNTQSRRSRAGKEFESIL 128 >gi|323974124|gb|EGB69258.1| EcoRII [Escherichia coli TW10509] Length = 305 Score = 40.8 bits (94), Expect = 0.062, Method: Composition-based stats. Identities = 16/25 (64%), Positives = 21/25 (84%) Query: 58 YLYEWVLSNTQSRRSRDGQEFEYII 82 ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 104 HIYDLALSNTQSRRSRAGKEFESIL 128 >gi|3421012|emb|CAA76527.1| R.Ecl18kI (restriction endonuclease) [Enterobacter cloacae] Length = 305 Score = 40.8 bits (94), Expect = 0.065, Method: Composition-based stats. Identities = 16/25 (64%), Positives = 21/25 (84%) Query: 58 YLYEWVLSNTQSRRSRDGQEFEYII 82 ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 104 HIYDLALSNTQSRRSRAGKEFESIL 128 >gi|110590214|pdb|2GB7|A Chain A, Metal-Depleted Ecl18ki In Complex With Uncleaved, Modified Dna gi|110590215|pdb|2GB7|B Chain B, Metal-Depleted Ecl18ki In Complex With Uncleaved, Modified Dna gi|110590216|pdb|2GB7|C Chain C, Metal-Depleted Ecl18ki In Complex With Uncleaved, Modified Dna gi|110590217|pdb|2GB7|D Chain D, Metal-Depleted Ecl18ki In Complex With Uncleaved, Modified Dna gi|110591455|pdb|2FQZ|A Chain A, Metal-Depleted Ecl18ki In Complex With Uncleaved Dna gi|110591456|pdb|2FQZ|B Chain B, Metal-Depleted Ecl18ki In Complex With Uncleaved Dna gi|110591457|pdb|2FQZ|C Chain C, Metal-Depleted Ecl18ki In Complex With Uncleaved Dna gi|110591458|pdb|2FQZ|D Chain D, Metal-Depleted Ecl18ki In Complex With Uncleaved Dna Length = 305 Score = 40.8 bits (94), Expect = 0.068, Method: Composition-based stats. Identities = 16/25 (64%), Positives = 21/25 (84%) Query: 58 YLYEWVLSNTQSRRSRDGQEFEYII 82 ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 104 HIYDLALSNTQSRRSRAGKEFESIL 128 >gi|1871452|dbj|BAA11168.1| restriction endonuclease [Salmonella enterica subsp. enterica serovar Typhi] Length = 318 Score = 40.4 bits (93), Expect = 0.084, Method: Composition-based stats. Identities = 16/25 (64%), Positives = 21/25 (84%) Query: 58 YLYEWVLSNTQSRRSRDGQEFEYII 82 ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 117 HIYDLALSNTQSRRSRAGKEFESIL 141 >gi|169606986|ref|XP_001796913.1| hypothetical protein SNOG_06545 [Phaeosphaeria nodorum SN15] gi|160707127|gb|EAT86376.2| hypothetical protein SNOG_06545 [Phaeosphaeria nodorum SN15] Length = 689 Score = 33.9 bits (76), Expect = 6.9, Method: Composition-based stats. Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 8/76 (10%) Query: 17 VPKMLITELSTEL---FNLKTA---NQNFFHNTLTKKFGDYMS--KITPYLYEWVLSNTQ 68 VP+ ++ + L F+ N+ H + +KF I P LYE L Q Sbjct: 286 VPRDVVELVRKTLRPGFHFAKCVDENEEPTHQRVPQKFVSVAGFENIIPTLYELTLREHQ 345 Query: 69 SRRSRDGQEFEYIIYS 84 + +S + F+ I+Y Sbjct: 346 AAQSGQARPFKAIMYF 361 >gi|224543424|ref|ZP_03683963.1| hypothetical protein CATMIT_02633 [Catenibacterium mitsuokai DSM 15897] gi|224523657|gb|EEF92762.1| hypothetical protein CATMIT_02633 [Catenibacterium mitsuokai DSM 15897] Length = 489 Score = 33.9 bits (76), Expect = 7.1, Method: Composition-based stats. Identities = 24/126 (19%), Positives = 44/126 (34%), Gaps = 20/126 (15%) Query: 1 MQFNEIILKNISNNYEVPKMLITELS--------------------TELFNLKTANQNFF 40 +Q +E L+ I E + +I + T L N + Sbjct: 34 LQLDEFQLEEIDEKLETAQDIIDHILDYAVEKGMISDSVTEKDLFDTRLMNCLMPRPSEV 93 Query: 41 HNTLTKKFGDYMSKITPYLYEWVLSNTQSRRSRDGQEFEYIIYSLYNINTFVTHLMHKKK 100 N + + K T Y Y+ +S+ R+SR + ++ Y Y +L +K Sbjct: 94 VNKFNTLYNESPEKATDYFYDLSISSNYIRKSRIDKNIKFNHYVKYGDIQITINLSKPEK 153 Query: 101 SGKALS 106 KA++ Sbjct: 154 DPKAIA 159 >gi|326436636|gb|EGD82206.1| RNA polymerase III subunit C11 [Salpingoeca sp. ATCC 50818] Length = 108 Score = 33.9 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 11/48 (22%), Positives = 21/48 (43%) Query: 35 ANQNFFHNTLTKKFGDYMSKITPYLYEWVLSNTQSRRSRDGQEFEYII 82 +T + + + PY +E + SR+SR+ ++ E II Sbjct: 9 CTNQLVLDTSAECGTHFACRTCPYKHEMNMPVVSSRKSRNPKQVEDII 56 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.321 0.135 0.356 Lambda K H 0.267 0.0404 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,879,657,958 Number of Sequences: 14124377 Number of extensions: 64991812 Number of successful extensions: 177988 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 27 Number of HSP's that attempted gapping in prelim test: 177951 Number of HSP's gapped (non-prelim): 58 length of query: 110 length of database: 4,842,793,630 effective HSP length: 78 effective length of query: 32 effective length of database: 3,741,092,224 effective search space: 119714951168 effective search space used: 119714951168 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 75 (33.5 bits)