BLAST/PSIBLAST alignment of GI: 254780520 and GI: 17988508 at iteration 1
>gi|17988508|ref|NP_541141.1| flagellar basal body rod modification protein [Brucella melitensis bv. 1 str. 16M] Length = 137
>gi|23500849|ref|NP_700289.1| flagellar basal body rod modification protein [Brucella suis 1330] Length = 137
>gi|62317952|ref|YP_223805.1| flagellar basal body rod modification protein [Brucella abortus bv. 1 str. 9-941] Length = 137
>gi|83269929|ref|YP_419220.1| flagellar basal body rod modification protein [Brucella melitensis biovar Abortus 2308] Length = 137
>gi|148557915|ref|YP_001257999.1| flagellar basal body rod modification protein [Brucella ovis ATCC 25840] Length = 137
>gi|161621177|ref|YP_001595063.1| flagellar basal body rod modification protein [Brucella canis ATCC 23365] Length = 137
>gi|163845452|ref|YP_001623107.1| flagellar basal body rod modification protein [Brucella suis ATCC 23445] Length = 137
>gi|189023203|ref|YP_001932944.1| flagellar basal body rod modification protein [Brucella abortus S19] Length = 137
>gi|225628424|ref|ZP_03786458.1| flagellar basal body rod modification protein [Brucella ceti str. Cudo] Length = 137
>gi|225686880|ref|YP_002734852.1| flagellar basal body rod modification protein [Brucella melitensis ATCC 23457] Length = 137
>gi|254691616|ref|ZP_05154870.1| flagellar basal body rod modification protein [Brucella abortus bv. 6 str. 870] Length = 137
>gi|254695088|ref|ZP_05156916.1| flagellar basal body rod modification protein [Brucella abortus bv. 3 str. Tulya] Length = 137
>gi|254698184|ref|ZP_05160012.1| flagellar basal body rod modification protein [Brucella abortus bv. 2 str. 86/8/59] Length = 137
>gi|254699258|ref|ZP_05161086.1| flagellar basal body rod modification protein [Brucella suis bv. 5 str. 513] Length = 137
>gi|254702378|ref|ZP_05164206.1| flagellar basal body rod modification protein [Brucella suis bv. 3 str. 686] Length = 137
>gi|254706501|ref|ZP_05168329.1| flagellar basal body rod modification protein [Brucella pinnipedialis M163/99/10] Length = 137
>gi|254711214|ref|ZP_05173025.1| flagellar basal body rod modification protein [Brucella pinnipedialis B2/94] Length = 137
>gi|254711813|ref|ZP_05173624.1| flagellar basal body rod modification protein [Brucella ceti M644/93/1] Length = 137
>gi|254714882|ref|ZP_05176693.1| flagellar basal body rod modification protein [Brucella ceti M13/05/1] Length = 137
>gi|254731629|ref|ZP_05190207.1| flagellar basal body rod modification protein [Brucella abortus bv. 4 str. 292] Length = 137
>gi|256015893|ref|YP_003105902.1| flagellar basal body rod modification protein [Brucella microti CCM 4915] Length = 137
>gi|256030157|ref|ZP_05443771.1| flagellar basal body rod modification protein [Brucella pinnipedialis M292/94/1] Length = 137
>gi|256042861|ref|ZP_05445807.1| flagellar basal body rod modification protein [Brucella melitensis bv. 1 str. Rev.1] Length = 137
>gi|256059809|ref|ZP_05450004.1| flagellar basal body rod modification protein [Brucella neotomae 5K33] Length = 137
>gi|256112181|ref|ZP_05453102.1| flagellar basal body rod modification protein [Brucella melitensis bv. 3 str. Ether] Length = 137
>gi|256158336|ref|ZP_05456240.1| flagellar basal body rod modification protein [Brucella ceti M490/95/1] Length = 137
>gi|256252730|ref|ZP_05458266.1| flagellar basal body rod modification protein [Brucella ceti B1/94] Length = 137
>gi|256256803|ref|ZP_05462339.1| flagellar basal body rod modification protein [Brucella abortus bv. 9 str. C68] Length = 137
