Query gi|254780521|ref|YP_003064934.1| flagellar biosynthesis repressor FlbT [Candidatus Liberibacter asiaticus str. psy62] Match_columns 153 No_of_seqs 103 out of 135 Neff 4.9 Searched_HMMs 39220 Date Sun May 29 22:51:08 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780521.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK00794 flbT flagellar biosyn 100.0 0 0 335.2 17.3 132 2-133 1-132 (133) 2 COG5443 FlbT Flagellar biosynt 100.0 0 0 333.6 14.4 148 1-148 1-148 (148) 3 pfam07378 FlbT Flagellar prote 100.0 3.2E-44 0 317.7 16.2 125 5-129 1-126 (126) 4 PRK12791 flbT flagellar biosyn 100.0 1.1E-33 2.8E-38 247.1 12.8 112 21-135 1-113 (113) 5 TIGR00266 TIGR00266 conserved 90.6 0.34 8.7E-06 29.1 3.7 32 2-33 11-43 (230) 6 pfam09890 DUF2117 Uncharacteri 84.0 1.3 3.3E-05 25.2 3.5 26 9-34 94-121 (209) 7 pfam02599 CsrA Global regulato 82.3 3.4 8.7E-05 22.4 5.1 37 5-41 2-45 (53) 8 PRK01712 carbon storage regula 78.0 5.4 0.00014 21.1 4.9 38 5-42 2-46 (64) 9 PRK00568 carbon storage regula 72.9 8 0.0002 19.9 4.7 38 5-42 2-46 (76) 10 COG4069 Uncharacterized protei 67.8 9.4 0.00024 19.5 4.1 30 6-35 163-195 (367) 11 TIGR00739 yajC preprotein tran 55.4 16 0.00042 17.9 3.5 41 5-45 34-81 (86) 12 TIGR02422 protocat_beta protoc 51.3 9.5 0.00024 19.4 1.8 19 11-29 61-80 (224) 13 TIGR01941 nqrF NADH:ubiquinone 49.4 12 0.00031 18.8 2.1 22 2-23 255-276 (425) 14 KOG2176 consensus 47.4 24 0.00061 16.7 3.7 26 95-120 141-166 (800) 15 COG4178 ABC-type uncharacteriz 39.6 23 0.0006 16.8 2.3 18 3-20 410-427 (604) 16 PRK10316 hypothetical protein; 39.0 32 0.00082 15.9 3.1 73 47-119 119-194 (209) 17 PRK09919 hypothetical protein; 39.0 32 0.00082 15.9 4.1 32 7-38 37-69 (114) 18 PRK01474 atpC F0F1 ATP synthas 34.4 38 0.00097 15.4 3.8 29 3-31 40-82 (112) 19 pfam00263 Secretin Bacterial t 32.7 40 0.001 15.2 3.4 36 5-40 102-139 (164) 20 COG1482 ManA Phosphomannose is 32.4 41 0.001 15.2 3.8 46 6-51 159-206 (312) 21 TIGR01966 RNasePH ribonuclease 31.5 31 0.00079 16.0 1.9 26 17-42 23-53 (237) 22 PRK06531 yajC preprotein trans 31.2 43 0.0011 15.1 2.9 48 7-54 35-92 (120) 23 TIGR02461 osmo_MPG_phos mannos 31.1 21 0.00053 17.2 0.9 16 7-22 53-70 (248) 24 TIGR02124 hypE hydrogenase exp 30.8 24 0.00061 16.8 1.2 67 8-88 165-243 (345) 25 TIGR01511 ATPase-IB1_Cu copper 30.5 30 0.00077 16.1 1.7 19 6-24 99-117 (545) 26 pfam09894 DUF2121 Uncharacteri 29.5 22 0.00056 17.0 0.8 14 72-85 148-161 (194) 27 COG3179 Predicted chitinase [G 29.2 32 0.00081 15.9 1.6 47 43-90 29-75 (206) 28 COG2013 Uncharacterized conser 28.9 47 0.0012 14.8 4.2 28 2-29 16-44 (227) 29 COG2217 ZntA Cation transport 28.2 48 0.0012 14.7 2.4 24 4-27 233-256 (713) 30 TIGR00802 nico transition meta 28.1 23 0.00057 16.9 0.7 12 51-62 222-233 (290) 31 pfam02699 YajC Preprotein tran 27.3 50 0.0013 14.6 4.0 39 7-45 36-79 (83) 32 pfam03186 CobD_Cbib CobD/Cbib 26.6 51 0.0013 14.5 5.2 62 84-145 85-146 (290) 33 PRK01209 cobD cobalamin biosyn 25.5 37 0.00095 15.5 1.4 61 85-145 88-148 (307) 34 PRK12655 fructose-6-phosphate 25.0 39 0.001 15.3 1.4 74 64-148 3-78 (220) 35 KOG0815 consensus 25.0 34 0.00086 15.7 1.1 26 26-51 148-173 (245) 36 TIGR01525 ATPase-IB_hvy heavy 24.6 48 0.0012 14.7 1.8 20 6-25 94-113 (639) 37 COG2871 NqrF Na+-transporting 23.7 57 0.0015 14.2 2.2 35 2-36 247-285 (410) 38 cd06495 p23_NUDCD3_like p23-li 23.7 58 0.0015 14.2 2.1 41 2-42 38-84 (102) 39 pfam10255 Paf67 RNA polymerase 23.5 52 0.0013 14.5 1.8 20 101-120 129-148 (402) 40 TIGR01480 copper_res_A copper- 23.1 47 0.0012 14.8 1.6 14 10-23 279-295 (644) 41 COG4568 Rof Transcriptional an 23.0 57 0.0014 14.2 2.0 41 3-43 24-67 (84) 42 PRK05585 yajC preprotein trans 23.0 59 0.0015 14.1 3.5 39 6-44 51-94 (107) 43 pfam04631 Baculo_44 Baculoviru 23.0 59 0.0015 14.1 2.3 21 3-23 101-121 (372) 44 cd03464 3,4-PCD_beta Protocate 22.8 60 0.0015 14.1 2.1 23 11-33 62-88 (220) 45 PRK00708 sec-independent trans 22.4 61 0.0016 14.0 5.2 47 57-105 11-57 (197) 46 TIGR00875 talC transaldolase, 22.3 61 0.0016 14.0 2.2 52 63-124 2-54 (216) 47 TIGR01367 pyrE_Therm orotate p 22.1 62 0.0016 14.0 2.2 16 8-23 107-122 (205) 48 COG4079 Uncharacterized protei 21.8 54 0.0014 14.4 1.6 16 71-86 148-163 (293) 49 pfam06466 PCAF_N PCAF (P300/CB 21.6 44 0.0011 15.0 1.2 10 110-119 113-122 (252) 50 COG1838 FumA Tartrate dehydrat 21.3 64 0.0016 13.9 2.1 20 7-26 14-34 (184) 51 KOG0344 consensus 21.3 64 0.0016 13.9 2.8 71 34-108 254-336 (593) No 1 >PRK00794 flbT flagellar biosynthesis repressor FlbT; Reviewed Probab=100.00 E-value=0 Score=335.16 Aligned_cols=132 Identities=42% Similarity=0.650 Sum_probs=129.4 Q ss_pred CCCEEEEECCCCEEEEEEEEEEECCEEEEEEECCCCEEEHHHCCCHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHH Q ss_conf 98658998789889981026741884899997265223157507977704658999999999995767968899999999 Q gi|254780521|r 2 NSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRY 81 (153) Q Consensus 2 ~s~Lkl~LKpgERi~INGAVi~~drr~~l~i~n~a~iLre~dil~~eeA~TP~rrlYf~vQ~mll~p~~~~~~~~~~~~~ 81 (153) +|||||+||||||||||||||+||||++|+|+|+|+||||+|||||||||||+||+||++|+||++|++.++++..|.+. T Consensus 1 ~~gLkl~LKpgERi~INGAVi~ndrr~~l~i~n~a~iLre~dil~~eeA~TP~rrlYf~vQ~m~l~p~~~~~~~~~~~~~ 80 (133) T PRK00794 1 KSGLVLSLKPGERIFINGAVLRNDRKVRLELLNDATFLLERHVLQPEEATTPLRQLYFAAQLMLIGPADADDARAQFARR 80 (133) T ss_pred CCCEEEEECCCCEEEECCEEEECCCEEEEEEEECCCCHHHHHCCCHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHH T ss_conf 99627985699889984849982880589997067010123048966568879999999999984877758999999999 Q ss_pred HHHHHHCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCC Q ss_conf 9999831399899999999999986892899999997488999997336898 Q gi|254780521|r 82 INILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAI 133 (153) Q Consensus 82 i~~l~~a~~~~~~~~~L~~~~~~V~~g~~Y~ALK~lR~Li~~E~~ll~~~~~ 133 (153) +++|+++|++|++++.|.+|+++|.+|+||+|||++|+||+||+++|++.++ T Consensus 81 ~~~l~~~~~~~~~~~~l~~i~~~v~~g~~Y~ALK~~R~L~~~E~~lL~~~~~ 132 (133) T PRK00794 81 LEGLLAVFKDPDILAGLKAIDELVEAGRYYEALKAIRALYPIEAEILAAVPA 132 (133) T ss_pred HHHHHHHHCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCC T ss_conf 9999998689999999999999997788999999998789999999744899 No 2 >COG5443 FlbT Flagellar biosynthesis regulator FlbT [Cell motility and secretion] Probab=100.00 E-value=0 Score=333.61 Aligned_cols=148 Identities=43% Similarity=0.701 Sum_probs=147.4 Q ss_pred CCCCEEEEECCCCEEEEEEEEEEECCEEEEEEECCCCEEEHHHCCCHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHH Q ss_conf 99865899878988998102674188489999726522315750797770465899999999999576796889999999 Q gi|254780521|r 1 MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRR 80 (153) Q Consensus 1 m~s~Lkl~LKpgERi~INGAVi~~drr~~l~i~n~a~iLre~dil~~eeA~TP~rrlYf~vQ~mll~p~~~~~~~~~~~~ 80 (153) |+++|||+|||||||||||||+|+|||++|+++|||+||+|+||||||+|+||+||+||++|||||+|+.