RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780521|ref|YP_003064934.1| flagellar biosynthesis repressor FlbT [Candidatus Liberibacter asiaticus str. psy62] (153 letters) >gnl|CDD|179127 PRK00794, flbT, flagellar biosynthesis repressor FlbT; Reviewed. Length = 132 Score = 126 bits (320), Expect = 2e-30 Identities = 51/118 (43%), Positives = 75/118 (63%) Query: 3 SPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQ 62 S L++SLK GERIF+NGAV+R + KV LELLND TF+ E V++ E+A TP QLY I Q Sbjct: 2 SGLKLSLKPGERIFINGAVLRNDRKVSLELLNDATFLRERDVLQPEDATTPLRQLYFIAQ 61 Query: 63 MIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTL 120 ++ + P + R + L + + ++ LK I+ L+ +GR++EALK +R L Sbjct: 62 LMLIGPAGAEDARAEFARRLEQLLAVFTDPDILAGLKAIDELVEAGRYYEALKALRGL 119 >gnl|CDD|148792 pfam07378, FlbT, Flagellar protein FlbT. This family consists of several FlbT proteins. FlbT is a post-transcriptional regulator of flagellin. FlbT is associated with the 5' untranslated region (UTR) of fljK (25 kDa flagellin) mRNA and that this association requires a predicted loop structure in the transcript. Mutations within this loop abolish FlbT association and result in increased mRNA stability. It is therefore thought that FlbT promotes the degradation of flagellin mRNA by associating with the 5' UTR. Length = 126 Score = 107 bits (270), Expect = 1e-24 Identities = 39/117 (33%), Positives = 64/117 (54%), Gaps = 1/117 (0%) Query: 5 LRISLKAGERIFLNGAVVR-VNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQM 63 L++SLK GERI +NGAV+R + + LE+ ND + E +++ E+A TP +LY VQ+ Sbjct: 1 LKLSLKPGERIIINGAVIRNGDRRSRLEIENDAPILREKDILQPEDATTPVRRLYFAVQL 60 Query: 64 IFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTL 120 + + P +D L + L + L L+ +GR+++ALK +R L Sbjct: 61 MLIGPEDRDDARALFLELLEELSAAFADPDSRALLDEATELVLAGRYYKALKALRKL 117 >gnl|CDD|183748 PRK12791, flbT, flagellar biosynthesis repressor FlbT; Reviewed. Length = 131 Score = 44.0 bits (104), Expect = 2e-05 Identities = 34/120 (28%), Positives = 57/120 (47%), Gaps = 8/120 (6%) Query: 4 PLRISLKAGERIFLNGAVVRVNNKVILELL--NDITFILEHHVIREEEAITPFHQLYLIV 61 PLR+ LK ERI + G V N+ L D + E ++ E A TP ++YL V Sbjct: 2 PLRVELKPFERIVI-GQSVITNSDTRARFLIDGDAPILREKDILTAETADTPAKRVYLCV 60 Query: 62 QMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILAL-KNIESLINSGRFFEALKNIRTL 120 Q+++L Y Y+ ++ +I+ + + I + I +G ++ALK +R L Sbjct: 61 QLMYLSNDIPAY----HGTYLGLIRELIEAVPSAWPIIEAINNHILNGDLYKALKELRKL 116 >gnl|CDD|162107 TIGR00918, 2A060602, The Eukaryotic (Putative) Sterol Transporter (EST) Family. Length = 1145 Score = 27.9 bits (62), Expect = 1.1 Identities = 11/44 (25%), Positives = 22/44 (50%) Query: 41 EHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINI 84 EH + + F+ +Y + Q F PT++ L DL + + ++ Sbjct: 726 EHDFLDAQFRYFSFYNMYAVTQGNFDYPTQQQLLYDLHQSFSSV 769 >gnl|CDD|180201 PRK05686, fliG, flagellar motor switch protein G; Validated. Length = 339 Score = 27.1 bits (61), Expect = 2.1 Identities = 12/27 (44%), Positives = 14/27 (51%) Query: 74 LIDLGRRYINILFNIIQNQQLILALKN 100 L+DL R I L + N L LALK Sbjct: 247 LVDLDDRSIQRLLREVDNDVLALALKG 273 >gnl|CDD|132689 TIGR03650, violacein_E, violacein biosynthesis enzyme VioE. This enzyme catalyzes the third step in violacein biosynthesis from a pair of Trp residues, as in Chromobacterium violaceum, but the first step that distinguishes that pathway from staurosporine (an indolocarbazole antibiotic) biosynthesis. Length = 184 Score = 26.8 bits (59), Expect = 2.2 Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 10/37 (27%) Query: 48 EEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINI 84 ++ PFH+L+L +D L LG R+I Sbjct: 94 DDETGPFHELFL----------PQDVLRRLGARHIGR 120 >gnl|CDD|184503 PRK14096, pgi, glucose-6-phosphate isomerase; Provisional. Length = 528 Score = 26.8 bits (60), Expect = 2.3 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 3/22 (13%) Query: 112 EALKNIR---TLSFIDNIDPNG 130 EAL+ + FIDN DP+G Sbjct: 134 EALQPNSDGLNIHFIDNTDPDG 155 >gnl|CDD|183005 