RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780519|ref|YP_003064932.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter asiaticus str. psy62] (88 letters) >d1lbva_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 252 Score = 23.5 bits (49), Expect = 5.4 Identities = 7/35 (20%), Positives = 14/35 (40%) Query: 1 MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILI 35 M+E D L I+R + + A + + + Sbjct: 1 MDERDALRISREIAGEVRKAIASMPLRERVKDVGM 35 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.330 0.139 0.373 Gapped Lambda K H 0.267 0.0522 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 278,417 Number of extensions: 9736 Number of successful extensions: 37 Number of sequences better than 10.0: 1 Number of HSP's gapped: 37 Number of HSP's successfully gapped: 14 Length of query: 88 Length of database: 2,407,596 Length adjustment: 53 Effective length of query: 35 Effective length of database: 1,679,906 Effective search space: 58796710 Effective search space used: 58796710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.4 bits)