>gi|256261983|ref|ZP_05464515.1| flagellar hook capping protein [Brucella melitensis bv. 2 str. 63/9] Length = 137
>gi|260166791|ref|ZP_05753602.1| flagellar basal body rod modification protein [Brucella sp. F5/99] Length = 137
>gi|260544137|ref|ZP_05819958.1| flagellar hook capping protein [Brucella abortus NCTC 8038] Length = 137
>gi|260564098|ref|ZP_05834583.1| flagellar hook capping protein [Brucella melitensis bv. 1 str. 16M] Length = 137
>gi|260568719|ref|ZP_05839188.1| flagellar hook capping protein [Brucella suis bv. 4 str. 40] Length = 137
>gi|260757247|ref|ZP_05869595.1| flagellar hook capping protein [Brucella abortus bv. 6 str. 870] Length = 137
>gi|260759388|ref|ZP_05871736.1| flagellar hook capping protein [Brucella abortus bv. 4 str. 292] Length = 137
>gi|260762631|ref|ZP_05874963.1| flagellar hook capping protein [Brucella abortus bv. 2 str. 86/8/59] Length = 137
>gi|260883051|ref|ZP_05894665.1| flagellar hook capping protein [Brucella abortus bv. 9 str. C68] Length = 137
>gi|261215439|ref|ZP_05929720.1| flagellar hook capping protein [Brucella abortus bv. 3 str. Tulya] Length = 137
>gi|261216572|ref|ZP_05930853.1| flagellar hook capping protein [Brucella ceti M13/05/1] Length = 137
>gi|261219808|ref|ZP_05934089.1| flagellar hook capping protein [Brucella ceti B1/94] Length = 137
>gi|261313955|ref|ZP_05953152.1| flagellar hook capping protein [Brucella pinnipedialis M163/99/10] Length = 137
>gi|261318805|ref|ZP_05958002.1| flagellar hook capping protein [Brucella pinnipedialis B2/94] Length = 137
>gi|261319442|ref|ZP_05958639.1| flagellar hook capping protein [Brucella ceti M644/93/1] Length = 137
>gi|261323789|ref|ZP_05962986.1| flagellar hook capping protein [Brucella neotomae 5K33] Length = 137
>gi|261749697|ref|ZP_05993406.1| flagellar hook capping protein [Brucella suis bv. 5 str. 513] Length = 137
>gi|261752941|ref|ZP_05996650.1| flagellar hook capping protein [Brucella suis bv. 3 str. 686] Length = 137
>gi|261756168|ref|ZP_05999877.1| flagellar hook capping protein [Brucella sp. F5/99] Length = 137
>gi|265987188|ref|ZP_06099745.1| flagellar hook capping protein [Brucella pinnipedialis M292/94/1] Length = 137
>gi|265989296|ref|ZP_06101853.1| flagellar hook capping protein [Brucella melitensis bv. 1 str. Rev.1] Length = 137
>gi|265993608|ref|ZP_06106165.1| flagellar hook capping protein [Brucella melitensis bv. 3 str. Ether] Length = 137
>gi|265996851|ref|ZP_06109408.1| flagellar hook capping protein [Brucella ceti M490/95/1] Length = 137
>gi|297250156|ref|ZP_06933857.1| flagellar hook capping protein [Brucella abortus bv. 5 str. B3196] Length = 137
>gi|17984300|gb|AAL53405.1| basal-body rod modification protein flgd [Brucella melitensis bv. 1 str. 16M] Length = 137
>gi|23464513|gb|AAN34294.1| basal-body rod modification protein FlgD, putative [Brucella suis 1330] Length = 137
>gi|62198145|gb|AAX76444.1| hypothetical FlgD basal-body rod modification protein [Brucella abortus bv. 1 str. 9-941] Length = 137
>gi|82940203|emb|CAJ13259.1| ATP/GTP-binding site motif A (P-loop):Flagellar hook capping protein [Brucella melitensis biovar Abortus 2308] Length = 137
>gi|148369200|gb|ABQ62072.1| putative basal-body rod modification protein FlgD [Brucella ovis ATCC 25840] Length = 137
>gi|161337988|gb|ABX64292.1| flagellar hook capping protein [Brucella canis ATCC 23365] Length = 137
>gi|163676175|gb|ABY40285.1| Hypothetical protein, conserved [Brucella suis ATCC 23445] Length = 137
>gi|189021777|gb|ACD74498.1| Flagellar hook capping protein [Brucella abortus S19] Length = 137