+++..++|+. T Consensus 1 mk~tlriSLk~gEki~iNGAVlr~DRkv~lellNdvtfLlEnhVlQpdqaTTPlRqlYF~aqmmlinp~gaeq~~~~F~~ 80 (148) T COG5443 1 MKSTLRISLKPGEKIFINGAVLRVDRKVALELLNDVTFLLENHVLQPDQATTPLRQLYFIAQMMLINPAGAEQATEMFRK 80 (148) T ss_pred CCCCEEEEECCCCEEEEECCEEEEECEEEEEEECCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHH T ss_conf 99755886358977998441899705257775331057787414781014772899999999995188667889999999 Q ss_pred HHHHHHHCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCH Q ss_conf 99999831399899999999999986892899999997488999997336898852156524652002 Q gi|254780521|r 81 YINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQEIKSW 148 (153) Q Consensus 81 ~i~~l~~a~~~~~~~~~L~~~~~~V~~g~~Y~ALK~lR~Li~~E~~ll~~~~~~p~~~~~i~~~~~~~ 148 (153) .+..++++|.+++++..|..|+.+|.+|++|+|||++|+|++||+++|++++..|+.++|++++.+|| T Consensus 81 ~l~~l~~~f~~~eil~~lk~Id~lV~~~~~feALkaiR~lyp~E~e~lg~q~~v~~~v~~g~~~ga~~ 148 (148) T COG5443 81 SLNMLLACFKDAEILAALKRIDGLVMAGRAFEALKAIRGLYPIEDEILGAQEHVPATVEQGRKAGAPW 148 (148) T ss_pred HHHHHHHHHCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCHHHHHHCCCCCCCCCCCCHHHHCCCCC T ss_conf 99999988277999999999998873438999999986004268987188887774400133246998 No 3 >pfam07378 FlbT Flagellar protein FlbT. This family consists of several FlbT proteins. FlbT is a post-transcriptional regulator of flagellin. FlbT is associated with the 5' untranslated region (UTR) of fljK (25 kDa flagellin) mRNA and that this association requires a predicted loop structure in the transcript. Mutations within this loop abolish FlbT association and result in increased mRNA stability. It is therefore thought that FlbT promotes the degradation of flagellin mRNA by associating with the 5' UTR. Probab=100.00 E-value=3.2e-44 Score=317.69 Aligned_cols=125 Identities=31% Similarity=0.492 Sum_probs=122.9 Q ss_pred EEEEECCCCEEEEEEEEEE-ECCEEEEEEECCCCEEEHHHCCCHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH Q ss_conf 5899878988998102674-188489999726522315750797770465899999999999576796889999999999 Q gi|254780521|r 5 LRISLKAGERIFLNGAVVR-VNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYIN 83 (153) Q Consensus 5 Lkl~LKpgERi~INGAVi~-~drr~~l~i~n~a~iLre~dil~~eeA~TP~rrlYf~vQ~mll~p~~~~~~~~~~~~~i~ 83 (153) |||+|||||||+||||||+ ||||++|+|+|+|+||||+|||||||||||+||+||++|+||++|++.++++..|.+.++ T Consensus 1 Lkl~LKp~Eri~INGAVi~Ngdrr~~l~i~n~a~iLre~dil~~eeA~TP~rrlYf~vQ~m~l~p~~~~~~~~~~~~~~~ 80 (126) T pfam07378 1 LKLSLKPGERIIINGAVIRNGDRRSRLEIENDAPILREKDILQPEDATTPVRRLYFAVQLMLIGPEDRDDARALFLELLE 80 (126) T ss_pred CEEEECCCCEEEECCEEEEECCCCEEEEEECCCCEECHHHCCCHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH T ss_conf 93560799889985858870797348999617813113304896656887999999999998587566899999999999 Q ss_pred HHHHCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHC Q ss_conf 9983139989999999999998689289999999748899999733 Q gi|254780521|r 84 ILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPN 129 (153) Q Consensus 84 ~l~~a~~~~~~~~~L~~~~~~V~~g~~Y~ALK~lR~Li~~E~~ll~ 129 (153) ++++++.+|++++.|.+|+++|.+|+||+|||++|+||+||+++|+ T Consensus 81 ~l~~~~~~p~~~~~l~~~~~~V~~g~~y~ALK~~R~Li~~E~~ll~ 126 (126) T pfam07378 81 ELSAAFADPDSRALLDEATELVLAGRYYKALKALRKLIPYEEELLA 126 (126) T ss_pred HHHHHHCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHC T ss_conf 9998755988999999999999779899999999888899999719 No 4 >PRK12791 flbT flagellar biosynthesis repressor FlbT; Reviewed Probab=100.00 E-value=1.1e-33 Score=247.08 Aligned_cols=112 Identities=20% Similarity=0.257 Sum_probs=104.8 Q ss_pred EEE-ECCEEEEEEECCCCEEEHHHCCCHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHH Q ss_conf 674-1884899997265223157507977704658999999999995767968899999999999983139989999999 Q gi|254780521|r 21 VVR-VNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALK 99 (153) Q Consensus 21 Vi~-~drr~~l~i~n~a~iLre~dil~~eeA~TP~rrlYf~vQ~mll~p~~~~~~~~~~~~~i~~l~~a~~~~~~~~~L~ 99 (153) ||+ ||||++|+|+|+|+||||||||||||||||+||+||++|+||++|+ .+.+...|.+.+.+++.++ |+.+..+. T Consensus 1 Vi~Ngdrrs~l~i~n~a~iLRekDil~~eeA~TP~rrvYf~vQ~myl~~d-~~~~~~~~~~~~~~l~~~~--p~~~~~l~ 77 (113) T PRK12791 1 VITNSDTRARFLIDGDAPILREKDILTAETADTPAKRVYLCVQLMYLSND-IPAYHGTYLGLIRELIEAV--PSAWPIIE 77 (113) T ss_pred CEECCCCCEEEEEECCCHHHHHHHCCCHHHCCCHHHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHHHHHC--CHHHHHHH T ss_conf 94278875268973797035542027965469869999999999982886-0778999999999999869--24799999 Q ss_pred HHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCC Q ss_conf 999998689289999999748899999733689885 Q gi|254780521|r 100 NIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFA 135 (153) Q Consensus 100 ~~~~~V~~g~~Y~ALK~lR~Li~~E~~ll~~~~~~p 135 (153) +|+++|.+|+||+|||+||+||+||+++|++.+++| T Consensus 78 ~i~~~V~~g~~Y~ALK~~R~Li~~E~~lL~~~~~~p 113 (113) T PRK12791 78 AINNHILNGDLYKALKELRKLIAREEKLLARAEATP 113 (113) T ss_pred HHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCC T ss_conf 999999686199999999877899999983588998 No 5 >TIGR00266 TIGR00266 conserved hypothetical protein TIGR00266; InterPro: IPR002838 The proteins in this family have no known function.. Probab=90.59 E-value=0.34 Score=29.13 Aligned_cols=32 Identities=28% Similarity=0.401 Sum_probs=24.8 Q ss_pred CCCEEEEECCCCEEEEEEEEEE-ECCEEEEEEE Q ss_conf 9865899878988998102674-1884899997 Q gi|254780521|r 2 NSPLRISLKAGERIFLNGAVVR-VNNKVILELL 33 (153) Q Consensus 2 ~s~Lkl~LKpgERi~INGAVi~-~drr~~l~i~ 33 (153) .|-|.|+|||||+++||--++- =|+...+.=+ T Consensus 11 ys~l~~~LkPge~v~~~~g~~~~M~~~v~l~~~ 43 (230) T TIGR00266 11 YSMLELTLKPGERVLAETGAMVSMDRSVELSTE 43 (230) T ss_pred EEEEEEEECCCCEEEECCCCEEEECCCEEEEEE T ss_conf 148998808885899727707985187799974 No 6 >pfam09890 DUF2117 Uncharacterized protein conserved in archaea (DUF2117). This domain, found in various hypothetical archaeal proteins, has no known function. Probab=84.04 E-value=1.3 Score=25.21 Aligned_cols=26 Identities=35% Similarity=0.470 Sum_probs=21.8 Q ss_pred ECCCCEEEEEEEEEE-E-CCEEEEEEEC Q ss_conf 878988998102674-1-8848999972 Q gi|254780521|r 9 LKAGERIFLNGAVVR-V-NNKVILELLN 34 (153) Q Consensus 9 LKpgERi~INGAVi~-~-drr~~l~i~n 34 (153) --|||.|++||-||- + +..++|..