Query gi|254780515|ref|YP_003064928.1| hypothetical protein CLIBASIA_02010 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 42 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 22:51:22 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780515.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam09019 EcoRII-C EcoRII C te 96.0 0.0033 8.5E-08 36.0 1.8 36 2-37 113-148 (164) 2 COG0351 ThiD Hydroxymethylpyri 9.9 1.1E+02 0.0027 14.7 0.6 26 10-35 83-108 (263) 3 KOG2825 consensus 9.4 1.5E+02 0.0039 13.9 1.2 20 12-31 244-263 (323) 4 pfam09404 DUF2003 Eukaryotic p 8.2 1.7E+02 0.0043 13.7 1.1 38 2-39 359-418 (447) 5 TIGR02236 recomb_radA DNA repa 8.1 1.8E+02 0.0047 13.5 1.2 19 3-21 215-233 (333) 6 PRK00033 clpS ATP-dependent Cl 6.8 1.8E+02 0.0047 13.5 0.7 16 9-24 68-83 (83) 7 pfam07490 Tir_receptor_N Trans 5.2 3.2E+02 0.0081 12.4 1.2 19 5-23 165-183 (269) 8 TIGR01485 SPP_plant-cyano sucr 5.0 2.3E+02 0.0057 13.1 0.2 23 2-24 64-88 (257) 9 TIGR00474 selA L-seryl-tRNA se 4.9 1.6E+02 0.0041 13.8 -0.6 23 1-23 331-353 (448) 10 PRK12412 pyridoxal kinase; Rev 4.4 2.9E+02 0.0075 12.6 0.5 27 10-36 83-109 (268) No 1 >pfam09019 EcoRII-C EcoRII C terminal. The C-terminal catalytic domain of the Restriction Endonuclease EcoRII has a restriction endonuclease-like fold with a central five-stranded mixed beta-sheet surrounded on both sides by alpha-helices. It cleaves DNA specifically at single 5' CCWGG sites. Probab=96.00 E-value=0.0033 Score=35.98 Aligned_cols=36 Identities=31% Similarity=0.483 Sum_probs=32.8 Q ss_pred CEEEEEEECCHHHHHHHHHHCCCCEEEEEEHHHHHH Q ss_conf 717999850032210553203353899985201133 Q gi|254780515|r 2 PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKE 37 (42) Q Consensus 2 ptihlltvdseiaenkaeridkhniilvvldkvkke 37 (42) +.+||+|.+..|.+|+..-+..|||.|||-..+++. T Consensus 113 ~~khL~TL~~gIS~~q~~eM~~~~i~LVvp~~l~~s 148 (164) T pfam09019 113 RRKHLFTLQPGISENQTNEMSEANVQLVVPSPLHKS 148 (164) T ss_pred HHHHEEECCCCCCHHHHHHHHHCCEEEEECHHHHHH T ss_conf 123145427777888999999769499953476521 No 2 >COG0351 ThiD Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [Coenzyme metabolism] Probab=9.90 E-value=1.1e+02 Score=14.67 Aligned_cols=26 Identities=46% Similarity=0.457 Sum_probs=21.3 Q ss_pred CCHHHHHHHHHHCCCCEEEEEEHHHH Q ss_conf 00322105532033538999852011 Q gi|254780515|r 10 DSEIAENKAERIDKHNIILVVLDKVK 35 (42) Q Consensus 10 dseiaenkaeridkhniilvvldkvk 35 (42) +.||.|--++.++++++.-+|+|-|- T Consensus 83 ~~eiie~va~~l~~~~~~~vV~DPVm 108 (263) T COG0351 83 SAEIIEVVAEKLKKYGIGPVVLDPVM 108 (263) T ss_pred CHHHHHHHHHHHHHCCCCCEEECCEE T ss_conf 88999999999986699869988437 No 3 >KOG2825 consensus Probab=9.42 E-value=1.5e+02 Score=13.94 Aligned_cols=20 Identities=45% Similarity=0.504 Sum_probs=15.1 Q ss_pred HHHHHHHHHHCCCCEEEEEE Q ss_conf 32210553203353899985 Q gi|254780515|r 12 EIAENKAERIDKHNIILVVL 31 (42) Q Consensus 12 eiaenkaeridkhniilvvl 31 (42) -|+|-+.+.||-||||.