RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780522|ref|YP_003064935.1| flagellar biosynthesis regulatory protein FlaF [Candidatus Liberibacter asiaticus str. psy62] (114 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 36.8 bits (85), Expect = 0.001 Identities = 13/82 (15%), Positives = 24/82 (29%), Gaps = 45/82 (54%) Query: 40 NSKQAVEALFY-----------TSRVWVVFIQDLVSEDN--------------------- 67 + ++A+ LF+ TS + ++D S +N Sbjct: 295 SVRKAITVLFFIGVRCYEAYPNTS-LPPSILED--SLENNEGVPSPMLSISNLTQEQVQD 351 Query: 68 -------HLPQEVKLNLISIGL 82 HLP + + I L Sbjct: 352 YVNKTNSHLPAGKQ---VEISL 370 Score = 30.7 bits (69), Expect = 0.082 Identities = 22/89 (24%), Positives = 33/89 (37%), Gaps = 20/89 (22%) Query: 3 QYYHET-----IQESSIECRK-REHWILDRSISLLSIAH---------KSLPNSKQAVEA 47 + Y T I E S+E + +L SIS L+ LP KQ + Sbjct: 312 EAYPNTSLPPSILEDSLENNEGVPSPML--SISNLTQEQVQDYVNKTNSHLPAGKQVEIS 369 Query: 48 LFYTSRVWVVF--IQDLVSEDNHLPQEVK 74 L ++ VV Q L + L ++ K Sbjct: 370 LVNGAKNLVVSGPPQSLYGLNLTL-RKAK 397 >1y0k_A Hypothetical protein PA4535; structural genomics, midwest center for structural genomics, MCSG, pseudomonas aeuruginosa PAO1; 1.75A {Pseudomonas aeruginosa PAO1} SCOP: c.52.1.31 Length = 209 Score = 25.7 bits (56), Expect = 2.6 Identities = 11/47 (23%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Query: 18 KREHWILDRSISLLSIAHKS---LPNSKQAVEALFYTSRVWVVFIQD 61 RE W+ R + L++ ++ +Q + LF + V F+ D Sbjct: 28 DRERWVCQRFLEALNVPYRQEDFAAPGEQPPDVLFKGAGFEVFFVLD 74 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 25.3 bits (54), Expect = 3.7 Identities = 7/37 (18%), Positives = 16/37 (43%), Gaps = 10/37 (27%) Query: 42 KQAVEALFYTSRVWVVFIQDLVSEDNHLPQ-EVKLNL 77 KQA++ L + +++ D+ P +K + Sbjct: 19 KQALKKLQASLKLYA---------DDSAPALAIKATM 46 >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Score = 25.3 bits (54), Expect = 3.8 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 18/60 (30%) Query: 59 IQDLVSEDNHLPQE----VKLNLISIGLWVLKECERIRRNKSNS-------YQ----DII 103 +Q+L + + QE K +L W ++ E++ +NK N+ YQ DII Sbjct: 98 LQELDAASKVMEQEWREKAKKDLEE---WNQRQSEQVEKNKINNRIADKAFYQQPDADII 154 >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 179 Score = 25.0 bits (54), Expect = 4.0 Identities = 10/42 (23%), Positives = 19/42 (45%) Query: 33 IAHKSLPNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVK 74 + ++LPN + A +A FI + SE N + + + Sbjct: 24 MIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSE 65 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.321 0.135 0.396 Gapped Lambda K H 0.267 0.0450 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 951,804 Number of extensions: 35974 Number of successful extensions: 60 Number of sequences better than 10.0: 1 Number of HSP's gapped: 60 Number of HSP's successfully gapped: 8 Length of query: 114 Length of database: 5,693,230 Length adjustment: 77 Effective length of query: 37 Effective length of database: 3,826,442 Effective search space: 141578354 Effective search space used: 141578354 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.7 bits)