RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780514|ref|YP_003064927.1| type II restriction endonuclease [Candidatus Liberibacter asiaticus str. psy62] (110 letters) >2gb7_A R.ECL18KI; ECL18KI-DNA complex, type II restriction endonuclease, nucleotide flipping, base extrusion, hydrolase/DNA complex; HET: DNA; 1.70A {Enterobacter cloacae} PDB: 2fqz_A* Length = 305 Score = 37.3 bits (86), Expect = 8e-04 Identities = 18/40 (45%), Positives = 25/40 (62%) Query: 48 FGDYMSKITPYLYEWVLSNTQSRRSRDGQEFEYIIYSLYN 87 D+ + ++Y+ LSNTQSRRSR G+EFE I+ L Sbjct: 94 IRDFTMEYPTHIYDLALSNTQSRRSRAGKEFESILELLMM 133 >1na6_A Ecorii, restriction endonuclease ecorii; site-specific restriction, mutation, replication, hydrolase; 2.10A {Escherichia coli} SCOP: b.142.1.1 c.52.1.22 PDB: 3hqg_A 3hqf_A Length = 404 Score = 35.2 bits (81), Expect = 0.003 Identities = 7/24 (29%), Positives = 12/24 (50%) Query: 64 LSNTQSRRSRDGQEFEYIIYSLYN 87 S + R+SR G+ E + L+ Sbjct: 256 NSVSNRRKSRAGKSLELHLEHLFI 279 >3bm3_A PSPGI restriction endonuclease; endonuclease-DNA complex, restriction enzyme, PSPGI, base flipping, hydrolase/DNA complex; HET: DNA MSE CIT; 1.70A {Pyrococcus SP} Length = 272 Score = 33.5 bits (76), Expect = 0.011 Identities = 13/39 (33%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Query: 49 GDYMSKITPYLYEWVLSNTQSRRSRDGQEFEYIIYSLYN 87 Y+S + S Q+R SR G+ FE I L N Sbjct: 76 EAYLSAGYSR-EKLEQSFQQARFSRGGKAFEIIFTKLLN 113 >1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Length = 480 Score = 25.4 bits (55), Expect = 3.2 Identities = 18/79 (22%), Positives = 29/79 (36%), Gaps = 5/79 (6%) Query: 37 QNFFHNTLTKKFGDYMSKITPYLYEWVLSNTQSRRSRDGQEFEYIIYSLYNINTFVTHLM 96 N F + +F KI L E + + ++ QE I +L +I V L Sbjct: 378 DNGFWSDNIDEFKKDNYKIFRQLIELLQAKVRNGDVNAKQEKIIIQVALNDITHVVELLP 437 Query: 97 H-----KKKSGKALSLSIM 110 K GKA + ++ Sbjct: 438 ESIDVLDKTGGKADIMELL 456 >1dlf_L Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 1.45A {Mus musculus} SCOP: b.1.1.1 PDB: 1wz1_L* 2dlf_L 1maj_A 1mak_A 1ktr_L 2cju_L* 2uud_K* 1dsf_L 1n4x_L 1bfv_L* 1cfv_L* 2bfv_L* 1wt5_C Length = 113 Score = 23.8 bits (51), Expect = 8.4 Identities = 10/39 (25%), Positives = 16/39 (41%) Query: 71 RSRDGQEFEYIIYSLYNINTFVTHLMHKKKSGKALSLSI 109 + GQ + +IY + N + V SG +L I Sbjct: 42 LQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKI 80 >3he1_A Major exported HCP3 protein; structural genomics, APC22128, HCPC, secretion, virulence, PSI-2, protein structure initiative; 2.10A {Pseudomonas aeruginosa} Length = 195 Score = 24.1 bits (52), Expect = 8.8 Identities = 10/67 (14%), Positives = 17/67 (25%), Gaps = 13/67 (19%) Query: 34 TANQNFFHNTLTKKFGD-----YMSKITPYLYEWVLSNTQ--------SRRSRDGQEFEY 80 + T + K +P L + S + R S G + Y Sbjct: 73 PRDPQSGQPTGQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHY 132 Query: 81 IIYSLYN 87 L + Sbjct: 133 YTTVLED 139 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.319 0.132 0.375 Gapped Lambda K H 0.267 0.0602 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 869,931 Number of extensions: 33127 Number of successful extensions: 96 Number of sequences better than 10.0: 1 Number of HSP's gapped: 96 Number of HSP's successfully gapped: 15 Length of query: 110 Length of database: 5,693,230 Length adjustment: 74 Effective length of query: 36 Effective length of database: 3,899,174 Effective search space: 140370264 Effective search space used: 140370264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.3 bits)