--| T Consensus 244 liqeL~k~~idthnIIVNQL 263 (323) T KOG2825 244 LIQELAKQGIDTHNIIVNQL 263 (323) T ss_pred HHHHHHHCCCCCCCEEEEEC T ss_conf 99999864886112013302 No 4 >pfam09404 DUF2003 Eukaryotic protein of unknown function (DUF2003). This is a family of proteins of unknown function which adopt an alpha helical and beta sheet structure. Probab=8.25 E-value=1.7e+02 Score=13.69 Aligned_cols=38 Identities=29% Similarity=0.429 Sum_probs=22.7 Q ss_pred CEEEEEEECCHHHHHHHH----------------------HHCCCCEEEEEEHHHHHHHH Q ss_conf 717999850032210553----------------------20335389998520113343 Q gi|254780515|r 2 PTIHLLTVDSEIAENKAE----------------------RIDKHNIILVVLDKVKKEKH 39 (42) Q Consensus 2 ptihlltvdseiaenkae----------------------ridkhniilvvldkvkkekh 39 (42) |..|+-.+-+-|.||.+| |||-+-.+.|+.+.-|+||. T Consensus 359 p~~h~pnIi~ii~e~~~eLn~~ekIv~~~D~~~qsTYfl~ridp~~~lVVif~~kk~EKD 418 (447) T pfam09404 359 PVTHWPNVIMIMTDRASELNTLEKVVHFYDDKVQSTYFLTRPEPHFTIVVIFDGRKSERD 418 (447) T ss_pred CCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCEEEEEEECCCCEEEEEEECCCCCHHH T ss_conf 212425799999887877523570899823641004778841674699999767641688 No 5 >TIGR02236 recomb_radA DNA repair and recombination protein RadA; InterPro: IPR011938 This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA, eukaryotic RAD51 (IPR011941 from INTERPRO), and archaeal RadB (IPR011939 from INTERPRO). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein .; GO: 0003684 damaged DNA binding, 0005524 ATP binding, 0008094 DNA-dependent ATPase activity, 0006281 DNA repair, 0006310 DNA recombination. Probab=8.10 E-value=1.8e+02 Score=13.54 Aligned_cols=19 Identities=37% Similarity=0.466 Sum_probs=13.2 Q ss_pred EEEEEEECCHHHHHHHHHH Q ss_conf 1799985003221055320 Q gi|254780515|r 3 TIHLLTVDSEIAENKAERI 21 (42) Q Consensus 3 tihlltvdseiaenkaeri 21 (42) .|.|+.|||-+|.=.||-+ T Consensus 215 pv~L~~VDSLtsHFRaEY~ 233 (333) T TIGR02236 215 PVRLLIVDSLTSHFRAEYV 233 (333) T ss_pred CEEEEEECCCCCCCCCCCC T ss_conf 4689998121002236764 No 6 >PRK00033 clpS ATP-dependent Clp protease adaptor protein ClpS; Reviewed Probab=6.78 E-value=1.8e+02 Score=13.54 Aligned_cols=16 Identities=38% Similarity=0.607 Sum_probs=9.8 Q ss_pred ECCHHHHHHHHHHCCC Q ss_conf 5003221055320335 Q gi|254780515|r 9 VDSEIAENKAERIDKH 24 (42) Q Consensus 9 vdseiaenkaeridkh 24 (42) -.-|+||.|.+++..| T Consensus 68 ~~~E~AE~k~~qvh~~ 83 (83) T PRK00033 68 GTREVAETKVEQVHQH 83 (83) T ss_pred CCHHHHHHHHHHHHCC T ss_conf 2789999999998549 No 7 >pfam07490 Tir_receptor_N Translocated intimin receptor (Tir) N-terminus. Intimin and its translocated intimin receptor (Tir) are bacterial proteins that mediate adhesion between mammalian cells and attaching and effacing (A/E) pathogens. A unique and essential feature of A/E bacterial pathogens is the formation of actin-rich pedestals beneath the intimately adherent bacteria and localized destruction of the intestinal brush border. The bacterial outer membrane adhesin, intimin, is necessary for the production of the A/E lesion and diarrhoea. The A/E bacteria translocate their own receptor for intimin, Tir, into the membrane of mammalian cells using the type III secretion system. The translocated Tir triggers additional host signalling events and actin nucleation, which are essential for lesion formation. This family represents the Tir N-terminal domain which is involved in Tir stability and Tir secretion. Probab=5.25 E-value=3.2e+02 Score=12.41 Aligned_cols=19 Identities=42% Similarity=0.618 Sum_probs=14.6 Q ss_pred EEEEECCHHHHHHHHHHCC Q ss_conf 9998500322105532033 Q gi|254780515|r 5 HLLTVDSEIAENKAERIDK 23 (42) Q Consensus 5 hlltvdseiaenkaeridk 23 (42) -+.