RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780522|ref|YP_003064935.1| flagellar biosynthesis regulatory protein FlaF [Candidatus Liberibacter asiaticus str. psy62] (114 letters) >gnl|CDD|183750 PRK12793, flaF, flagellar biosynthesis regulatory protein FlaF; Reviewed. Length = 115 Score = 136 bits (345), Expect = 1e-33 Identities = 52/110 (47%), Positives = 78/110 (70%) Query: 5 YHETIQESSIECRKREHWILDRSISLLSIAHKSLPNSKQAVEALFYTSRVWVVFIQDLVS 64 Y E +++S R+RE DRSI LL A S++A+EAL++T R+W V I+DL S Sbjct: 6 YAEVMEDSVASARERERQAFDRSIDLLEAARAKGAYSREAIEALYFTRRLWTVLIEDLGS 65 Query: 65 EDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDGLK 114 +N LP+E++ +LISIGLWVLKE +RIR+ +SN++ +I++ + +RDGLK Sbjct: 66 PENALPEELRADLISIGLWVLKEADRIRQGESNNFAGLIEINTSIRDGLK 115 >gnl|CDD|148743 pfam07309, FlaF, Flagellar protein FlaF. This family consists of several bacterial FlaF flagellar proteins. FlaF and FlaG are trans-acting, regulatory factors that modulate flagellin synthesis during flagellum biogenesis. Length = 113 Score = 110 bits (277), Expect = 1e-25 Identities = 38/112 (33%), Positives = 64/112 (57%), Gaps = 1/112 (0%) Query: 2 RQYYHETIQESSIECRKREHWILDRSISLLSIAHKSLPNSKQAVEALFYTSRVWVVFIQD 61 + Y Q ++ R+RE L R+ + L A K+ ++A+EAL + ++W +F D Sbjct: 3 QSAYARVAQSTATP-REREAQALARATARLQQARKAGAAGREALEALHFNRKLWTIFAAD 61 Query: 62 LVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDGL 113 L S DN LPQE++ NLIS+GL+VLK ++ ++ +I++ + DGL Sbjct: 62 LASPDNPLPQELRANLISLGLFVLKHTSKVLAGPADDLDPLIEINRAIADGL 113 >gnl|CDD|183751 PRK12794, flaF, flagellar biosynthesis regulatory protein FlaF; Reviewed. Length = 122 Score = 49.9 bits (120), Expect = 2e-07 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Query: 45 VEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIID 104 EAL + ++W +F D+ DN LP E++ + ++ L+V K ++ R +ID Sbjct: 48 AEALHFNRKLWSIFASDVADPDNPLPIELRARIFNLSLFVQKHSSKVLRKP-EKLTPLID 106 Query: 105 VISIVRDGLK 114 + + GL Sbjct: 107 INRNIAAGLS 116 >gnl|CDD|179574 PRK03378, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional. Length = 292 Score = 26.8 bits (60), Expect = 1.4 Identities = 11/51 (21%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Query: 33 IAHKSLPNSKQAVEALFY--TSRVWVVFIQDLVSEDNHLPQEVKLNLISIG 81 + H P + E L++ TS+ + V ++ ++ + L L IG Sbjct: 11 VGHPRHPTALTTHEMLYHWLTSKGYEVIVEQQIAHELQLKNVKTGTLAEIG 61 >gnl|CDD|105645 PRK12430, PRK12430, putative bifunctional flagellar biosynthesis protein FliO/FliP; Provisional. Length = 379 Score = 26.4 bits (58), Expect = 1.8 Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 75 LNLISIGLWVLKECERIRRNKSNSYQDIIDVISI 108 + LI I W+LK+ + NK S II+ +S+ Sbjct: 34 ILLILILSWILKKISLFKINKIISRMKIIERLSL 67 >gnl|CDD|162306 TIGR01340, aconitase_mito, aconitate hydratase, mitochondrial. This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. Length = 745 Score = 26.4 bits (58), Expect = 1.9 Identities = 12/51 (23%), Positives = 22/51 (43%), Gaps = 13/51 (25%) Query: 64 SEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDGLK 114 + N P+++ LI C ++SY+D+ SIV+D + Sbjct: 334 VQKNGWPEKLSAGLIG-------SC------TNSSYEDMSRCASIVKDAEQ 371 >gnl|CDD|149788 pfam08841, DDR, Diol dehydratase reactivase ATPase-like domain. Diol dehydratase (DDH, EC:4.2.1.28) and its isofunctional homologue glycerol dehydratase (GDH, EC.4.2.1.30) are enzymes which catalyse the conversion of glycerol 1,2-propanediol, and 1,2-ethanediol to aldehydes. These reactions require coenzyme B12. Cleavage of the Co-C bond of coenzyme B12 by substrates or coenzyme analogues results in inactivation during which coenzyme B12 remains tightly bound to the apoenzyme. This family comprises of the large subunit of the diol dehydratase and glycerol dehydratase