RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780521|ref|YP_003064934.1| flagellar biosynthesis repressor FlbT [Candidatus Liberibacter asiaticus str. psy62] (153 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 36.1 bits (83), Expect = 0.004 Identities = 17/106 (16%), Positives = 32/106 (30%), Gaps = 37/106 (34%) Query: 51 IT-PFHQLYLI--VQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINS 107 + PFH L+ +I DL + + + + + + + Sbjct: 423 VASPFHSHLLVPASDLI---------NKDLVKNNV-----SFNAKDIQIPVYDTF----D 464 Query: 108 GRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQEIKSW-KSTQ 152 G ++R LS +I I I + W +TQ Sbjct: 465 GS------DLRVLS--GSISE-------RIVDCIIRLPVKWETTTQ 495 Score = 34.9 bits (80), Expect = 0.007 Identities = 23/169 (13%), Positives = 49/169 (28%), Gaps = 59/169 (34%) Query: 5 LRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAI--TPFHQLYLIVQ 62 L + L E +L G NDI H + + T + ++ Sbjct: 84 LNLCLTEFENCYLEG--------------NDI-----HALAAKLLQENDTTLVKTKELI- 123 Query: 63 MIFLVPTKKDY---LIDLGRRYINI----LFNIIQNQQL-ILAL----KNIESLINSGRF 110 K+Y I R + LF + ++A+ N + + Sbjct: 124 --------KNYITARIMAKRPFDKKSNSALFRAVGEGNAQLVAIFGGQGNTD------DY 169 Query: 111 FEALKNIRTL--SFIDNIDPNGSAIFASI------FQSIRQ---EIKSW 148 FE L+++ + ++ + + + + + I W Sbjct: 170 FEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILEW 218 Score = 26.1 bits (57), Expect = 4.0 Identities = 10/41 (24%), Positives = 16/41 (39%), Gaps = 11/41 (26%) Query: 76 DLGR----RYINILFNIIQNQQLILALKNIE-SLINSGRFF 111 +L + Y+N N L K +E SL+N + Sbjct: 343 NLTQEQVQDYVNKT-----NSHLPAG-KQVEISLVNGAKNL 377 >2ae0_X Membrane-bound lytic murein transglycosylase A; double-PSI beta-barrel, small mixed parallel/antiparallel six stranded beta barrel; 2.00A {Escherichia coli} SCOP: b.52.1.4 PDB: 2pjj_A 2pic_A 2pi8_A* 2gae_A Length = 345 Score = 27.5 bits (61), Expect = 1.3 Identities = 16/77 (20%), Positives = 37/77 (48%), Gaps = 8/77 (10%) Query: 76 DLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFA 135 D G++Y + F Q L+ + + IN+G F E + +IR S P + Sbjct: 7 DRGQQYKDGKFT--QPFSLVNQPDAVGAPINAGDFAEQINHIRNSS------PRLYGNQS 58 Query: 136 SIFQSIRQEIKSWKSTQ 152 +++ ++++ +++ T+ Sbjct: 59 NVYNAVQEWLRAGGDTR 75 >2fk4_A Protein E6; zinc binding domain, oncoprotein, metal binding protein; NMR {Human papillomavirus type 16} SCOP: g.90.1.1 Length = 75 Score = 27.1 bits (60), Expect = 1.9 Identities = 11/40 (27%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Query: 47 EEEAITPFHQLYL--IVQMIFLVPTKKDYLIDLGRRYINI 84 E++ P L + I L P +K +D +R+ NI Sbjct: 13 EQQYNKPLSDLLIRCINCQKPLSPEEKQRHLDKKQRFHNI 52 >3bmz_A Putative uncharacterized protein; violacein, biosynthetic protein; HET: PG4 PGE; 1.21A {Chromobacterium violaceum atcc 12472} PDB: 2zf3_A 2zf4_A* Length = 199 Score = 26.5 bits (58), Expect = 2.8 Identities = 10/37 (27%), Positives = 16/37 (43%), Gaps = 10/37 (27%) Query: 48 EEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINI 84 ++ PF +L+L +D L LG R+I Sbjct: 99 DDETGPFAELFL----------PRDVLRRLGARHIGR 125 >2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding, GET5, GET4; 1.99A {Saccharomyces cerevisiae} Length = 312 Score = 26.0 bits (57), Expect = 3.8 Identities = 8/26 (30%), Positives = 17/26 (65%) Query: 97 ALKNIESLINSGRFFEALKNIRTLSF 122 L+ E+ I +G ++EA + +RT++ Sbjct: 16 TLQRFENKIKAGDYYEAHQTLRTIAN 41 >2hqy_A Conserved hypothetical protein; PSI2, MAD, structural genomics, protein structure initiative; HET: COA; 1.80A {Bacteroides thetaiotaomicron vpi-5482} SCOP: d.108.1.4 d.108.1.4 Length = 305 Score = 25.6 bits (56), Expect = 5.3 Identities = 10/37 (27%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Query: 8 SLKAGERIFLNGAVVRVNNKV----ILELLNDITFIL 40 +L E + L G ++ VN K+ +N TF + Sbjct: 197 ALHNFEALGLTGGILHVNGKIVAFTFGMPINHETFGV 233 >2wzp_P Lactococcal phage P2 ORF15; baseplate, viral protein; 2.60A {Lactococcus phage P2} PDB: 2x53_S Length = 326 Score = 25.4 bits (55), Expect = 6.4 Identities = 12/42 (28%), Positives = 17/42 (40%) Query: 67 VPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSG 108 P +L D+G Y I+F Q Q IL ++ G Sbjct: 238 TPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQG 279 >3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein structure initiative; 2.43A {Pyrococcus furiosus dsm 3638} Length = 369 Score = 24.9 bits (53), Expect = 8.8 Identities = 8/28 (28%), Positives = 15/28 (53%) Query: 27 KVILELLNDITFILEHHVIREEEAITPF 54 V+ E+++ + + H REE I P+ Sbjct: 49 GVLEEIVSSLRMVGFTHYNREEMLIFPY 76 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.326 0.142 0.395 Gapped Lambda K H 0.267 0.0518 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,315,947 Number of extensions: 60604 Number of successful extensions: 219 Number of sequences better than 10.0: 1 Number of HSP's gapped: 219 Number of HSP's successfully gapped: 26 Length of query: 153 Length of database: 5,693,230 Length adjustment: 84 Effective length of query: 69 Effective length of database: 3,656,734 Effective search space: 252314646 Effective search space used: 252314646 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.3 bits)