+| T Consensus 94 v~pGE~I~VNGiVIG~a~s~~V~lvaen 121 (209) T pfam09890 94 VFPGENIMVNGIVIGKATSSEVELVSEN 121 (209) T ss_pred ECCCCCEEEEEEEEEEECCCCEEEEEEC T ss_conf 0899947994189988648837999819 No 7 >pfam02599 CsrA Global regulator protein family. This is a family of global regulator proteins. This protein is a RNA-binding protein and a global regulator of carbohydrate metabolism genes facilitating mRNA decay. In E. coli CsrA binds the CsrB RNA molecule to form the Csr regulatory system which has a strong negative regulatory effect on glycogen biosynthesis, glyconeogenesis and glycogen catabolism and a positive regulatory effect on glycolysis. In other bacteria such as Erwinia caratovara RmsA has been shown to regulate the production of virulence determinants, such extracellular enzymes. RmsA binds to RmsB regulatory RNA. Probab=82.35 E-value=3.4 Score=22.42 Aligned_cols=37 Identities=19% Similarity=0.367 Sum_probs=30.2 Q ss_pred EEEEECCCCEEEEEEEE----EE-ECCEEEEEEEC--CCCEEEH Q ss_conf 58998789889981026----74-18848999972--6522315 Q gi|254780521|r 5 LRISLKAGERIFLNGAV----VR-VNNKVILELLN--DITFILE 41 (153) Q Consensus 5 Lkl~LKpgERi~INGAV----i~-~drr~~l~i~n--~a~iLre 41 (153) |.|+=|+||.|+||+-. +. .+..+++-|+. +++|+|+ T Consensus 2 LvLtRk~gE~I~Igd~I~i~Vl~i~~~~VrlGi~AP~~v~I~R~ 45 (53) T pfam02599 2 LVLTRKVGESIVIGDDIEITVLEVKGGQVRIGIEAPKEVSIHRE 45 (53) T ss_pred CEEEEECCCEEEECCCEEEEEEEEECCEEEEEEECCCCCCEEHH T ss_conf 27861389989969998999999709989999988999919589 No 8 >PRK01712 carbon storage regulator; Provisional Probab=77.99 E-value=5.4 Score=21.09 Aligned_cols=38 Identities=16% Similarity=0.364 Sum_probs=31.2 Q ss_pred EEEEECCCCEEEEEEEE----EE-ECCEEEEEEEC--CCCEEEHH Q ss_conf 58998789889981026----74-18848999972--65223157 Q gi|254780521|r 5 LRISLKAGERIFLNGAV----VR-VNNKVILELLN--DITFILEH 42 (153) Q Consensus 5 Lkl~LKpgERi~INGAV----i~-~drr~~l~i~n--~a~iLre~ 42 (153) |.|+=|+||.|+||+-+ +. .+..++|-|+. +++|+|+- T Consensus 2 LVLtRk~gEsI~Ig~~I~i~Vl~i~g~~VrlGI~AP~~v~I~R~E 46 (64) T PRK01712 2 LILTRRVGESLMIGDDIEVTVLGVKGNQVRIGINAPKEVSVHREE 46 (64) T ss_pred CEEEEECCCEEEECCCEEEEEEEECCCEEEEEEECCCCCCEEHHH T ss_conf 158420899799699979999998299899989889998190999 No 9 >PRK00568 carbon storage regulator; Provisional Probab=72.94 E-value=8 Score=19.94 Aligned_cols=38 Identities=18% Similarity=0.240 Sum_probs=30.9 Q ss_pred EEEEECCCCEEEEEEEE----EE-ECCEEEEEEEC--CCCEEEHH Q ss_conf 58998789889981026----74-18848999972--65223157 Q gi|254780521|r 5 LRISLKAGERIFLNGAV----VR-VNNKVILELLN--DITFILEH 42 (153) Q Consensus 5 Lkl~LKpgERi~INGAV----i~-~drr~~l~i~n--~a~iLre~ 42 (153) |.|+=|+||.|+||+-+ +. .+..+++-|+. +++|+|+- T Consensus 2 LVLtRK~gEsI~IgddI~i~Vv~i~g~~VrlGI~AP~~v~I~R~E 46 (76) T PRK00568 2 LILSRKVNEGIVIDDNIHIKVISIDRGSVRLGFEAPESTLILRAE 46 (76) T ss_pred CEEECCCCCEEEECCCEEEEEEEECCCEEEEEEECCCCCEEEHHH T ss_conf 037533898589579869999997399799989879987683999 No 10 >COG4069 Uncharacterized protein conserved in archaea [Function unknown] Probab=67.83 E-value=9.4 Score=19.47 Aligned_cols=30 Identities=43% Similarity=0.547 Sum_probs=24.1 Q ss_pred EEE-ECCCCEEEEEEEEEE-E-CCEEEEEEECC Q ss_conf 899-878988998102674-1-88489999726 Q gi|254780521|r 6 RIS-LKAGERIFLNGAVVR-V-NNKVILELLND 35 (153) Q Consensus 6 kl~-LKpgERi~INGAVi~-~-drr~~l~i~n~ 35 (153) +++ .-|||+|++||-|+. + .+-+.|+.+|. T Consensus 163 ri~gv~pgenIlVnGIvVGkA~S~~V~LVaEnG 195 (367) T COG4069 163 RISGVFPGENILVNGIVVGKATSSEVELVAENG 195 (367) T ss_pred EEECCCCCCCEEEEEEEEEEECCCCEEEEEECC T ss_conf 874026886368941798665157469996186 No 11 >TIGR00739 yajC preprotein translocase, YajC subunit; InterPro: IPR003849 This entry describes proteins of unknown function.. Probab=55.39 E-value=16 Score=17.87 Aligned_cols=41 Identities=20% Similarity=0.365 Sum_probs=24.6 Q ss_pred EEEEECCCCEEEEEEEEE----E-ECCEEEEEEEC--CCCEEEHHHCC Q ss_conf 589987898899810267----4-18848999972--65223157507 Q gi|254780521|r 5 LRISLKAGERIFLNGAVV----R-VNNKVILELLN--DITFILEHHVI 45 (153) Q Consensus 5 Lkl~LKpgERi~INGAVi----~-~drr~~l~i~n--~a~iLre~dil 45 (153) |.=+||+||+++.+|-++ . +|+.-.+.|++ +..+---|+.+ T Consensus 34 l~~~L~KGd~V~T~gGi~G~V~~i~e~~~~i~i~~~~~t~~~~~K~aI 81 (86) T TIGR00739 34 LIESLKKGDKVLTIGGIIGTVTKIAENTNNIVIELNDNTEITFSKNAI 81 (86) T ss_pred HHHCCCCCCEEEECCCEEEEEEEEECCCCEEEEEECCCCEEEEEHHHH T ss_conf 885279977899838838999885238867899987994899860342 No 12 >TIGR02422 protocat_beta protocatechuate 3,4-dioxygenase, beta subunit; InterPro: IPR012785 Protocatechuate (3,4-dihydroxybenzene, PCA) is an aromatic compound which is a key intermediate in the degradation of the plant biopolymer lignin and other aromatic compounds. The key step of PCA degradation is the ring-cleavage performed by dioxygenases adding both atoms from molecular oxygen to specific carbon atoms within the ring. This step can be performed by two distinct mechanisms; intradiol cleavage and extradiol cleavage. In intradiol cleavage the oxygen atoms are added to the carbons carrying the hydroxyl groups, producing two carboxylate groups. In extradiol cleavage the oxygens are added to one carbon carrying a hydroxyl group and another carrying a hydrogen, resulting in the formation of a carboxylate group and an aldehydic group. For further information see . PCA dioxygenases fall into the broader category of catechol dioxygenases. These are metalloenzymes which bind non-haeme iron. The extradiol dioxygenases use Fe(II) to activate oxygen for nucleophilic attack on the aromatic substrate, while the intradiol dioxygenases use Fe(III) to activate the aromatic substrate for an electrophilic attack by oxygen . This entry represents the beta subunit of protocatechuate 3,4-dioxygenase, an enzyme which cleaves the PCA ring by an intradiol mechanism. It is composed of two subunits, alpha (IPR012786 from INTERPRO) and beta which are highly similar in structure and are thought to share a common ancestor , , . The core of each subunit is two four-stranded beta-sheets that fold upon each other to form a beta sandwhich. The active site cavity contains the Fe(III)-binding site and is located between the two subunits. All Fe(III) ligands are contributed by the beta subunit.; GO: 0005506 iron ion binding, 0018578 protocatechuate 34-dioxygenase activity, 0019619 protocatechuate catabolic process. Probab=51.31 E-value=9.5 Score=19.43 Aligned_cols=19 Identities=37% Similarity=0.557 Sum_probs=14.8 Q ss_pred CCCEEEEEEEEE-EECCEEE Q ss_conf 898899810267-4188489 Q gi|254780521|r 11 AGERIFLNGAVV-RVNNKVI 29 (153) Q Consensus 11 pgERi~INGAVi-~~drr~~ 29 (153) =||||+|-|=|+ +.+|-+. T Consensus 61 IGERI~V~GrVlD~~GrPVp 80 (224) T TIGR02422 61 IGERIIVHGRVLDEDGRPVP 80 (224) T ss_pred CCCEEEEEEEEECCCCCCCC T ss_conf 77757897688658888588 No 13 >TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit; InterPro: IPR010205 This entry represents the NqrF subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria.; GO: 0016655 oxidoreductase activity acting on NADH or NADPH quinone or similar compound as acceptor, 0051537 2 iron 2 sulfur cluster binding, 0006814 sodium ion transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane. Probab=49.41 E-value=12 Score=18.76 Aligned_cols=22 Identities=27% Similarity=0.431 Sum_probs=18.2 Q ss_pred CCCEEEEECCCCEEEEEEEEEE Q ss_conf 9865899878988998102674 Q gi|254780521|r 2 NSPLRISLKAGERIFLNGAVVR 23 (153) Q Consensus 2 ~s~Lkl~LKpgERi~INGAVi~ 23 (153) +|+-.