RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780520|ref|YP_003064933.1| flagellar basal body rod modification protein [Candidatus Liberibacter asiaticus str. psy62] (131 letters) >gnl|CDD|146544 pfam03963, FlgD, Flagellar hook capping protein. FlgD is known to be absolutely required for hook assembly, yet it has not been detected in the mature flagellum. It appears to act as a hook-capping protein to enable assembly of hook protein subunits. Length = 140 Score = 85.1 bits (211), Expect = 5e-18 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 3/80 (3%) Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73 +KS S L +D FLKLL Q+++QDP PM +E +AQLA FS +EQ +N+TL+ L Sbjct: 18 AKSTSSSELDKDDFLKLLTAQLQNQDPLNPMDNTEFIAQLAQFSTVEQIQNLNTTLESLA 77 Query: 74 --LKSNNLAQASSYIGKNIT 91 ++S+ QASS IGK + Sbjct: 78 ASMQSSQALQASSLIGKTVL 97 >gnl|CDD|32028 COG1843, FlgD, Flagellar hook capping protein [Cell motility and secretion]. Length = 222 Score = 81.2 bits (200), Expect = 8e-17 Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 3/132 (2%) Query: 3 INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62 + T + + S +LG+D FLKLLI Q+K+QDPT PM +E ++QLA FSQ+EQ Sbjct: 9 TSASTITTNSKTDSTSSNASLGKDDFLKLLIAQLKNQDPTNPMDNTEFISQLAQFSQVEQ 68 Query: 63 SVQMNSTLQELLKSNN---LAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNT 119 MN+TL+ L QAS+ IGK + ADG ++ V ++ T A Sbjct: 69 MENMNTTLESLSSQMTSSQTLQASNLIGKTVMVADGKVTLVDGTVKFVVTLPQAANNVGI 128 Query: 120 EIPITTGIRISN 131 EI G+ + Sbjct: 129 EITDGNGVVVRT 140 >gnl|CDD|146351 pfam03666, NPR3, Nitrogen Permease regulator of amino acid transport activity 3. This family, also known in yeasts as Rmd11, complexes with NPR2, pfam06218. This complex heterodimer is responsible for inactivating TORC1. an evolutionarily conserved protein complex that controls cell size via nutritional input signals, specifically, in response to amino acid starvation. Length = 424 Score = 25.4 bits (56), Expect = 4.4 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Query: 60 MEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVN 102 EQS ++ S +E+L ++LA+A ++I S SG+ N Sbjct: 164 REQSQKLESLYEEILSKSSLARALKDCYESI-----STSGIAN 201 >gnl|CDD|176978 CHL00037, petA, cytochrome f. Length = 320 Score = 25.7 bits (57), Expect = 4.6 Identities = 13/46 (28%), Positives = 20/46 (43%), Gaps = 12/46 (26%) Query: 75 KSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120 KSNN + NA + +G+V+ I G IT+ +T Sbjct: 200 KSNN----------TVYNA--TAAGIVSKILRKEKGGYEITIVDTS 233 >gnl|CDD|37230 KOG2019, KOG2019, KOG2019, Metalloendoprotease HMP1 (insulinase superfamily) [General function prediction only, Posttranslational modification, protein turnover, chaperones]. Length = 998 Score = 25.3 bits (55), Expect = 5.1 Identities = 13/44 (29%), Positives = 18/44 (40%) Query: 11 QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQL 54 Q E S G ++ I DP EP+K EQ+ +L Sbjct: 418 QIEISLKHQSTGFGLSLMQSIISKWINDMDPFEPLKFEEQLKKL 461 >gnl|CDD|143862 pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC). superoxide dismutases (SODs) catalyse the conversion of superoxide radicals to hydrogen peroxide and molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the copper/zinc-binding family is one. Defects in the human SOD1 gene cause familial amyotrophic lateral sclerosis (Lou Gehrig's disease). Structure is an eight-stranded beta sandwich, similar to the immunoglobulin fold. Length = 140 Score = 24.9 bits (55), Expect = 6.6 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Query: 90 ITNADGSISGVVNAIQVSSTGLTAITVD 117 + ADG + G V QV G+ +TVD Sbjct: 5 LKGADGKVVGTVTFTQVGGGGVL-VTVD 31 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.307 0.121 0.306 Gapped Lambda K H 0.267 0.0732 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,192,232 Number of extensions: 47130 Number of successful extensions: 81 Number of sequences better than 10.0: 1 Number of HSP's gapped: 79 Number of HSP's successfully gapped: 13 Length of query: 131 Length of database: 6,263,737 Length adjustment: 83 Effective length of query: 48 Effective length of database: 4,470,190 Effective search space: 214569120 Effective search space used: 214569120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits) S2: 52 (23.8 bits)