||.|.|+|..+.-|+| T Consensus 165 aMVTvASDIaeARqrIl~k 183 (269) T pfam07490 165 AMVTVASDIAEARQRILDK 183 (269) T ss_pred EEEEEHHHHHHHHHHHHHH T ss_conf 1276314789999999974 No 8 >TIGR01485 SPP_plant-cyano sucrose phosphatase; InterPro: IPR012847 This entry describes the sucrose phosphate phosphohydrolase from plants and cyanobacteria (SPP). However, a closely related group of sequences from bacteria and archaea may prove to catalyze the same reaction. SPP is a member of the Class IIB subfamily of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. SPP catalyzes the final step in the biosynthesis of sucrose, a critically important molecule for plants. Sucrose phosphate synthase (SPS), the prior step in the biosynthesis of sucrose contains a domain, which exhibits considerable similarity to SPP albeit without conservation of the catalytic residues. The catalytic machinery of the synthase resides in another domain. It seems likely that the phosphatase-like domain is involved in substrate binding, possibly binding both substrates in a "product-like" orientation prior to ligation by the synthase catalytic domain.. Probab=4.98 E-value=2.3e+02 Score=13.12 Aligned_cols=23 Identities=39% Similarity=0.411 Sum_probs=17.8 Q ss_pred CEEEEEEECCHHHHH--HHHHHCCC Q ss_conf 717999850032210--55320335 Q gi|254780515|r 2 PTIHLLTVDSEIAEN--KAERIDKH 24 (42) Q Consensus 2 ptihlltvdseiaen--kaeridkh 24 (42) |-|-++.|-|||.-+ .|+-.|.+ T Consensus 64 PD~~v~sVGsEI~~~GGEa~~~D~~ 88 (257) T TIGR01485 64 PDILVTSVGSEIYYGGGEAEVPDSD 88 (257) T ss_pred CCCEEEEECCEEEECCCCCCCCCHH T ss_conf 3520012031353378443577336 No 9 >TIGR00474 selA L-seryl-tRNA selenium transferase; InterPro: IPR004534 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3-prime or 5-prime non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation. This family describes SelA. A close homolog of SelA is found in Helicobacter pylori, but all other required elements are missing and the protein is shorter at the N-terminus than SelA from other species. The trusted cut-off is set above the score generated for Helicobacter pyloriputative SelA.; GO: 0004125 L-seryl-tRNASec selenium transferase activity, 0001514 selenocysteine incorporation, 0005737 cytoplasm. Probab=4.85 E-value=1.6e+02 Score=13.82 Aligned_cols=23 Identities=43% Similarity=0.660 Sum_probs=18.4 Q ss_pred CCEEEEEEECCHHHHHHHHHHCC Q ss_conf 97179998500322105532033 Q gi|254780515|r 1 MPTIHLLTVDSEIAENKAERIDK 23 (42) Q Consensus 1 mptihlltvdseiaenkaeridk 23 (42) .||+.+||-+.+.-..||+|..+ T Consensus 331 ip~lr~ltr~~~~~~~~a~rL~~ 353 (448) T TIGR00474 331 IPTLRLLTRAKKFLRIKAERLEK 353 (448) T ss_pred CHHHHHHCCHHHHHHHHHHHHHH T ss_conf 21556530348899999999888 No 10 >PRK12412 pyridoxal kinase; Reviewed Probab=4.41 E-value=2.9e+02 Score=12.56 Aligned_cols=27 Identities=48% Similarity=0.500 Sum_probs=20.6 Q ss_pred CCHHHHHHHHHHCCCCEEEEEEHHHHH Q ss_conf 003221055320335389998520113 Q gi|254780515|r 10 DSEIAENKAERIDKHNIILVVLDKVKK 36 (42) Q Consensus 10 dseiaenkaeridkhniilvvldkvkk 36 (42) +.++.+--++.+.+++..-+|+|-|-. T Consensus 83 s~~~i~~v~~~L~~~~~~~vV~DPVl~ 109 (268) T PRK12412 83 SVEIIEMVAETIEKHNFKNVVVDPVMV 109 (268) T ss_pred CHHHHHHHHHHHHHCCCCCEEECCCCC T ss_conf 877899999999967998778637755 Done!