-+||||.||.|-|===+ T Consensus 255 ~SSYifsLKpGDKv~~sGPfGe 276 (425) T TIGR01941 255 MSSYIFSLKPGDKVTVSGPFGE 276 (425) T ss_pred EEEEEEECCCCCEEEEECCCCC T ss_conf 1333774479877799778885 No 14 >KOG2176 consensus Probab=47.36 E-value=24 Score=16.72 Aligned_cols=26 Identities=15% Similarity=0.454 Sum_probs=19.9 Q ss_pred HHHHHHHHHHHHCCCHHHHHHHHHHH Q ss_conf 99999999998689289999999748 Q gi|254780521|r 95 ILALKNIESLINSGRFFEALKNIRTL 120 (153) Q Consensus 95 ~~~L~~~~~~V~~g~~Y~ALK~lR~L 120 (153) +.......+++.+|+||.|||.+-.| T Consensus 141 LEl~sK~~e~~s~kqyy~aLktle~l 166 (800) T KOG2176 141 LELYSKLQEQMSEKQYYPALKTLESL 166 (800) T ss_pred HHHHHHHHHHHHHCCHHHHHHHHHHH T ss_conf 99999999998742378998789999 No 15 >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Probab=39.65 E-value=23 Score=16.81 Aligned_cols=18 Identities=33% Similarity=0.770 Sum_probs=15.8 Q ss_pred CCEEEEECCCCEEEEEEE Q ss_conf 865899878988998102 Q gi|254780521|r 3 SPLRISLKAGERIFLNGA 20 (153) Q Consensus 3 s~Lkl~LKpgERi~INGA 20 (153) +.+.+.++|||+++|+|- T Consensus 410 ~~l~~~v~~G~~llI~G~ 427 (604) T COG4178 410 SELNFEVRPGERLLITGE 427 (604) T ss_pred CCCEEEECCCCEEEEECC T ss_conf 465265479987998789 No 16 >PRK10316 hypothetical protein; Provisional Probab=39.02 E-value=32 Score=15.88 Aligned_cols=73 Identities=16% Similarity=0.162 Sum_probs=51.1 Q ss_pred HHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHH---HHHHHHCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHH Q ss_conf 77704658999999999995767968899999999---99998313998999999999999868928999999974 Q gi|254780521|r 47 EEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRY---INILFNIIQNQQLILALKNIESLINSGRFFEALKNIRT 119 (153) Q Consensus 47 ~eeA~TP~rrlYf~vQ~mll~p~~~~~~~~~~~~~---i~~l~~a~~~~~~~~~L~~~~~~V~~g~~Y~ALK~lR~ 119 (153) ++=+-||.|.--...=.--|.-.++....+.+..- +.......+-...+..+..+..++..|+||+|=..+++ T Consensus 119 edf~atP~K~aAia~AN~~L~~Gd~k~A~e~LklAgvdv~~~~al~PL~qT~~~V~~A~~ll~~gkyyeAn~aLk~ 194 (209) T PRK10316 119 EDYVATPEKEAAIKIANEKMAKGDKKGAIEELRLAGVGVIENQYLMPLKQTRKAVADAQKLLDKGKYYEANLALKG 194 (209) T ss_pred CCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCEEHHHHCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHH T ss_conf 5555680678999999999976787789999987487721032417816679999999999866984478999997 No 17 >PRK09919 hypothetical protein; Provisional Probab=38.98 E-value=32 Score=15.88 Aligned_cols=32 Identities=13% Similarity=0.122 Sum_probs=27.3 Q ss_pred EEECCCCEEEEEEEEEE-ECCEEEEEEECCCCE Q ss_conf 99878988998102674-188489999726522 Q gi|254780521|r 7 ISLKAGERIFLNGAVVR-VNNKVILELLNDITF 38 (153) Q Consensus 7 l~LKpgERi~INGAVi~-~drr~~l~i~n~a~i 38 (153) ..|+||+.|-+++..+- +|...-+.|.|-.++ T Consensus 37 ~~L~pG~~i~~~~~gvliN~k~~~itIynvt~y 69 (114) T PRK09919 37 VFLPPGSIFTPVKSGILLNDKEYPITIYNVTPF 69 (114) T ss_pred EEECCCCEEEECCCEEEECCCEEEEEEEEECCC T ss_conf 880899888974883898893866789984457 No 18 >PRK01474 atpC F0F1 ATP synthase subunit epsilon; Validated Probab=34.36 E-value=38 Score=15.40 Aligned_cols=29 Identities=28% Similarity=0.503 Sum_probs=17.6 Q ss_pred CCEEEEECCCC-------------EEEEEEEEEE-ECCEEEEE Q ss_conf 86589987898-------------8998102674-18848999 Q gi|254780521|r 3 SPLRISLKAGE-------------RIFLNGAVVR-VNNKVILE 31 (153) Q Consensus 3 s~Lkl~LKpgE-------------Ri~INGAVi~-~drr~~l~ 31 (153) .||.-+|+||+ +++|+|-.++ .+.++++. T Consensus 40 aplit~L~~G~v~v~~~~~~~~~~~~~V~GGfveV~~n~vtIL 82 (112) T PRK01474 40 VPMIVSLKAGLVQVYIDDMHKPENTYLISGGVTEVTGSYINIA 82 (112) T ss_pred CCEEEEECCCEEEEEECCCCCCEEEEEECCCEEEECCCEEEEE T ss_conf 1116553185899998689994799998786999819989999 No 19 >pfam00263 Secretin Bacterial type II and III secretion system protein. Probab=32.69 E-value=40 Score=15.22 Aligned_cols=36 Identities=19% Similarity=0.394 Sum_probs=27.7 Q ss_pred EEEEECCCCEEEEEEEEEEE--CCEEEEEEECCCCEEE Q ss_conf 58998789889981026741--8848999972652231 Q gi|254780521|r 5 LRISLKAGERIFLNGAVVRV--NNKVILELLNDITFIL 40 (153) Q Consensus 5 Lkl~LKpgERi~INGAVi~~--drr~~l~i~n~a~iLr 40 (153) -.+.+|.||-++|+|-.-.. +....+=++.+.|||- T Consensus 102 t~v~l~~Get~vlgGl~~~~~~~~~~gvP~L~~iP~lG 139 (164) T pfam00263 102 TTVRVRDGQTLVLGGLIQEEDSESVSKVPLLGDIPLLG 139 (164) T ss_pred EEEEECCCCEEEEEEEEEEEEEEEEECCCCCCCCCCHH T ss_conf 99999799799996288983610314361574061104 No 20 >COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] Probab=32.37 E-value=41 Score=15.19 Aligned_cols=46 Identities=24% Similarity=0.294 Sum_probs=32.3 Q ss_pred EEEECCCCEEEEEEEEEEE-CCEEEEEEE-CCCCEEEHHHCCCHHHCC Q ss_conf 8998789889981026741-884899997-265223157507977704 Q gi|254780521|r 6 RISLKAGERIFLNGAVVRV-NNKVILELL-NDITFILEHHVIREEEAI 51 (153) Q Consensus 6 kl~LKpgERi~INGAVi~~-drr~~l~i~-n~a~iLre~dil~~eeA~ 51 (153) +++|||||=+|+.-..+-+ .+-.-++++ |-.+.+|.-|-=+..|.. T Consensus 159 ~v~lkpGe~~fl~Agt~HA~~~G~~lEvmqnSDntyR~yd~~r~~d~~ 206 (312) T COG1482 159 RVKLKPGEAFFLPAGTPHAYLKGLVLEVMQNSDNTYRVYDTDRYDDIG 206 (312) T ss_pred EEECCCCCEEEECCCCCEEECCCEEEEEEECCCCEEECCCCCCCCCCH T ss_conf 785478878985699830543660899872576279712365323506 No 21 >TIGR01966 RNasePH ribonuclease PH; InterPro: IPR002381 Prokaryotic ribonuclease PH (2.7.7.56 from EC) (RNase PH) is a phosphorolytic exoribonuclease that removes nucleotide residues following the -CCA terminus of tRNA and adds nucleotides to the ends of RNA molecules by using nucleoside diphosphates as substrates . There is a similar protein in Caenorhabditis elegans that belongs to this group. More information about these proteins can be found at Protein of the Month: RNA Exosomes .; GO: 0000049 tRNA binding, 0004549 tRNA-specific ribonuclease activity, 0008033 tRNA processing. Probab=31.54 E-value=31 Score=15.98 Aligned_cols=26 Identities=15% Similarity=0.312 Sum_probs=19.5 Q ss_pred EEEEEE-E-ECCE--EEEEEECCCC-EEEHH Q ss_conf 810267-4-1884--8999972652-23157 Q gi|254780521|r 17 LNGAVV-R-VNNK--VILELLNDIT-FILEH 42 (153) Q Consensus 17 INGAVi-~-~drr--~~l~i~n~a~-iLre~ 42 (153) =-|.|| . ||.| ||=+|+.+|| |||++ T Consensus 23 aEGSvLi~~G~TkVlCTASv~e~VP~flrG~ 53 (237) T TIGR01966 23 AEGSVLIEFGDTKVLCTASVEEKVPPFLRGS 53 (237) T ss_pred CCCEEEEEECCEEEEEEEEECCCCCCCCCCC T ss_conf 8872689787924666787558728523588 No 22 >PRK06531 yajC preprotein translocase subunit YajC; Validated Probab=31.17 E-value=43 Score=15.06 Aligned_cols=48 Identities=23% Similarity=0.466 Sum_probs=31.0 Q ss_pred EEECCCCEEEEEEEEE----EEC---CEEEEEEEC-CCCEEEH--HHCCCHHHCCCHH Q ss_conf 9987898899810267----418---848999972-6522315--7507977704658 Q gi|254780521|r 7 ISLKAGERIFLNGAVV----RVN---NKVILELLN-DITFILE--HHVIREEEAITPF 54 (153) Q Consensus 7 l~LKpgERi~INGAVi----~~d---rr~~l~i~n-~a~iLre--~dil~~eeA~TP~ 54 (153) =.