PRK11162, mltA, murein transglycosylase A; Provisional. Length = 355 Score = 26.8 bits (60), Expect = 2.4 Identities = 15/73 (20%), Positives = 31/73 (42%), Gaps = 8/73 (10%) Query: 75 IDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIF 134 D G++Y + F Q L+ IN+G F E + IR S P + Sbjct: 26 TDRGQQYKDGKFT--QPLSLVNQPNASGKPINAGDFAEQVNQIRNSS------PRLYGRY 77 Query: 135 ASIFQSIRQEIKS 147 ++ + ++++ + + Sbjct: 78 SNTYNAVQEWLLA 90 >gnl|CDD|149139 pfam07899, Frigida, Frigida-like protein. This family is composed of plant proteins that are similar to FRIGIDA protein expressed by Arabidopsis thaliana. This protein is probably nuclear and is required for the regulation of flowering time in the late-flowering phenotype. It is known to increase RNA levels of flowering locus C. Allelic variation at the FRIGIDA locus is a major determinant of natural variation in flowering time. Length = 294 Score = 26.1 bits (58), Expect = 3.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Query: 101 IESLINSGRFFEALKNIRTLSFIDNIDP 128 IE LIN GR +A+ I +D P Sbjct: 185 IEELINRGRQIDAVHFIYEFGLVDKFPP 212 >gnl|CDD|149034 pfam07743, HSCB_C, HSCB C-terminal oligomerisation domain. This domain is the HSCB C-terminal oligomerisation domain and is found on co-chaperone proteins. Length = 77 Score = 25.3 bits (56), Expect = 6.9 Identities = 10/38 (26%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 90 QNQQLILAL-KNIESLINSGRFFEALKNIRTLSFIDNI 126 + +Q I L +E+ +++G + EA +R L F++ + Sbjct: 34 EVKQRIKELLAELEAALDAGDWEEAADLVRRLKFLEKL 71 >gnl|CDD|182075 PRK09786, PRK09786, endodeoxyribonuclease RUS; Reviewed. Length = 120 Score = 25.2 bits (55), Expect = 8.0 Identities = 7/26 (26%), Positives = 14/26 (53%) Query: 73 YLIDLGRRYINILFNIIQNQQLILAL 98 ++ G+ Y + + II+N L + L Sbjct: 26 HISAEGQAYRDNVARIIKNAMLDIGL 51 >gnl|CDD|179219 PRK01096, PRK01096, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional. Length = 440 Score = 24.9 bits (55), Expect = 8.3 Identities = 7/28 (25%), Positives = 13/28 (46%) Query: 31 ELLNDITFILEHHVIREEEAITPFHQLY 58 LL+ + ++E +PFH+ Y Sbjct: 5 TLLSRERLGKKGKTSKDELGRSPFHKDY 32 >gnl|CDD|131061 TIGR02006, IscS, cysteine desulfurase IscS. This model represents IscS, one of several cysteine desulfurases from a larger protein family designated (misleadingly, in this case) class V aminotransferases. IscS is one of at least 6 enzymes characteristic of the IscSUA-hscAB-fsx system of iron-sulfur cluster assembly. Scoring almost as well as proteobacterial sequences included in the model are mitochondrial cysteine desulfurases, apparently from an analogous system in eukaryotes. The sulfur, taken from cysteine, may be used in other systems as well, such as tRNA base modification and biosynthesis of other cofactors. Length = 402 Score = 24.8 bits (54), Expect = 9.4 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 5/36 (13%) Query: 76 DLGRRY---INILFNIIQNQQLILALKNIESLINSG 108 DL R +N+ FN ++ + LI+ALK++ ++SG Sbjct: 290 DLEHRVPGNLNVSFNYVEGESLIMALKDLA--VSSG 323 >gnl|CDD|180192 PRK05673, dnaE, DNA polymerase III subunit alpha; Validated. Length = 1135 Score = 24.7 bits (55), Expect = 9.6 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 13/39 (33%) Query: 99 KNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASI 137 + +ESLI +G F D++ PN +A+ AS+ Sbjct: 864 RVLESLIKAGAF-------------DSLGPNRAALLASL 889 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.142 0.395 Gapped Lambda K H 0.267 0.0597 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,541,342 Number of extensions: 163119 Number of successful extensions: 460 Number of sequences better than 10.0: 1 Number of HSP's gapped: 457 Number of HSP's successfully gapped: 39 Length of query: 153 Length of database: 5,994,473 Length adjustment: 85 Effective length of query: 68 Effective length of database: 4,157,793 Effective search space: 282729924 Effective search space used: 282729924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (24.5 bits)