RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780516|ref|YP_003064929.1| type II modification methyltransferase [Candidatus Liberibacter asiaticus str. psy62] (83 letters) >gnl|CDD|143915 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase. Length = 319 Score = 110 bits (278), Expect = 6e-26 Identities = 43/82 (52%), Positives = 50/82 (60%), Gaps = 5/82 (6%) Query: 2 LKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKT 61 K DLF GIGG RL LEQ EC ++EI+ + KTY+ANFP GDI I Sbjct: 1 FKFIDLFAGIGGFRLGLEQA----GFECVAANEIDKSAAKTYEANFPKV-PIGDITLIDI 55 Query: 62 QDIPDHDVLLAGFPCQPFSQAG 83 +DIPD D+L GFPCQ FS AG Sbjct: 56 KDIPDIDILTGGFPCQDFSIAG 77 >gnl|CDD|73191 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology. Cytosine-specific DNA methylases are found both in prokaryotes and eukaryotes. DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the mammalian genome. These effects include transcriptional repression via inhibition of transcription factor binding or the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability.. Length = 275 Score = 105 bits (263), Expect = 3e-24 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 5/83 (6%) Query: 2 LKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKT 61 L++ DLF GIGG RL LE+ E ++EI+ + +TY+ANFPN LI GDI KI Sbjct: 1 LRVIDLFAGIGGFRLGLEKA----GFEIVAANEIDKSAAETYEANFPNKLIEGDITKIDE 56 Query: 62 QD-IPDHDVLLAGFPCQPFSQAG 83 +D IPD D+L GFPCQPFS AG Sbjct: 57 KDFIPDIDLLTGGFPCQPFSIAG 79 >gnl|CDD|30619 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair]. Length = 328 Score = 87.1 bits (215), Expect = 1e-18 Identities = 38/86 (44%), Positives = 54/86 (62%), Gaps = 7/86 (8%) Query: 1 MLKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNT-LIFGDIAKI 59 +K+ DLF GIGG+ L E+ E F++EI+P +V TY+ANFP+ +I GDI ++ Sbjct: 3 KMKVIDLFAGIGGLSLGFEEA----GFEIVFANEIDPPAVATYKANFPHGDIILGDIKEL 58 Query: 60 KTQDIP--DHDVLLAGFPCQPFSQAG 83 + + D DVL+ G PCQ FS AG Sbjct: 59 DGEALRKSDVDVLIGGPPCQDFSIAG 84 >gnl|CDD|36137 KOG0919, KOG0919, KOG0919, C-5 cytosine-specific DNA methylase [Transcription]. Length = 338 Score = 32.7 bits (74), Expect = 0.023 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 5/85 (5%) Query: 2 LKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLI-FGDIAKIK 60 L++ +L+ G GG+ LE + + ++N + + Y N+ + L+ +I + Sbjct: 4 LRVLELYSGHGGMHYALEDAQIPAQIVA--AIDVNTVANEVYAHNYHSNLVKTRNIQSLT 61 Query: 61 TQDIP--DHDVLLAGFPCQPFSQAG 83 ++ ++LL PCQPF++ G Sbjct: 62 VKEFDKLQANMLLMSPPCQPFTRIG 86 >gnl|CDD|32590 COG2520, COG2520, Predicted methyltransferase [General function prediction only]. Length = 341 Score = 31.0 bits (70), Expect = 0.062 Identities = 10/43 (23%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Query: 4 ITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQAN 46 + D+F G+G + + V ++ +INP +V+ + N Sbjct: 192 VLDMFAGVGPFSIPI-AKKGRPKV---YAIDINPDAVEYLKEN 230 >gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).. Length = 107 Score = 30.9 bits (70), Expect = 0.084 Identities = 15/83 (18%), Positives = 32/83 (38%), Gaps = 10/83 (12%) Query: 3 KITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQAN------FPNTLIFGDI 56 ++ DL CG G + L L R +I+P +++ + ++ GD Sbjct: 1 RVLDLGCGTGALALALASGPGAR----VTGVDISPVALELARKAAAALLADNVEVLKGDA 56 Query: 57 AKIKTQDIPDHDVLLAGFPCQPF 79 ++ + DV+++ P Sbjct: 57 EELPPEADESFDVIISDPPLHHL 79 >gnl|CDD|32446 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]. Length = 432 Score = 26.8 bits (59), Expect = 1.4 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Query: 6 DLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQAN 46 DL+CG+G L L + EI+P +V+ Q N Sbjct: 299 DLYCGVGTFGLPLAKRVKK-----VHGVEISPEAVEAAQEN 334 >gnl|CDD|39628 KOG4427, KOG4427, KOG4427, E3 ubiquitin protein ligase [Posttranslational modification, protein turnover, chaperones]. Length = 1096 Score = 26.9 bits (59), Expect = 1.4 Identities = 12/44 (27%), Positives = 18/44 (40%) Query: 31 FSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPDHDVLLAGF 74 F S I+P + + LI GD + I D+ + GF Sbjct: 931 FRSIISPEWLSLFSPPELQRLISGDNSDIDLDDLKRNTKYYGGF 974 >gnl|CDD|145554 pfam02475, Met_10, Met-10+ like-protein. The methionine-10 mutant allele of N. crassa codes for a protein of unknown function. However, homologous proteins have been found in yeast suggesting this protein may be involved in methionine biosynthesis, transport and/or utilisation. Length = 199 Score = 26.1 bits (58), Expect = 1.9 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Query: 4 ITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQAN 46 + D+F GIG + + + H + ++ E+NP +VK + N Sbjct: 104 VVDMFAGIGPFSIPIAK---HSKAKRVYAVELNPEAVKYLKEN 143 >gnl|CDD|34970 COG5411, COG5411, Phosphatidylinositol 5-phosphate phosphatase [Signal transduction mechanisms]. Length = 460 Score = 25.3 bits (55), Expect = 4.1 Identities = 15/62 (24%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Query: 8 FCGIGGIRLDLEQTFNH-RNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPD 66 F G + + FN+ R CF +S + + F I +I + I D Sbjct: 146 FGGSSSNKGAVAIRFNYERTSFCFVNSHLAAGVNNIEERIFDYRSIASNICFSRGLRIYD 205 Query: 67 HD 68 HD Sbjct: 206 HD 207 >gnl|CDD|38173 KOG2962, KOG2962, KOG2962, Prohibitin-related membrane protease subunits [General function prediction only]. Length = 322 Score = 24.7 bits (53), Expect = 5.7 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Query: 3 KITDLFCGI-GGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDI 56 ++ ++ CG GG+ + F+ V F + VK Y ++ TLIF I Sbjct: 70 EVKNVPCGTSGGVLI----YFDRIEVVNFLRPDAVYDIVKNYTVDYDKTLIFNKI 120 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.143 0.447 Gapped Lambda K H 0.267 0.0696 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,019,561 Number of extensions: 42563 Number of successful extensions: 111 Number of sequences better than 10.0: 1 Number of HSP's gapped: 103 Number of HSP's successfully gapped: 13 Length of query: 83 Length of database: 6,263,737 Length adjustment: 53 Effective length of query: 30 Effective length of database: 5,118,460 Effective search space: 153553800 Effective search space used: 153553800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (23.5 bits)