|+||.+++-+|... ..| +++.|.+.+ ..+|.|. +.++.+.++.+|. T Consensus 35 ~~L~kGdeVvTiGGl~G~V~~Vd~e~~tV~Ld~~Gv~l~f~r~AI~~Vv~~~~~~~~~ 92 (120) T PRK06531 35 NAIQKGDEVVTIGGLFGTVDEVDTEAKKIVLDVDGVYLTFELSAIKRVVTKAETETTL 92 (120) T ss_pred HHCCCCCEEEECCCCEEEEEEEECCCCEEEEEECCEEEEEEHHHHHHHCCCCCCCCCC T ss_conf 7257999899789828999999278988999828979999867765225788898866 No 23 >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase; InterPro: IPR012813 Members of this family are mannosyl-3-phosphoglycerate phosphatase (3.1.3.70 from EC). It acts sequentially after mannosyl-3-phosphoglycerate synthase (2.4.1.217 from EC) in a two-step pathway of biosynthesis of the compatible solute mannosylglycerate, a typical osmolyte of thermophiles.; GO: 0050531 mannosyl-3-phosphoglycerate phosphatase activity, 0051479 mannosylglycerate biosynthetic process, 0005737 cytoplasm. Probab=31.12 E-value=21 Score=17.16 Aligned_cols=16 Identities=44% Similarity=0.885 Sum_probs=9.9 Q ss_pred EEECCCCEEEE--EEEEE Q ss_conf 99878988998--10267 Q gi|254780521|r 7 ISLKAGERIFL--NGAVV 22 (153) Q Consensus 7 l~LKpgERi~I--NGAVi 22 (153) |.++|.||||| ||+-| T Consensus 53 Lgv~~PeriFI~ENGgaI 70 (248) T TIGR02461 53 LGVKDPERIFIVENGGAI 70 (248) T ss_pred CCCCCCCEEEEEECCCEE T ss_conf 389998658987227332 No 24 >TIGR02124 hypE hydrogenase expression/formation protein HypE; InterPro: IPR011854 This family contains HypE (or HupE), a protein required for expression of catalytically active hydrogenase in many systems. It appears to be an accessory protein involved in maturation rather than a regulatory protein involved in expression. HypE shows considerable homology to the thiamine-monophosphate kinase ThiL (IPR006283 from INTERPRO) and other enzymes.. Probab=30.78 E-value=24 Score=16.76 Aligned_cols=67 Identities=13% Similarity=0.113 Sum_probs=39.6 Q ss_pred EECCCCEEEEEEEEEE-E----CCEEEEEEECCCCEEEHHHCCCHHHCCCHHHHHHHHHHHHHHCC---C----CHHHHH Q ss_conf 9878988998102674-1----88489999726522315750797770465899999999999576---7----968899 Q gi|254780521|r 8 SLKAGERIFLNGAVVR-V----NNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVP---T----KKDYLI 75 (153) Q Consensus 8 ~LKpgERi~INGAVi~-~----drr~~l~i~n~a~iLre~dil~~eeA~TP~rrlYf~vQ~mll~p---~----~~~~~~ 75 (153) .++||.+|+|||.+=+ | .-|.-|.++++ -.+=|+.|+=.|+.|+-.- . -+|-.| T Consensus 165 ~~~~GD~Ii~sG~iG~HG~~Il~~Regl~f~~~--------------i~SDCapL~~lv~~ll~~~g~~~~v~~~RD~TR 230 (345) T TIGR02124 165 NIQPGDVIIVSGSIGDHGAAILAVREGLGFETN--------------IESDCAPLNGLVEALLAVGGYEPAVHAMRDATR 230 (345) T ss_pred CCCCCCEEEECCCCHHHHHHHHHHHHCCCCCCC--------------CCCHHHHHHHHHHHHHHCCCCCCCCEEEECCCC T ss_conf 414576689816840678998876502552567--------------333277658999999843798714237616785 Q ss_pred HHHHHHHHHHHHC Q ss_conf 9999999999831 Q gi|254780521|r 76 DLGRRYINILFNI 88 (153) Q Consensus 76 ~~~~~~i~~l~~a 88 (153) .-+-.-+.++.+. T Consensus 231 GGLA~vLNE~A~~ 243 (345) T TIGR02124 231 GGLAAVLNEIAES 243 (345) T ss_pred CCHHHHHHHHHHH T ss_conf 5047899999996 No 25 >TIGR01511 ATPase-IB1_Cu copper-translocating P-type ATPase; InterPro: IPR006403 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (F-, V- and A-ATPases contain rotary motors) and in the type of ions they transport , . F-ATPases (F1F0-ATPases) in mitochondria, chloroplasts and bacterial plasma membranes are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases) are primarily found in eukaryotic vacuoles, catalysing ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases) are found in Archaea and function like F-ATPases. P-ATPases (E1E2-ATPases) are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP. P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles . P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H^+, Na^+, K^+, Mg^2+, Ca^2+, Ag^+ and Ag^2+, Zn^2+, Co^2+, Pb^2+, Ni^2+, Cd^2+, Cu^+ and Cu^2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2. This entry represents P-type ATPases that specialise in cation and copper transport; those transporting copper (3.6.3.4 from EC) have been classified as belonging to the IB subfamily , , . These proteins are involved in a variety of processes in both prokaryotes and eukaryotes. Some of these P-ATPases import copper into cells, such as in Arabidopsis sp., which require copper to create functional hormone receptors for ethylene signalling. Other P-ATPases are involved in copper export out of cells, such as occurs with the efflux of hepatic copper into the bile in eukaryotes. In bacteria, some of these P-ATPases play a role in osmotic adaptation. Certain copper ATPases have been implicated in both Wilson and Menkes diseases . More information about this protein can be found at Protein of the Month: ATP Synthases .; GO: 0004008 copper-exporting ATPase activity, 0005524 ATP binding, 0046872 metal ion binding, 0046873 metal ion transmembrane transporter activity, 0030001 metal ion transport, 0016020 membrane. Probab=30.54 E-value=30 Score=16.08 Aligned_cols=19 Identities=26% Similarity=0.504 Sum_probs=9.0 Q ss_pred EEEECCCCEEEEEEEEEEE Q ss_conf 8998789889981026741 Q gi|254780521|r 6 RISLKAGERIFLNGAVVRV 24 (153) Q Consensus 6 kl~LKpgERi~INGAVi~~ 24 (153) .+.++||||+=+-|.|++| T Consensus 99 ~~~V~pG~k~PvDG~v~~G 117 (545) T TIGR01511 99 IVKVLPGEKIPVDGTVIEG 117 (545) T ss_pred EEEECCCCCCCCCCEEECC T ss_conf 8997578956404078513 No 26 >pfam09894 DUF2121 Uncharacterized protein conserved in archaea (DUF2121). This domain, found in various hypothetical archaeal proteins, has no known function. Probab=29.51 E-value=22 Score=17.00 Aligned_cols=14 Identities=7% Similarity=0.128 Sum_probs=5.6 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 88999999999999 Q gi|254780521|r 72 DYLIDLGRRYINIL 85 (153) Q Consensus 72 ~~~~~~~~~~i~~l 85 (153) .+....|...++.. T Consensus 148 ~~i~~i~~~i~~~v 161 (194) T pfam09894 148 KDIRDIFEKIMEEV 161 (194) T ss_pred HHHHHHHHHHHHHH T ss_conf 99999999999986 No 27 >COG3179 Predicted chitinase [General function prediction only] Probab=29.24 E-value=32 Score=15.92 Aligned_cols=47 Identities=15% Similarity=0.082 Sum_probs=27.3 Q ss_pred HCCCHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCC Q ss_conf 507977704658999999999995767968899999999999983139 Q gi|254780521|r 43 HVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINILFNIIQ 90 (153) Q Consensus 43 dil~~eeA~TP~rrlYf~vQ~mll~p~~~~~~~~~~~~~i~~l~~a~~ 90 (153) -.|.+-.-+||.|+.-|++|+|-=.- .-....+.+--....|.