RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780521|ref|YP_003064934.1| flagellar biosynthesis repressor FlbT [Candidatus Liberibacter asiaticus str. psy62] (153 letters) >2hqy_A Conserved hypothetical protein; PSI2, MAD, structural genomics, protein structure initiative; HET: COA; 1.80A {Bacteroides thetaiotaomicron vpi-5482} (A:119-290) Length = 172 Score = 27.0 bits (60), Expect = 1.4 Identities = 19/79 (24%), Positives = 29/79 (36%), Gaps = 15/79 (18%) Query: 9 LKAGERIFLNGAVVRVNNKV----ILELLNDITFILEHHVIREEEAITPFHQLYLIVQMI 64 L E + L G ++ VN K+ +N TF + E+A T Y ++ Sbjct: 80 LHNFEALGLTGGILHVNGKIVAFTFGMPINHETF-----GVHVEKADTSIDGAYAMINYE 134 Query: 65 FLVPTKKDYLIDLGRRYIN 83 F + Y YIN Sbjct: 135 FANRIPEQY------IYIN 147 >3bmz_A Putative uncharacterized protein; violacein, biosynthetic protein; HET: PG4 PGE; 1.21A {Chromobacterium violaceum atcc 12472} PDB: 2zf3_A 2zf4_A* (A:) Length = 199 Score = 26.1 bits (57), Expect = 2.1 Identities = 10/37 (27%), Positives = 16/37 (43%), Gaps = 10/37 (27%) Query: 48 EEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINI 84 ++ PF +L+L +D L LG R+I Sbjct: 99 DDETGPFAELFL----------PRDVLRRLGARHIGR 125 >2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding, GET5, GET4; 1.99A {Saccharomyces cerevisiae} (A:1-130) Length = 130 Score = 26.3 bits (58), Expect = 2.2 Identities = 8/25 (32%), Positives = 17/25 (68%) Query: 98 LKNIESLINSGRFFEALKNIRTLSF 122 L+ E+ I +G ++EA + +RT++ Sbjct: 17 LQRFENKIKAGDYYEAHQTLRTIAN 41 >1xgs_A Methionine aminopeptidase; hyperthermophIle; 1.75A {Pyrococcus furiosus} (A:1-202,A:266-295) Length = 232 Score = 25.7 bits (55), Expect = 2.9 Identities = 11/34 (32%), Positives = 19/34 (55%) Query: 18 NGAVVRVNNKVILELLNDITFILEHHVIREEEAI 51 G V+ V V+ E+ N I EH +I E++++ Sbjct: 194 AGQVIEVPPPVLKEIRNGIVAQFEHTIIVEKDSV 227 >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} (W:) Length = 461 Score = 24.9 bits (52), Expect = 5.4 Identities = 4/34 (11%), Positives = 11/34 (32%), Gaps = 1/34 (2%) Query: 92 QQLILALKNIESLINSGRFFEALKNIRTLSFIDN 125 Q L + + + + L+ + + D Sbjct: 6 QSLDIQCEELSDARWAE-LLPLLQQCQVVRLDDC 38 >2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} (A:105-236) Length = 132 Score = 24.4 bits (52), Expect = 7.5 Identities = 2/15 (13%), Positives = 5/15 (33%) Query: 72 DYLIDLGRRYINILF 86 DY+ ++ Sbjct: 10 DYIAKKAGEGAKVIE 24 >3l6u_A ABC-type sugar transport system periplasmic component; structural genomics, nysgrc, target 11006S, PSI-2, protein structure initiative; 1.90A {Exiguobacterium sibiricum} (A:112-249) Length = 138 Score = 24.4 bits (52), Expect = 8.2 Identities = 3/15 (20%), Positives = 6/15 (40%) Query: 72 DYLIDLGRRYINILF 86 + + GR I+ Sbjct: 15 ELIKQTGRSTGRIVE 29 >2wzp_P Lactococcal phage P2 ORF15; baseplate, viral protein; 2.60A {Lactococcus phage P2} PDB: 2x53_S (P:165-326) Length = 162 Score = 24.2 bits (52), Expect = 9.0 Identities = 12/42 (28%), Positives = 17/42 (40%) Query: 67 VPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSG 108 P +L D+G Y I+F Q Q IL ++ G Sbjct: 74 TPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQG 115 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.326 0.142 0.395 Gapped Lambda K H 0.267 0.0484 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,134,502 Number of extensions: 50303 Number of successful extensions: 224 Number of sequences better than 10.0: 1 Number of HSP's gapped: 224 Number of HSP's successfully gapped: 22 Length of query: 153 Length of database: 4,956,049 Length adjustment: 81 Effective length of query: 72 Effective length of database: 2,217,844 Effective search space: 159684768 Effective search space used: 159684768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.0 bits)