RPSBLAST alignment of GI: 254780515 and SCOP domain: d1na6a2

Alignment
>d1na6a2 c.52.1.22 (A:179-398) Restriction endonuclease EcoRII, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 220
 Score = 36.0 bits (83), Expect = 0.001
 Identities = 7/36 (19%), Positives = 17/36 (47%)

Query: 2   PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKE 37
             +HL T+   ++  +   + +  + LVV   + K+
Sbjct: 164 HQVHLFTLQEGVSLAQYREMRESGVRLVVPSSLHKK 199

SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Restriction endonuclease-like
superfamily: Restriction endonuclease-like
family: Type II restriction endonuclease catalytic domain
domain: Restriction endonuclease EcoRII, C-terminal domain
species: Escherichia coli [TaxId: 562]