RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780515|ref|YP_003064928.1| hypothetical protein CLIBASIA_02010 [Candidatus Liberibacter asiaticus str. psy62] (42 letters) >1na6_A Ecorii, restriction endonuclease ecorii; site-specific restriction, mutation, replication, hydrolase; 2.10A {Escherichia coli} SCOP: b.142.1.1 c.52.1.22 PDB: 3hqg_A 3hqf_A Length = 404 Score = 36.0 bits (83), Expect = 0.002 Identities = 7/35 (20%), Positives = 16/35 (45%) Query: 2 PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKK 36 +HL T+ ++ + + + + LVV + K Sbjct: 342 HQVHLFTLQEGVSLAQYREMRESGVRLVVPSSLHK 376 >2gb7_A R.ECL18KI; ECL18KI-DNA complex, type II restriction endonuclease, nucleotide flipping, base extrusion, hydrolase/DNA complex; HET: DNA; 1.70A {Enterobacter cloacae} PDB: 2fqz_A* Length = 305 Score = 35.0 bits (80), Expect = 0.004 Identities = 8/38 (21%), Positives = 19/38 (50%) Query: 2 PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKH 39 ++L T+D +E + + N+++V + K K+ Sbjct: 202 REMYLATLDDSFSEETINILYEANVVVVTTVENKNFKY 239 >3bm3_A PSPGI restriction endonuclease; endonuclease-DNA complex, restriction enzyme, PSPGI, base flipping, hydrolase/DNA complex; HET: DNA MSE CIT; 1.70A {Pyrococcus SP} Length = 272 Score = 31.1 bits (70), Expect = 0.059 Identities = 6/41 (14%), Positives = 14/41 (34%) Query: 2 PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE 42 + D E A + + I V + + + ++E Sbjct: 185 INFWFVGFDEEFTIYSAIAMLDNGIDRVYVIDGRYDSLIEE 225 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.315 0.133 0.350 Gapped Lambda K H 0.267 0.0553 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 332,529 Number of extensions: 8655 Number of successful extensions: 20 Number of sequences better than 10.0: 1 Number of HSP's gapped: 20 Number of HSP's successfully gapped: 5 Length of query: 42 Length of database: 5,693,230 Length adjustment: 15 Effective length of query: 27 Effective length of database: 5,329,570 Effective search space: 143898390 Effective search space used: 143898390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.4 bits)