BLAST/PSIBLAST alignment of GI: 254780515 and GI: 261400949 at iteration 1
>gi|261400949|ref|ZP_05987074.1| type II restriction enzyme SsoII [Neisseria lactamica ATCC 23970] Length = 132
>gi|269209192|gb|EEZ75647.1| type II restriction enzyme SsoII [Neisseria lactamica ATCC 23970] Length = 132
 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 33/42 (78%)

Query: 1   MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE 42
           +P I+LLTVD +I+ENK  +++ HNI+LVV   +KK+ HLK+
Sbjct: 67  VPNIYLLTVDDDISENKVIQMNNHNIVLVVPQNIKKQPHLKD 108