>gi|225616270|gb|EEH13318.1| flagellar basal body rod modification protein [Brucella ceti str. Cudo] Length = 137
>gi|225642985|gb|ACO02898.1| flagellar hook capping protein [Brucella melitensis ATCC 23457] Length = 137
>gi|255998553|gb|ACU50240.1| flagellar basal body rod modification protein [Brucella microti CCM 4915] Length = 137
>gi|260097408|gb|EEW81282.1| flagellar hook capping protein [Brucella abortus NCTC 8038] Length = 137
>gi|260151741|gb|EEW86834.1| flagellar hook capping protein [Brucella melitensis bv. 1 str. 16M] Length = 137
>gi|260155384|gb|EEW90465.1| flagellar hook capping protein [Brucella suis bv. 4 str. 40] Length = 137
>gi|260669706|gb|EEX56646.1| flagellar hook capping protein [Brucella abortus bv. 4 str. 292] Length = 137
>gi|260673052|gb|EEX59873.1| flagellar hook capping protein [Brucella abortus bv. 2 str. 86/8/59] Length = 137
>gi|260677355|gb|EEX64176.1| flagellar hook capping protein [Brucella abortus bv. 6 str. 870] Length = 137
>gi|260872579|gb|EEX79648.1| flagellar hook capping protein [Brucella abortus bv. 9 str. C68] Length = 137
>gi|260917046|gb|EEX83907.1| flagellar hook capping protein [Brucella abortus bv. 3 str. Tulya] Length = 137
>gi|260918392|gb|EEX85045.1| flagellar hook capping protein [Brucella ceti B1/94] Length = 137
>gi|260921661|gb|EEX88229.1| flagellar hook capping protein [Brucella ceti M13/05/1] Length = 137
>gi|261292132|gb|EEX95628.1| flagellar hook capping protein [Brucella ceti M644/93/1] Length = 137
>gi|261298028|gb|EEY01525.1| flagellar hook capping protein [Brucella pinnipedialis B2/94] Length = 137
>gi|261299769|gb|EEY03266.1| flagellar hook capping protein [Brucella neotomae 5K33] Length = 137
>gi|261302981|gb|EEY06478.1| flagellar hook capping protein [Brucella pinnipedialis M163/99/10] Length = 137
>gi|261736152|gb|EEY24148.1| flagellar hook capping protein [Brucella sp. F5/99] Length = 137
>gi|261739450|gb|EEY27376.1| flagellar hook capping protein [Brucella suis bv. 5 str. 513] Length = 137
>gi|261742694|gb|EEY30620.1| flagellar hook capping protein [Brucella suis bv. 3 str. 686] Length = 137
>gi|262551148|gb|EEZ07309.1| flagellar hook capping protein [Brucella ceti M490/95/1] Length = 137
>gi|262764478|gb|EEZ10510.1| flagellar hook capping protein [Brucella melitensis bv. 3 str. Ether] Length = 137
>gi|262999965|gb|EEZ12655.1| flagellar hook capping protein [Brucella melitensis bv. 1 str. Rev.1] Length = 137
>gi|263091467|gb|EEZ16003.1| flagellar hook capping protein [Brucella melitensis bv. 2 str. 63/9] Length = 137
>gi|264659385|gb|EEZ29646.1| flagellar hook capping protein [Brucella pinnipedialis M292/94/1] Length = 137
>gi|297174025|gb|EFH33389.1| flagellar hook capping protein [Brucella abortus bv. 5 str. B3196] Length = 137
>gi|326411298|gb|ADZ68362.1| flagellar basal body rod modification protein [Brucella melitensis M28] Length = 137
>gi|326554587|gb|ADZ89226.1| flagellar basal body rod modification protein [Brucella melitensis M5-90] Length = 137
Score = 117 bits (294), Expect = 4e-25, Method: Compositional matrix adjust.
Identities = 56/111 (50%), Positives = 82/111 (73%)
Query: 20 KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
K ++ D+FLKLL+TQ+++QDPT+PM ++ V+QLA FS +EQSVQMNS L+ L+ + +L
Sbjct: 27 KASVDYDSFLKLLVTQMQNQDPTQPMDPTQYVSQLATFSNVEQSVQMNSKLETLIANTSL 86
Query: 80 AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
QA +IG+ +TNADGSISGVV ++ + S+G+ A D + I G+RIS
Sbjct: 87 TQAEGWIGRTLTNADGSISGVVKSVTIQSSGMLAELEDGKTLTIGEGVRIS 137