BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780519|ref|YP_003064932.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter asiaticus str. psy62] (88 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780519|ref|YP_003064932.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter asiaticus str. psy62] Length = 88 Score = 167 bits (422), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 88/88 (100%), Positives = 88/88 (100%) Query: 1 MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60 MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI Sbjct: 1 MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60 Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88 TLIISAPFIGGQISSFVTLVLSRIQSSL Sbjct: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88 >gi|254780666|ref|YP_003065079.1| Fmu (Sun) domain protein [Candidatus Liberibacter asiaticus str. psy62] Length = 445 Score = 21.9 bits (45), Expect = 2.3, Method: Compositional matrix adjust. Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 46 EVTLTFVPKIIAVFITLIISA 66 VTL F+P+I AV ++IS+ Sbjct: 54 NVTLRFLPRIDAVLDFVLISS 74 >gi|254781213|ref|YP_003065626.1| head-to-tail joining protein, putative [Candidatus Liberibacter asiaticus str. psy62] Length = 556 Score = 21.2 bits (43), Expect = 4.0, Method: Composition-based stats. Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 66 APFIGGQISSFVTLVLSR 83 P IGG S F+ ++SR Sbjct: 392 GPLIGGLQSEFIGAMISR 409 >gi|254781088|ref|YP_003065501.1| F0F1 ATP synthase subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 250 Score = 20.8 bits (42), Expect = 4.6, Method: Compositional matrix adjust. Identities = 11/40 (27%), Positives = 20/40 (50%) Query: 31 LGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70 LGI +FL L + L F + +I ++++ +IG Sbjct: 203 LGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYIG 242 >gi|254780546|ref|YP_003064959.1| hypothetical protein CLIBASIA_02165 [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Score = 20.0 bits (40), Expect = 7.2, Method: Compositional matrix adjust. Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 58 VFITLIISAPFIGGQIS 74 +F L +SA GGQIS Sbjct: 264 LFYLLRVSAAICGGQIS 280 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.330 0.139 0.373 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,107 Number of Sequences: 1233 Number of extensions: 1212 Number of successful extensions: 11 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 88 length of database: 328,796 effective HSP length: 56 effective length of query: 32 effective length of database: 259,748 effective search space: 8311936 effective search space used: 8311936 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 31 (16.5 bits)