RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780520|ref|YP_003064933.1| flagellar basal body rod modification protein [Candidatus Liberibacter asiaticus str. psy62] (131 letters) >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Length = 256 Score = 28.1 bits (62), Expect = 0.25 Identities = 5/66 (7%), Positives = 20/66 (30%), Gaps = 13/66 (19%) Query: 25 QDAFLKLLITQIKHQDPTEPMK-------------ASEQVAQLAVFSQMEQSVQMNSTLQ 71 ++ L + +E + S + + F + + ++ Sbjct: 190 REKMFLCLDEYCRRSRSSEEGRFAALLLRLPALRSISLKSFEHLFFFHLVADTSIAGYIR 249 Query: 72 ELLKSN 77 + L+++ Sbjct: 250 DALRNH 255 >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Length = 230 Score = 24.7 bits (53), Expect = 2.7 Identities = 9/65 (13%), Positives = 24/65 (36%), Gaps = 13/65 (20%) Query: 25 QDAFLKLLITQIKHQDPTEPMK-------------ASEQVAQLAVFSQMEQSVQMNSTLQ 71 ++ L KH+ P +P + + + F ++ +++ L Sbjct: 165 REKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLM 224 Query: 72 ELLKS 76 E+L++ Sbjct: 225 EMLEA 229 >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Score = 24.7 bits (53), Expect = 2.7 Identities = 8/67 (11%), Positives = 22/67 (32%), Gaps = 13/67 (19%) Query: 25 QDAFLKLLITQIKHQDPTEPMK-------------ASEQVAQLAVFSQMEQSVQMNSTLQ 71 + L I + + + Q+ + F ++ ++++ LQ Sbjct: 167 RSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQ 226 Query: 72 ELLKSNN 78 E+L + Sbjct: 227 EMLLGGS 233 >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 Score = 23.9 bits (51), Expect = 4.6 Identities = 7/74 (9%), Positives = 23/74 (31%), Gaps = 13/74 (17%) Query: 16 KSKSKKTLGQDAFLKLLITQIKHQDPTEPMK-------------ASEQVAQLAVFSQMEQ 62 KS+++ + ++ L + + P + + S + ++ Sbjct: 187 KSRAEIEMCREKVYACLDEHCRLEHPGDDGRFAQLLLRLPALRSISLKCQDHLFLFRITS 246 Query: 63 SVQMNSTLQELLKS 76 + E L++ Sbjct: 247 DRPLEELFLEQLEA 260 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.307 0.121 0.306 Gapped Lambda K H 0.267 0.0530 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 368,210 Number of extensions: 12941 Number of successful extensions: 28 Number of sequences better than 10.0: 1 Number of HSP's gapped: 28 Number of HSP's successfully gapped: 8 Length of query: 131 Length of database: 2,407,596 Length adjustment: 76 Effective length of query: 55 Effective length of database: 1,364,116 Effective search space: 75026380 Effective search space used: 75026380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits) S2: 48 (22.7 bits)