reactivating factors whose function is to reactivate the holoenzyme by exchange of a damaged cofactor for intact coenzyme. Length = 332 Score = 25.8 bits (57), Expect = 2.5 Identities = 8/18 (44%), Positives = 14/18 (77%) Query: 57 VFIQDLVSEDNHLPQEVK 74 +FIQDL++ D +P +V+ Sbjct: 54 IFIQDLLAVDTFVPVKVR 71 >gnl|CDD|180841 PRK07106, PRK07106, 5-aminoimidazole-4-carboxamide ribonucleotide transformylase; Provisional. Length = 390 Score = 25.0 bits (55), Expect = 4.1 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 14/55 (25%) Query: 58 FIQDLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDG 112 ++++V+E+ LP E K +LI I L LK +SNS + +DG Sbjct: 197 LLKNIVTENKELPDEAKRDLI-IALITLK------YTQSNS-------VCYAKDG 237 >gnl|CDD|183730 PRK12765, PRK12765, flagellar capping protein; Provisional. Length = 595 Score = 24.5 bits (53), Expect = 5.9 Identities = 7/19 (36%), Positives = 12/19 (63%) Query: 94 NKSNSYQDIIDVISIVRDG 112 +KS +Y+D+ D I+ G Sbjct: 149 DKSTTYRDLADKINEASGG 167 >gnl|CDD|178424 PLN02830, PLN02830, UDP-sugar pyrophosphorylase. Length = 615 Score = 24.3 bits (53), Expect = 6.9 Identities = 11/27 (40%), Positives = 13/27 (48%), Gaps = 10/27 (37%) Query: 45 VEALFYTS----------RVWVVFIQD 61 V AL Y+S + WVVF QD Sbjct: 256 VHALLYSSGLLDKWLSAGKKWVVFFQD 282 >gnl|CDD|177824 PLN02167, PLN02167, UDP-glycosyltransferase family protein. Length = 475 Score = 24.4 bits (53), Expect = 7.2 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Query: 12 SSIECRKREHWI-LDRSISLLSIAHKSLPNSKQA 44 +IE KR I LDR I ++I + SLP + QA Sbjct: 19 VTIEFAKR--LINLDRRIHTITILYWSLPFAPQA 50 >gnl|CDD|131719 TIGR02671, cas_csx9, CRISPR-associated protein (provisional), Csx9 family. Members of this family, so far, are archaeal proteins found in CRISPR-associated (cas) gene regions. So far, this rare cas protein is found in only three genomes: Pyrococcus horikoshii shinkaj OT3, Pyrococcus abyssi GE5, and Thermococcus kodakarensis KOD1. In each case it is found immediately upstream of cas3 in loci that resemble the Apern type but lack Csa1 and Csa4 genes. Length = 377 Score = 24.1 bits (52), Expect = 7.7 Identities = 12/49 (24%), Positives = 21/49 (42%) Query: 55 WVVFIQDLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDII 103 WVV L + L ++ L S+ + +I RN NS+ ++ Sbjct: 3 WVVMDAGLEPDPEELADALEGALDSLKSRAMINTSKIGRNDRNSFDRVL 51 >gnl|CDD|118190 pfam09658, Cas_Csx9, CRISPR-associated protein (Cas_Csx9). Clusters of short DNA repeats with nonhomologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry describes archaeal proteins encoded in cas gene regions. Length = 377 Score = 24.1 bits (52), Expect = 7.7 Identities = 12/49 (24%), Positives = 21/49 (42%) Query: 55 WVVFIQDLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDII 103 WVV L + L ++ L S+ + +I RN NS+ ++ Sbjct: 3 WVVMDAGLEPDPEELADALEGALDSLKSRAMINTSKIGRNDRNSFDRVL 51 >gnl|CDD|178635 PLN03086, PLN03086, PRLI-interacting factor K; Provisional. Length = 567 Score = 24.1 bits (52), Expect = 9.5 Identities = 9/18 (50%), Positives = 14/18 (77%) Query: 13 SIECRKREHWILDRSISL 30 ++ECR +H+I RSI+L Sbjct: 407 TVECRNCKHYIPSRSIAL 424 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.135 0.396 Gapped Lambda K H 0.267 0.0589 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,789,679 Number of extensions: 95717 Number of successful extensions: 164 Number of sequences better than 10.0: 1 Number of HSP's gapped: 164 Number of HSP's successfully gapped: 23 Length of query: 114 Length of database: 5,994,473 Length adjustment: 79 Effective length of query: 35 Effective length of database: 4,287,441 Effective search space: 150060435 Effective search space used: 150060435 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.3 bits)