RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780522|ref|YP_003064935.1| flagellar biosynthesis regulatory protein FlaF [Candidatus Liberibacter asiaticus str. psy62] (114 letters) >1y0k_A Hypothetical protein PA4535; structural genomics, midwest center for structural genomics, MCSG, pseudomonas aeuruginosa PAO1; 1.75A {Pseudomonas aeruginosa PAO1} (A:) Length = 209 Score = 26.9 bits (59), Expect = 1.1 Identities = 11/47 (23%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Query: 18 KREHWILDRSISLLSIAHKS---LPNSKQAVEALFYTSRVWVVFIQD 61 RE W+ R + L++ ++ +Q + LF + V F+ D Sbjct: 28 DRERWVCQRFLEALNVPYRQEDFAAPGEQPPDVLFKGAGFEVFFVLD 74 >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} (B:1-115) Length = 115 Score = 26.8 bits (59), Expect = 1.2 Identities = 12/47 (25%), Positives = 21/47 (44%) Query: 33 IAHKSLPNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLIS 79 + ++LPN + A +A FI + SE N + + + IS Sbjct: 24 MIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTIS 70 >2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} (A:77-96,A:251-368,A:438-463) Length = 164 Score = 25.9 bits (57), Expect = 2.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 57 VFIQDLVSEDNHLPQEVK 74 +FIQDL++ D +P V Sbjct: 97 IFIQDLLAVDTSVPVSVT 114 >1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} (A:77-95,A:253-371,A:442-466) Length = 163 Score = 25.6 bits (56), Expect = 2.2 Identities = 7/18 (38%), Positives = 15/18 (83%) Query: 57 VFIQDLVSEDNHLPQEVK 74 ++IQDL++ D +P++V+ Sbjct: 96 IYIQDLLAVDTFIPRKVQ 113 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.321 0.135 0.396 Gapped Lambda K H 0.267 0.0676 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 840,733 Number of extensions: 31009 Number of successful extensions: 47 Number of sequences better than 10.0: 1 Number of HSP's gapped: 47 Number of HSP's successfully gapped: 9 Length of query: 114 Length of database: 4,956,049 Length adjustment: 68 Effective length of query: 46 Effective length of database: 2,657,309 Effective search space: 122236214 Effective search space used: 122236214 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.1 bits)