++|+ T Consensus 29 ~~l~~~gi~~p~r~AmFlAQ~~HESg-gf~rl~EnlnYSaq~L~~tf~ 75 (206) T COG3179 29 PALDEAGITTPLRQAMFLAQVMHESG-GFTRLDENLNYSAQGLLQTFP 75 (206) T ss_pred HHHHHHCCCCHHHHHHHHHHHHHHCC-CCEEEHHHCCHHHHHHHHHCC T ss_conf 88887358978899999999864137-724205310458899998631 No 28 >COG2013 Uncharacterized conserved protein [Function unknown] Probab=28.88 E-value=47 Score=14.80 Aligned_cols=28 Identities=18% Similarity=0.386 Sum_probs=17.8 Q ss_pred CCCEEEEECCCCEEEEEEEEEE-ECCEEE Q ss_conf 9865899878988998102674-188489 Q gi|254780521|r 2 NSPLRISLKAGERIFLNGAVVR-VNNKVI 29 (153) Q Consensus 2 ~s~Lkl~LKpgERi~INGAVi~-~drr~~ 29 (153) ..-|+++|+|+|.+++++-.+- -+.-.+ T Consensus 16 ~~~leveL~~ge~V~~e~Gam~~~~~~v~ 44 (227) T COG2013 16 FAVLEVELSPGESVYAEAGAMVYMDGDVE 44 (227) T ss_pred CCEEEEEECCCCEEEEECCEEEECCCCEE T ss_conf 30899995799679994685898269879 No 29 >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Probab=28.23 E-value=48 Score=14.73 Aligned_cols=24 Identities=29% Similarity=0.401 Sum_probs=17.9 Q ss_pred CEEEEECCCCEEEEEEEEEEECCE Q ss_conf 658998789889981026741884 Q gi|254780521|r 4 PLRISLKAGERIFLNGAVVRVNNK 27 (153) Q Consensus 4 ~Lkl~LKpgERi~INGAVi~~drr 27 (153) +-.+..||||||=+-|-|++|.-. T Consensus 233 GD~v~VrpGE~IPvDG~V~~G~s~ 256 (713) T COG2217 233 GDIVLVRPGERIPVDGVVVSGSSS 256 (713) T ss_pred CCEEEECCCCEECCCEEEEECCEE T ss_conf 998998999974477599967077 No 30 >TIGR00802 nico transition metal uptake transporter, Ni2+-Co2+ transporter (NiCoT) family; InterPro: IPR004688 This family is found in both Gram-negative and Gram-positive bacteria. The functionally characterised members of the family catalyze uptake of either Ni2+ or Co2+ in a proton motive force-dependent process. Topological analyses with the HoxN Ni2+ transporter of Ralstonia eutropha suggest that it possesses 8 TMSs with its N- and C-termini in the cytoplasm.; GO: 0015099 nickel ion transmembrane transporter activity, 0015675 nickel ion transport, 0016021 integral to membrane. Probab=28.14 E-value=23 Score=16.92 Aligned_cols=12 Identities=25% Similarity=0.611 Sum_probs=7.1 Q ss_pred CCHHHHHHHHHH Q ss_conf 465899999999 Q gi|254780521|r 51 ITPFHQLYLIVQ 62 (153) Q Consensus 51 ~TP~rrlYf~vQ 62 (153) .+|+||+||=+- T Consensus 222 ~~P~RKlyYNit 233 (290) T TIGR00802 222 SDPLRKLYYNIT 233 (290) T ss_pred HCCHHHHHHHHH T ss_conf 226147789899 No 31 >pfam02699 YajC Preprotein translocase subunit. See. Probab=27.27 E-value=50 Score=14.62 Aligned_cols=39 Identities=23% Similarity=0.486 Sum_probs=25.4 Q ss_pred EEECCCCEEEEEEEEE----E-ECCEEEEEEECCCCEEEHHHCC Q ss_conf 9987898899810267----4-1884899997265223157507 Q gi|254780521|r 7 ISLKAGERIFLNGAVV----R-VNNKVILELLNDITFILEHHVI 45 (153) Q Consensus 7 l~LKpgERi~INGAVi----~-~drr~~l~i~n~a~iLre~dil 45 (153) =+||||.+++-+|-.. . .|+...+++-..+.+--+|..+ T Consensus 36 ~~L~~Gd~VvT~gGi~G~V~~i~~~~v~lei~~gv~i~v~r~aI 79 (83) T pfam02699 36 SSLKKGDEVVTIGGIHGKIVKVDDDTVVLEIADGVKVKVDKSAI 79 (83) T ss_pred HHCCCCCEEEECCCEEEEEEEEECCEEEEEECCCCEEEEEHHHH T ss_conf 85789999998997199999997999999988993999996986 No 32 >pfam03186 CobD_Cbib CobD/Cbib protein. This family includes CobD proteins from a number of bacteria, in Salmonella this protein is called Cbib. Salmonella CobD is a different protein. This protein is involved in cobalamin biosynthesis and is probably an enzyme responsible for the conversion of adenosylcobyric acid to adenosylcobinamide or adenosylcobinamide phosphate. Probab=26.58 E-value=51 Score=14.54 Aligned_cols=62 Identities=13% Similarity=0.166 Sum_probs=53.4 Q ss_pred HHHHCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH Q ss_conf 99831399899999999999986892899999997488999997336898852156524652 Q gi|254780521|r 84 ILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQEI 145 (153) Q Consensus 84 ~l~~a~~~~~~~~~L~~~~~~V~~g~~Y~ALK~lR~Li~~E~~ll~~~~~~p~~~~~i~~~~ 145 (153) -+..++.......+..++.+.+..|+.-+|=+.+..+.-++.+-|+..++.-+.+|++.+.. T Consensus 85 ll~~~l~~r~l~~~~~~V~~aL~~~dl~~AR~~ls~iv~Rdt~~L~~~~I~ra~iEs~aen~ 146 (290) T pfam03186 85 LLYLTLAFRSLSDHAKAVARALRAGDLEAARRLLSMIVGRDTSNLSEAGIARAAIESLAENT 146 (290) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHC T ss_conf 99999932159999999999998499999999999985988031998999999999999863 No 33 >PRK01209 cobD cobalamin biosynthesis protein; Provisional Probab=25.48 E-value=37 Score=15.45 Aligned_cols=61 Identities=13% Similarity=0.214 Sum_probs=50.6 Q ss_pred HHHCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH Q ss_conf 9831399899999999999986892899999997488999997336898852156524652 Q gi|254780521|r 85 LFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQEI 145 (153) Q Consensus 85 l~~a~~~~~~~~~L~~~~~~V~~g~~Y~ALK~lR~Li~~E~~ll~~~~~~p~~~~~i~~~~ 145 (153) +..++...+...+..++.+.+..|+.-+|=+.+..+.-++..-|+..++.-+.+|++.+.. T Consensus 88 l~~~la~r~l~~~~~~V~~aL~~~dl~~AR~~ls~iV~RDt~~L~~~~i~rAaiEslaEn~ 148 (307) T PRK01209 88 LYTALAGRSLADHAAAVARALRAGDLEEARRAVSMIVGRDTSQLDEAGIARAAIESVAENT 148 (307) T ss_pred HHHHHHHCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHC T ss_conf 9999831329999999999998499999999999885988032998999999999999864 No 34 >PRK12655 fructose-6-phosphate aldolase; Reviewed Probab=24.98 E-value=39 Score=15.32 Aligned_cols=74 Identities=14% Similarity=0.121 Sum_probs=43.6 Q ss_pred HHHCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH--CCCCCCCCHHHHH Q ss_conf 99576796889999999999998313998999999999999868928999999974889999973--3689885215652 Q gi|254780521|r 64 IFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDP--NGSAIFASIFQSI 141 (153) Q Consensus 64 mll~p~~~~~~~~~~~~~i~~l~~a~~~~~~~~~L~~~~~~V~~g~~Y~ALK~lR~Li~~E~~ll--~~~~~~p~~~~~i 141 (153) +|+|-++.+++...+.. .-+.+++++|.+... +..++|+.++.+++++..+..+- .-+.....|+++- T Consensus 3 ~flDtAd~~ei~~~~~~--g~i~GvTTNPsll~k--------~g~~~~~~~~~i~~~~~~~~~l~~ev~~~d~~~m~~~a 72 (220) T PRK12655 3 LYLDTANVAEVERLARI--LPIAGVTTNPSIIAA--------SKESIWEVLPRLQKAIGGEGILFAQTMSRDAQGMVEEA 72 (220) T ss_pred EEEECCCHHHHHHHHCC--CCCCEECCCHHHHHH--------CCCCHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHH T ss_conf 99974899999999707--994758289999986--------59987999999999828999789999559999999999 Q ss_pred HHHHCCH Q ss_conf 4652002 Q gi|254780521|r 142 RQEIKSW 148 (153) Q Consensus 142 ~~~~~~~ 148 (153) + ++..| T Consensus 73 ~-~l~~~ 78 (220) T PRK12655 73 K-RLRNA 78 (220) T ss_pred H-HHHHH T ss_conf 9-99974 No 35 >KOG0815 consensus Probab=24.96 E-value=34 Score=15.74 Aligned_cols=26 Identities=23% Similarity=0.391 Sum_probs=24.3 Q ss_pred CEEEEEEECCCCEEEHHHCCCHHHCC Q ss_conf 84899997265223157507977704 Q gi|254780521|r 26 NKVILELLNDITFILEHHVIREEEAI 51 (153) Q Consensus 26 rr~~l~i~n~a~iLre~dil~~eeA~ 51 (153) .|.+++|.+|+.++.+.|=..+.