>TIGR00675 dcm DNA-cytosine methyltransferase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2.1.1.73 from EC) (C5 Mtase) are enzymes that specifically methylate the C-5 carbon of cytosines in DNA to produce C5-methylcytosine , , . In mammalian cells, cytosine-specific methyltransferases methylate certain CpG sequences, which are believed to modulate gene expression and cell differentiation. In bacteria, these enzymes are a component of restriction-modification systems and serve as valuable tools for the manipulation of DNA , . The structure of HhaI methyltransferase (M.HhaI) has been resolved to 2.5 A : the molecule folds into 2 domains - a larger catalytic domain containing catalytic and cofactor binding sites, and a smaller DNA recognition domain.; GO: 0003677 DNA binding, 0006306 DNA methylation.

Probab=100.00 E-value=6.8e-36 Score=200.63 Aligned_cols=80 Identities=60% Similarity=1.060 Sum_probs=74.9 Q ss_pred EEEECCCCCHHHHHHHHHHHC--CCCEEEEEEEC--CHHHHHHHHHCCCC--CCCCCEEEEEECCC------CCCCEEEE Q ss_conf 964107947889999872220--89569999806--95551122200123--32321158975365------78871999 Q gi|254780516|r 4 ITDLFCGIGGIRLDLEQTFNH--RNVECFFSSEI--NPYSVKTYQANFPN--TLIFGDIAKIKTQD------IPDHDVLL 71 (83) Q Consensus 4 v~~LFsG~GG~~~gl~~a~~~--~~~~~v~a~e~--d~~a~~~y~~n~~~--~~~~~DI~~~~~~~------~~~~D~l~ 71 (83) T Consensus 1 ~idLFaGiGG~rlGfe~~g~~l~~~~~~V~~sE~PRdk~A~~tY~~Nf~~~~~~~~~DI~~i~~~~~~~~~~~Pd~D~L~ 80 (425) T TIGR00675 1 VIDLFAGIGGIRLGFEQAGKELTVAFKCVFASEIPRDKYAQKTYEANFGNDEKVPFGDITKISPSDLLRHIAIPDFDILL 80 (425) T ss_pred CEEEECCCCHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHCCCCCEECCCCCCCCCCCCCCCCCCCCCEEEEE T ss_conf 94542551357899997410141113788720166877899999976478842067763336601150012488678996 Q ss_pred ECCCCCCCCCCC Q ss_conf 868997543689 Q gi|254780516|r 72 AGFPCQPFSQAG 83 (83) Q Consensus 72 gG~PCq~fS~aG 83 (83) T Consensus 81 gGFPCQ~FS~AG 92 (425) T TIGR00675 81 GGFPCQPFSIAG 92 (425) T ss_pred CCCCCCHHHHHC T ss_conf 389971344641

HHsearch alignment for GI: 254780516 and conserved domain: TIGR00675