BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780521|ref|YP_003064934.1| flagellar biosynthesis repressor FlbT [Candidatus Liberibacter asiaticus str. psy62] (153 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780521|ref|YP_003064934.1| flagellar biosynthesis repressor FlbT [Candidatus Liberibacter asiaticus str. psy62] Length = 153 Score = 305 bits (780), Expect = 3e-85, Method: Compositional matrix adjust. Identities = 153/153 (100%), Positives = 153/153 (100%) Query: 1 MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLI 60 MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLI Sbjct: 1 MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLI 60 Query: 61 VQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTL 120 VQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTL Sbjct: 61 VQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTL 120 Query: 121 SFIDNIDPNGSAIFASIFQSIRQEIKSWKSTQK 153 SFIDNIDPNGSAIFASIFQSIRQEIKSWKSTQK Sbjct: 121 SFIDNIDPNGSAIFASIFQSIRQEIKSWKSTQK 153 >gi|254780241|ref|YP_003064654.1| preprotein translocase subunit SecY [Candidatus Liberibacter asiaticus str. psy62] Length = 444 Score = 28.5 bits (62), Expect = 0.056, Method: Compositional matrix adjust. Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 10/81 (12%) Query: 50 AITPFHQLYLIVQMIF-LVPT----KKDY-----LIDLGRRYINILFNIIQNQQLILALK 99 I P+ +IVQ+I VP+ KK+ +I+ RY +L I+Q + + LK Sbjct: 85 GIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLK 144 Query: 100 NIESLINSGRFFEALKNIRTL 120 N + +++ +F I TL Sbjct: 145 NGQGIVSDSDYFFVFSTIITL 165 >gi|254781202|ref|YP_003065615.1| hypothetical protein CLIBASIA_05545 [Candidatus Liberibacter asiaticus str. psy62] Length = 864 Score = 25.0 bits (53), Expect = 0.66, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 19/30 (63%) Query: 76 DLGRRYINILFNIIQNQQLILALKNIESLI 105 DL R+ INIL + + N+ L L N+++ + Sbjct: 604 DLERKEINILKDKVSNKMHALVLDNVQTSV 633 >gi|254780480|ref|YP_003064893.1| 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 23.9 bits (50), Expect = 1.4, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 24 VNNKVILELLNDITFILEHHVI 45 V K +LE+ + + F+LEH I Sbjct: 306 VGAKAVLEVRSSVPFVLEHGQI 327 >gi|254780180|ref|YP_003064593.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Candidatus Liberibacter asiaticus str. psy62] Length = 360 Score = 23.1 bits (48), Expect = 2.4, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 7/56 (12%) Query: 1 MNSPLRIS--LKAGERIFLNG--AVVRVNNKVILELLNDITFILEHHVIREEEAIT 52 ++ PL IS L + FLN A+V N KVI LN + F H+ R E+ I+ Sbjct: 35 LSCPLVISDHLVSDLPAFLNSNDAIVFNNTKVITAQLNGVRFC---HINRREKEIS 87 >gi|254780245|ref|YP_003064658.1| 50S ribosomal protein L18 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Score = 22.7 bits (47), Expect = 3.5, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 12/21 (57%) Query: 1 MNSPLRISLKAGERIFLNGAV 21 +N PLR SLK G I AV Sbjct: 57 LNEPLRSSLKTGANIVAATAV 77 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.142 0.395 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,566 Number of Sequences: 1233 Number of extensions: 3660 Number of successful extensions: 15 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 10 length of query: 153 length of database: 328,796 effective HSP length: 67 effective length of query: 86 effective length of database: 246,185 effective search space: 21171910 effective search space used: 21171910 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 34 (17.7 bits)