||+ T Consensus 148 srGtiEIlsdV~lik~GDKVGaSEAt 173 (245) T KOG0815 148 SRGTIEILSDVQLIKTGDKVGASEAT 173 (245) T ss_pred ECCEEEECCCCEEECCCCCCCHHHHH T ss_conf 02337860451230267735712889 No 36 >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase; InterPro: IPR006416 This group encompasses the copper and cadmium-type heavy metal transporting P-type ATPases as well as those which cannot be assigned to one or other of the groups. ; GO: 0015662 ATPase activity coupled to transmembrane movement of ions phosphorylative mechanism, 0030001 metal ion transport, 0016021 integral to membrane. Probab=24.60 E-value=48 Score=14.72 Aligned_cols=20 Identities=30% Similarity=0.569 Sum_probs=15.2 Q ss_pred EEEECCCCEEEEEEEEEEEC Q ss_conf 89987898899810267418 Q gi|254780521|r 6 RISLKAGERIFLNGAVVRVN 25 (153) Q Consensus 6 kl~LKpgERi~INGAVi~~d 25 (153) .+..||||||=+-|.|++|. T Consensus 94 ~v~V~pGe~~PvDG~v~~G~ 113 (639) T TIGR01525 94 IVVVRPGERIPVDGEVISGE 113 (639) T ss_pred EEEECCCCCCCCCCEEECCC T ss_conf 89975688121056786586 No 37 >COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Probab=23.75 E-value=57 Score=14.19 Aligned_cols=35 Identities=17% Similarity=0.262 Sum_probs=23.2 Q ss_pred CCCEEEEECCCCEEEEEEEEEE-E--C-CEEEEEEECCC Q ss_conf 9865899878988998102674-1--8-84899997265 Q gi|254780521|r 2 NSPLRISLKAGERIFLNGAVVR-V--N-NKVILELLNDI 36 (153) Q Consensus 2 ~s~Lkl~LKpgERi~INGAVi~-~--d-rr~~l~i~n~a 36 (153) +|+-.-+||||.|+.|.|--=+ . | .+--++|-+.| T Consensus 247 mSSyi~sLKpGDKvtisGPfGEfFaKdtdaemvFigGGA 285 (410) T COG2871 247 MSSYIWSLKPGDKVTISGPFGEFFAKDTDAEMVFIGGGA 285 (410) T ss_pred EEEEEEEECCCCEEEEECCCHHHHHCCCCCCEEEEECCC T ss_conf 110478506997479836614543126887369983586 No 38 >cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins. Little is known about the function of the proteins in this subgroup. Probab=23.66 E-value=58 Score=14.18 Aligned_cols=41 Identities=20% Similarity=0.525 Sum_probs=26.4 Q ss_pred CCCEEEEEC--CCCEEEEEEEEEE-E-CCEEEEEEEC-C-CCEEEHH Q ss_conf 986589987--8988998102674-1-8848999972-6-5223157 Q gi|254780521|r 2 NSPLRISLK--AGERIFLNGAVVR-V-NNKVILELLN-D-ITFILEH 42 (153) Q Consensus 2 ~s~Lkl~LK--pgERi~INGAVi~-~-drr~~l~i~n-~-a~iLre~ 42 (153) ++.|++.|| +|+..+|.|-.-. . -.-+.=.|+. + ..|.++| T Consensus 38 ~~~lkv~lk~~~~~~~iidGel~~~Ik~des~WtlEdgk~l~i~LeK 84 (102) T cd06495 38 SSSIRVSVRDGGGEKVLMEGEFTHKINTENSLWSLEPGKCVLLSLSK 84 (102) T ss_pred ECEEEEEEECCCCCCEEEECCCCCCCCCCCEEEEECCCCEEEEEEEE T ss_conf 59699998358897118925056875424306796399989999970 No 39 >pfam10255 Paf67 RNA polymerase I-associated factor PAF67. RNA polymerase I is a multisubunit enzyme and its transcription competence is dependent on the presence of PAF67. This family of proteins is conserved from worms to humans. Probab=23.48 E-value=52 Score=14.50 Aligned_cols=20 Identities=20% Similarity=0.426 Sum_probs=15.9 Q ss_pred HHHHHHCCCHHHHHHHHHHH Q ss_conf 99998689289999999748 Q gi|254780521|r 101 IESLINSGRFFEALKNIRTL 120 (153) Q Consensus 101 ~~~~V~~g~~Y~ALK~lR~L 120 (153) ..=+|.-|+||.|||.+-.+ T Consensus 129 lRlhvLLGDY~~Alk~L~~I 148 (402) T pfam10255 129 LRVHVLLGDYYLALKVLEPI 148 (402) T ss_pred HHHHHHCCCHHHHHHHHHHH T ss_conf 99987005689999975241 No 40 >TIGR01480 copper_res_A copper-resistance protein, CopA family; InterPro: IPR006376 These sequences represent the CopA copper resistance protein family. CopA is related to laccase (benzenediol:oxygen oxidoreductase) and L-ascorbate oxidase, both copper-containing enzymes. Most members have a typical TAT (twin-arginine translocation) signal sequence with an Arg-Arg pair. Twin-arginine translocation is observed for a large number of periplasmic proteins that cross the inner membrane with metal-containing cofactors already bound. The combination of copper-binding sites and TAT translocation motif suggests a mechanism of resistance by packaging and export. ; GO: 0005507 copper ion binding, 0042597 periplasmic space. Probab=23.06 E-value=47 Score=14.75 Aligned_cols=14 Identities=36% Similarity=0.994 Sum_probs=6.3 Q ss_pred CCCCEE---EEEEEEEE Q ss_conf 789889---98102674 Q gi|254780521|r 10 KAGERI---FLNGAVVR 23 (153) Q Consensus 10 KpgERi---~INGAVi~ 23 (153) |||||+ ||||.-+. T Consensus 279 ~pGEkVrLRfINgsamT 295 (644) T TIGR01480 279 RPGEKVRLRFINGSAMT 295 (644) T ss_pred CCCCEEEEEEEECCCCE T ss_conf 88764788887152351 No 41 >COG4568 Rof Transcriptional antiterminator [Transcription] Probab=23.00 E-value=57 Score=14.22 Aligned_cols=41 Identities=22% Similarity=0.244 Sum_probs=22.8 Q ss_pred CCEEEEECCCCEEEEEEEEEEECCEEE-EEEEC--CCCEEEHHH Q ss_conf 865899878988998102674188489-99972--652231575 Q gi|254780521|r 3 SPLRISLKAGERIFLNGAVVRVNNKVI-LELLN--DITFILEHH 43 (153) Q Consensus 3 s~Lkl~LKpgERi~INGAVi~~drr~~-l~i~n--~a~iLre~d 43 (153) -+|+++||.||++.--.+-..-..|.. |.++. .-.-||.-+ T Consensus 24 l~l~L~lkdGev~~a~A~d~~~r~k~Eyl~v~~eget~~LrlD~ 67 (84) T COG4568 24 LPLTLELKDGEVLQAKASDLQRRKKVEYLAVEVEGETRELRLDK 67 (84) T ss_pred CEEEEEECCCEEEEEEEHHHHHHCCEEEEEEEECCCEEEEEHHH T ss_conf 25899972874999981245641250389998348156776245 No 42 >PRK05585 yajC preprotein translocase subunit YajC; Validated Probab=22.96 E-value=59 Score=14.09 Aligned_cols=39 Identities=26% Similarity=0.484 Sum_probs=25.5 Q ss_pred EEEECCCCEEEEEEEEE----E-ECCEEEEEEECCCCEEEHHHC Q ss_conf 89987898899810267----4-188489999726522315750 Q gi|254780521|r 6 RISLKAGERIFLNGAVV----R-VNNKVILELLNDITFILEHHV 44 (153) Q Consensus 6 kl~LKpgERi~INGAVi----~-~drr~~l~i~n~a~iLre~di 44 (153) .=+||+|.+++-+|-.. + .|..+.+++-.++.+=.+|.. T Consensus 51 ~~~L~~Gd~VvT~gGi~G~I~~v~d~~v~leia~gv~i~~~r~a 94 (107) T PRK05585 51 LSSLAKGDEVVTNGGIIGKVTKVSEDFVIIELNDDTEIKIQKSA 94 (107) T ss_pred HHHCCCCCEEEECCCCEEEEEEEECCEEEEEECCCCEEEEEHHH T ss_conf 98458999999899858999999799899998899589999589 No 43 >pfam04631 Baculo_44 Baculovirus hypothetical protein. This family includes several hypothetical baculoviral proteins, with predicted molecular weights of approximately 44 kD. Probab=22.95 E-value=59 Score=14.09 Aligned_cols=21 Identities=14% Similarity=0.349 Sum_probs=16.0 Q ss_pred CCEEEEECCCCEEEEEEEEEE Q ss_conf 865899878988998102674 Q gi|254780521|r 3 SPLRISLKAGERIFLNGAVVR 23 (153) Q Consensus 3 s~Lkl~LKpgERi~INGAVi~ 23 (153) ++--....+++|++|||..+. T Consensus 101 sA~YFfV~~~D~fvvnG~~L~ 121 (372) T pfam04631 101 SAVYFFVGEHDKFVVNGQLLS 121 (372) T ss_pred CEEEEEECCCCEEEECCCCCC T ss_conf 515999547737998484726 No 44 >cd03464 3,4-PCD_beta Protocatechuate 3,4-dioxygenase (3,4-PCD) , beta subunit. 3,4-PCD catalyzes the oxidative ring cleavage of 3,4-dihydroxybenzoate to produce beta-carboxy-cis,cis-muconate. 3,4-PCDs are large aggregates of 12 protomers, each composed of an alpha- and beta-subunit and an Fe3+ ion bound in the beta-subunit at the alpha-subunit-beta-subunit interface. 3,4-PCD is a member of the aromatic dioxygenases which are non-heme iron intradiol-cleaving enzymes that break the C1-C2 bond and utilize Fe3+. Probab=22.78 E-value=60 Score=14.07 Aligned_cols=23 Identities=30% Similarity=0.622 Sum_probs=16.3 Q ss_pred CCCEEEEEEEEEEE-CC---EEEEEEE Q ss_conf 89889981026741-88---4899997 Q gi|254780521|r 11 AGERIFLNGAVVRV-NN---KVILELL 33 (153) Q Consensus 11 pgERi~INGAVi~~-dr---r~~l~i~ 33 (153) -||||+|-|-|+-+ ++ .+-++|= T Consensus 62 ~GerI~v~GrVlD~~G~PV~dAlvEIW 88 (220) T cd03464 62 IGERIIVHGRVLDEDGRPVPNTLVEIW 88 (220) T ss_pred CCCEEEEEEEEECCCCCCCCCCEEEEE T ss_conf 788799999998899999777465776 No 45 >PRK00708 sec-independent translocase; Provisional Probab=22.43 E-value=61 Score=14.03 Aligned_cols=47 Identities=6% Similarity=0.043 Sum_probs=25.3 Q ss_pred HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH Q ss_conf 9999999995767968899999999999983139989999999999998 Q gi|254780521|r 57 LYLIVQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLI 105 (153) Q Consensus 57 lYf~vQ~mll~p~~~~~~~~~~~~~i~~l~~a~~~~~~~~~L~~~~~~V 105 (153) |.++|-++.++|.+-......+-+.+..+... ..+.+..++++.+.. T Consensus 11 lI~vValiVvGPkdLP~~~Rt~g~~~~k~R~m--A~efq~~~de~~re~ 57 (197) T PRK00708 11 VIAIVLIVVVGPKDLPPMLRAFGKMTARMRKM--AGEFRRQFDEALREA 57 (197) T ss_pred HHHHHHHHEECHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHH T ss_conf 99999850468477799999999999999999--999999999999999 No 46 >TIGR00875 talC transaldolase, putative; InterPro: IPR004731 Transaldolase (2.2.1.2 from EC) catalyzes the reversible transfer of a three-carbon ketol unit from sedoheptulose 7-phosphate to glyceraldehyde 3-phosphate to form erythrose 4-phosphate and fructose 6-phosphate. This enzyme, together with transketolase, provides a link between the glycolytic and pentose-phosphate pathways. Transaldolase is an enzyme of about 34 Kd whose sequence has been well conserved throughout evolution. A lysine has been implicated in the catalytic mechanism of the enzyme; it acts as a nucleophilic group that attacks the carbonyl group of fructose-6-phosphate. Transaldolase is evolutionary related to a bacterial protein of about 20 Kd (known as talC in Escherichia coli), whose exact function is not yet known.; GO: 0005975 carbohydrate metabolic process. Probab=22.35 E-value=61 Score=14.02 Aligned_cols=52 Identities=23% Similarity=0.329 Sum_probs=38.7 Q ss_pred HHHHCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHC-CCHHHHHHHHHHHHHHH Q ss_conf 999576796889999999999998313998999999999999868-92899999997488999 Q gi|254780521|r 63 MIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINS-GRFFEALKNIRTLSFID 124 (153) Q Consensus 63 ~mll~p~~~~~~~~~~~~~i~~l~~a~~~~~~~~~L~~~~~~V~~-g~~Y~ALK~lR~Li~~E 124 (153) ..|+|-+|-++-+..-. +--+-+++++|++.+ -.. ..||+-||.+-+++--| T Consensus 2 ~fflDTANv~Ei~~~~e--~g~~~GVTTNPslia--------k~~n~~f~evl~ei~~~vGd~ 54 (216) T TIGR00875 2 KFFLDTANVEEIKKAAE--LGILAGVTTNPSLIA--------KEGNRSFWEVLKEIQEVVGDE 54 (216) T ss_pred CCCCCCCCHHHHHHHHH--CCCCCCCCCCHHHHH--------HCCCCCHHHHHHHHHHHHCCC T ss_conf 54124125799999984--245477345633420--------136887889999999874588 No 47 >TIGR01367 pyrE_Therm orotate phosphoribosyltransferase; InterPro: IPR006273 This group of sequences are a distinct clade of orotate phosphoribosyltransferases. Members include the experimentally determined example from Thermus aquaticus and additional examples from Caulobacter crescentus, Helicobacter pylori (Campylobacter pylori), Mesorhizobium loti, and related species. ; GO: 0004588 orotate phosphoribosyltransferase activity, 0019856 pyrimidine base biosynthetic process. Probab=22.12 E-value=62 Score=13.99 Aligned_cols=16 Identities=31% Similarity=0.557 Sum_probs=13.3 Q ss_pred EECCCCEEEEEEEEEE Q ss_conf 9878988998102674 Q gi|254780521|r 8 SLKAGERIFLNGAVVR 23 (153) Q Consensus 8 ~LKpgERi~INGAVi~ 23 (153) .+||||||+|=-=||+ T Consensus 107 ~v~pGek~v~vEDvvT 122 (205) T TIGR01367 107 EVKPGEKVVVVEDVVT 122 (205) T ss_pred EECCCCEEEEEEEEEC T ss_conf 3369977999962110 No 48 >COG4079 Uncharacterized protein conserved in archaea [Function unknown] Probab=21.79 E-value=54 Score=14.38 Aligned_cols=16 Identities=6% Similarity=-0.080 Sum_probs=6.6 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 6889999999999998 Q gi|254780521|r 71 KDYLIDLGRRYINILF 86 (153) Q Consensus 71 ~~~~~~~~~~~i~~l~ 86 (153) -.+....+..+.+-++ T Consensus 148 lqd~~dal~elfe~vs 163 (293) T COG4079 148 LQDAVDALMELFETVS 163 (293) T ss_pred HHHHHHHHHHHHHHHH T ss_conf 8999999999999862 No 49 >pfam06466 PCAF_N PCAF (P300/CBP-associated factor) N-terminal domain. This region is spliced out of human histone acetyltransferase GCN5 isoform 2. It is predicted to be of a mixed alpha/beta fold - though predominantly helical. Probab=21.63 E-value=44 Score=14.96 Aligned_cols=10 Identities=30% Similarity=0.600 Sum_probs=3.8 Q ss_pred HHHHHHHHHH Q ss_conf 8999999974 Q gi|254780521|r 110 FFEALKNIRT 119 (153) Q Consensus 110 ~Y~ALK~lR~ 119 (153) ||--.|.+|+ T Consensus 113 Y~~l~klLRK 122 (252) T pfam06466 113 YFYLFKLLRK 122 (252) T ss_pred HHHHHHHHHH T ss_conf 9999999999 No 50 >COG1838 FumA Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain [Energy production and conversion] Probab=21.32 E-value=64 Score=13.88 Aligned_cols=20 Identities=30% Similarity=0.635 Sum_probs=16.8 Q ss_pred EEECCCCEEEEEEEEEEE-CC Q ss_conf 998789889981026741-88 Q gi|254780521|r 7 ISLKAGERIFLNGAVVRV-NN 26 (153) Q Consensus 7 l~LKpgERi~INGAVi~~-dr 26 (153) -+||.|+++++||-.+.+ |. T Consensus 14 ~~LkvGd~v~lsG~I~t~RD~ 34 (184) T COG1838 14 AKLKVGDVVYLSGKIVTGRDA 34 (184) T ss_pred HHCCCCCEEEEEEEEEEEHHH T ss_conf 736678889994479984158 No 51 >KOG0344 consensus Probab=21.29 E-value=64 Score=13.88 Aligned_cols=71 Identities=13% Similarity=0.081 Sum_probs=41.1 Q ss_pred CCCCEEEHHHCCCHHHCCCHHHHHHHHHHHH-----HHC-----CCCHHHHH--HHHHHHHHHHHHCCCCHHHHHHHHHH Q ss_conf 2652231575079777046589999999999-----957-----67968899--99999999998313998999999999 Q gi|254780521|r 34 NDITFILEHHVIREEEAITPFHQLYLIVQMI-----FLV-----PTKKDYLI--DLGRRYINILFNIIQNQQLILALKNI 101 (153) Q Consensus 34 n~a~iLre~dil~~eeA~TP~rrlYf~vQ~m-----ll~-----p~~~~~~~--~~~~~~i~~l~~a~~~~~~~~~L~~~ 101 (153) +.+...++++-+ ...||.| +++.+++= |.. -+.++... ..|..+++++..+..+++++-.+..+ T Consensus 254 k~a~~~~~k~di---li~TP~r-i~~~~~~~~~~idl~~V~~lV~dEaD~lfe~~~f~~Qla~I~sac~s~~i~~a~FSa 329 (593) T KOG0344 254 KPAFLSDEKYDI---LISTPMR-IVGLLGLGKLNIDLSKVEWLVVDEADLLFEPEFFVEQLADIYSACQSPDIRVALFSA 329 (593) T ss_pred CCCHHHHHHHHH---HHCCHHH-HHHHHCCCCCCCHHHEEEEEEECHHHHHHCHHHHHHHHHHHHHHHCCCCHHHHHHHC T ss_conf 332467778878---8618799-999855897532012035676646876508156999999999985285222566321 Q ss_pred HHHHHCC Q ss_conf 9998689 Q gi|254780521|r 102 ESLINSG 108 (153) Q Consensus 102 ~~~V~~g 108 (153) +..+.-. T Consensus 330 t~~~~VE 336 (593) T KOG0344 330 TISVYVE 336 (593) T ss_pred CCCHHHH T ss_conf 4607799 Done!